Search Results

Search found 21005 results on 841 pages for 'disk format'.

Page 283/841 | < Previous Page | 279 280 281 282 283 284 285 286 287 288 289 290  | Next Page >

• Python Imaging: YCbCr problems

  - by daver

  Hi, I'm doing some image processing in Python using PIL, I need to extract the luminance layer from a series of images, and do some processing on that using numpy, then put the edited luminance layer back into the image and save it. The problem is, I can't seem to get any meaningful representation of my Image in a YCbCr format, or at least I don't understand what PIL is giving me in YCbCr. PIL documentation claims YCbCr format gives three channels, but when I grab the data out of the image using np.asarray, I get 4 channels. Ok, so I figure one must be alpha. Here is some code I'm using to test this process: import Image as im import numpy as np pengIm = im.open("Data\\Test\\Penguins.bmp") yIm = pengIm.convert("YCbCr") testIm = np.asarray(yIm) grey = testIm[:,:,0] grey = grey.astype('uint8') greyIm = im.fromarray(grey, "L") greyIm.save("Data\\Test\\grey.bmp") I'm expecting a greyscale version of my image, but what I get is this jumbled up mess: http://i.imgur.com/zlhIh.png Can anybody explain to me where I'm going wrong? The same code in matlab works exactly as I expect.

  Read the article

• Use boost date_time to parse and create HTTP-dates

  - by John Price

  I'm writing a kind of HTTP proxy, so I need to be able to do 3 things: Parse an HTTP-date given any of the 3 formats specified in RFC 2616, sec 3.3, Convert a file date-time to an HTTP-date string, and Output the date to a string. For reference, theses are examples of the date-times I need to parse. I will output only the first format: Sun, 06 Nov 1994 08:49:37 GMT ; RFC 822, updated by RFC 1123 Sunday, 06-Nov-94 08:49:37 GMT ; RFC 850, obsoleted by RFC 1036 Sun Nov 6 08:49:37 1994 ; ANSI C's asctime() format I'm pretty sure Boost date_time can do all of this, but I'm having some trouble with number 1. Does anyone already have code to do this? Perhaps I'm not using google proficiently, but I can't find an example of how to do this with boost anywhere. Thanks for any help!

  Read the article

• Autocomplete server-side implementation

  - by toluju

  What is a fast and efficient way to implement the server-side component for an autocomplete feature in an html input box? I am writing a service to autocomplete user queries in our web interface's main search box, and the completions are displayed in an ajax-powered dropdown. The data we are running queries against is simply a large table of concepts our system knows about, which matches roughly with the set of wikipedia page titles. For this service obviously speed is of utmost importance, as responsiveness of the web page is important to the user experience. The current implementation simply loads all concepts into memory in a sorted set, and performs a simple log(n) lookup on a user keystroke. The tailset is then used to provide additional matches beyond the closest match. The problem with this solution is that it does not scale. It currently is running up against the VM heap space limit (I've set -Xmx2g, which is about the most we can push on our 32 bit machines), and this prevents us from expanding our concept table or adding more functionality. Switching to 64-bit VMs on machines with more memory isn't an immediate option. I've been hesitant to start working on a disk-based solution as I am concerned that disk seek time will kill performance. Are there possible solutions that will let me scale better, either entirely in memory or with some fast disk-backed implementations? Edits: @Gandalf: For our use case it is important the the autocompletion is comprehensive and isn't just extra help for the user. As for what we are completing, it is a list of concept-type pairs. For example, possible entries are [("Microsoft", "Software Company"), ("Jeff Atwood", "Programmer"), ("StackOverflow.com", "Website")]. We are using Lucene for the full search once a user selects an item from the autocomplete list, but I am not yet sure Lucene would work well for the autocomplete itself. @Glen: No databases are being used here. When I'm talking about a table I just mean the structured representation of my data. @Jason Day: My original implementation to this problem was to use a Trie, but the memory bloat with that was actually worse than the sorted set due to needing a large number of object references. I'll read on the ternary search trees to see if it could be of use.

  Read the article

• Why must "stride" in the System.Drawing.Bitmap constructor be a multiple of 4?

  - by Gorchestopher H

  I am writing an application that requires me to take a proprietary bitmap format (an MVTec Halcon HImage) and convert it into a System.Drawing.Bitmap in C#. The only proprietary functions given to me to help me do this involve me writing to file, except for the use of a "get pointer" function. This function is great, it gives me a pointer to the pixel data, the width, the height, and the type of the image. My issue is that when I create my System.Drawing.Bitmap using the constructor: new System.Drawing.Bitmap(width, height, stride, format, scan) I need to specify a "stride" that is a multiple of 4. This may be a problem as I am unsure what size bitmap my function will be hit with. Supposing I end up with a bitmap that is 111x111 pixels, I have no way to run this function other than adding a bogus column to my image or subtracting 3 columns. Is there a way I can sneak around this limitation?

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• trying to find php library to convert pdf to chm

  - by justjoe

  is there any library or PHP project to manipulate pdf and change it into chm format ?

  Read the article

• java version of python-dateutil

  - by elhefe

  Python has a very handy package that can parse nearly any unambiguous date and provides helpful error messages on a parse failure, python-dateutil. Comparison to the SimpleDateFormat class is not favorable - AFAICT SimpleDateFormat can only handle one exact date format and the error messages have no granularity. I've looked through the Joda API but it appears Joda is the same way - only one explicit format can be parsed at a time. Is there any package or library that reproduces the python-dateutil behavior? Or am I missing something WRT Joda/SimpleDateFormat?

  Read the article

• How to serve a View as CSV in ASP.NET Web Forms

  - by ChessWhiz

  Hi, I have a MS SQL view that I want to make available as a CSV download in my ASPNET Web Forms app. I am using Entity Framework for other views and tables in the project. What's the best way to enable this download? I could add a HyperLink whose click handler iterates over the view, writes its CSV form to the disk, and then serves that file. However, I'd prefer not to write to the disk if it can be avoided, and that involves iteration code that may be avoided with some other solution. Any ideas?

  Read the article

• Red Hat cluster: Failure of one of two services sharing the same virtual IP tears down IP

  - by js.

  I'm creating a 2+1 failover cluster under Red Hat 5.5 with 4 services of which 2 have to run on the same node, sharing the same virtual IP address. One of the services on each node needs a (SAN) disk, the other doesn't. I'm using HA-LVM. When I shut down (via ifdown) the two interfaces connected to the SAN to simulate SAN failure, the service needing the disk is disabled, the other keeps running, as expected. Surprisingly (and unfortunately), the virtual IP address shared by the two services on the same machine is also removed, rendering the still-running service useless. How can I configure the cluster to keep the IP address up?

  Read the article

• API for accessing PHP documentation?

  - by Chad Johnson

  I'm done some Googling, and I've found nothing. I'm scoping out writing a plugin for an editor I use, and I am wondering whether there is a way I can access the PHP documentation via an API? For instance, I'd like to get raw access to the information (besides the comments) located here: http://php.net/file_exists. php.net seemingly uses MediaWiki which provides an API. The tutorial provides the example URL, http://en.wikipedia.org/w/api.php?action=login&format=xml. This does not work for php.net, however (http://php.net/w/api.php?action=login&format=xml). I'm just looking for a little information on how to interface with the PHP documentation.

  Read the article

• How to send a Timestamp field to Oracle stored proc. from Java despite the DB config?

  - by Alfabravo

  I'm making a request from a java webapp to an Oracle' stored procedure which happens to have a Timestamp IN parameter. In the testing environment, it works sending: SimpleDateFormat dateFormat = new SimpleDateFormat("dd-MMM-yyyy hh:mm:ss a"); input.setTimestampField(dateFormat.format(new Date())); But in the production environment, it raises an exception ORA-01830: date format picture ends before converting entire input string. I know the testing environment should be a replica of the production site, but it is not in my hands to set them properly. And I need to send the Timestamp field despite the way they setup the database. Any ideas? Thanks in advance.

  Read the article

• current_date casting

  - by Armen Mkrtchyan

  Hi. string selectSql = "update " + table + " set state_" + mode + "_id=1 WHERE stoping_" + mode + " < current_date;"; when i call current_date, it return yyyy-MM-dd format, but i want to return dd.MM.yyyy format, how can i do that. please help. my program works fine when i am trying string selectSql = "update " + table + " set state_" + mode + "_id=1 WHERE stoping_" + mode + " < '16.04.2010';";

  Read the article

• R: Using sapply on vector of POSIXct

  - by Chris

  I have what may be a very simple question. I want to process a column of POSIXct objects from a dataframe and generate a vector of datetime strings. I tried to use the following sapply call dt <- sapply(df$datetime, function(x) format(x,"%Y-%m-%dT%H:%M:%S")) but to no avail. I keep getting the following error Error in prettyNum(.Internal(format(x, trim, digits, nsmall, width, 3L, : invalid 'trim' argument When I apply this function to a single POSIXct object from the column, I have no problem. So I'm stumped at the moment about what the problem is. Do I need to do something special with POSIXct objects?

  Read the article

• Microsoft Word Document Controls not accepting carriage returns

  - by Scott

  So, I have a Microsoft Word 2007 Document with several Plain Text Format (I have tried Rich Text Format as well) controls which accept input via XML. For carriage returns, I had the string being passed through XML containing "\r\n" when I wanted a carriage return, but the word document ignored that and just kept wrapping things on the same line. I also tried replacing the \r\n with System.Environment.NewLine in my C# mapper, but that just put in \r\n anyway, which still didn't work. Note also that on the control itself I have set it to "Allow Carriage Returns (Multiple Paragrpahs)" in the control properties. This is the XML for the listMapper <Field id="32" name="32" fieldType="SimpleText"> <DataSelector path="/Data/DB/DebtProduct"> <InputField fieldType="" path="/Data/DB/Client/strClientFirm" link="" type=""/> <InputField fieldType="" path="strClientRefDebt" link="" type=""/> </DataSelector> <DataMapper formatString="{0} Account Number: {1}" name="SimpleListMapper" type=""> <MapperData> </MapperData> </DataMapper> </Field> Note that this is the listMapper C# where I actually map the list (notice where I try and append the system.environment.newline) namespace DocEngine.Core.DataMappers { public class CSimpleListMapper:CBaseDataMapper { public override void Fill(DocEngine.Core.Interfaces.Document.IControl control, CDataSelector dataSelector) { if (control != null && dataSelector != null) { ISimpleTextControl textControl = (ISimpleTextControl)control; IContent content = textControl.CreateContent(); CInputFieldCollection fileds = dataSelector.Read(Context); StringBuilder builder = new StringBuilder(); if (fileds != null) { foreach (List<string> lst in fileds) { if (CanMap(lst) == false) continue; if (builder.Length > 0 && lst[0].Length > 0) builder.Append(Environment.NewLine); if (string.IsNullOrEmpty(FormatString)) builder.Append(lst[0]); else builder.Append(string.Format(FormatString, lst.ToArray())); } content.Value = builder.ToString(); textControl.Content = content; applyRules(control, null); } } } } } Does anybody have any clue at all how I can get MS Word 2007 (docx) to quit ignoring my newline characters??

  Read the article

• Fully automated SQL Server Restore

  - by hasen j

  I'm not very fluent with SQL Server commands. I need a script to restore a database from a .bak file and move the logical_data and logical_log files to a specific path. I can do: restore filelistonly from disk='D:\backups\my_backup.bak' This will give me a result set with a column LogicalName, next I need to use the logical names from the result set in the restore command: restore database my_db_name from disk='d:\backups\my_backups.bak' with file=1, move 'logical_data_file' to 'd:\data\mydb.mdf', move 'logical_log_file' to 'd:\data\mylog.ldf' How do I capture the logical names from the first result set into variables that can be supplied to the "move" command? I think the solution might be trivial, but I'm pretty new to SQL Server.

  Read the article

• How does the iPhone SDK Core Data system store date types to sqlite?

  - by Andrew Arrow

  I used core data to do this: NSManagedObjectContext *m = [self managedObjectContext]; Foo *f = (Foo *)[NSEntityDescription insertNewObjectForEntityForName:@"Foo" inManagedObjectContext:m]; f.created_at = [NSDate date]; [m insertObject:f]; NSError *error; [m save:&error]; Where the created_at field is defined as type "Date" in the xcdatamodel. When I export the sql from the sqlite database it created, created_at is defined as type "timestamp" and the values look like: 290902422.72624 Nine digits before the . and then some fraction. What is this format? It's not epoch time and it's not julianday format. Epoch would be: 1269280338.81213 julianday would be: 2455278.236746875 (notice only 7 digits before the . not 9 like I have) How can I convert a number like 290902422.72624 to epoch time? Thanks!

  Read the article

• rails, rest, render different action with responds to

  - by Sam

  Maybe my logic is not restful or know if this is how you would do it but this is what I am trying to do. I'm getting a category inside a category controller and then once I get that category I want to return to an index page in a different controller but keep that @category and the Category.busineses. Before rest I would have just done this: render :controller = "businesses" and it would have rendered the view of the index action in that controller. now in my respond_to block I have this format.html {redirect_to(business_path)} # index.html.erb format.xml { render :xml => @businesses } but of course with a render it looses the instance variable and starts with a new action. So what I want to do is render the action instead of redirecting to that action. is this possible?

  Read the article

• mdadm: Win7-install created a boot partition on one of my RAID6 drives. How to rebuild?

  - by EXIT_FAILURE

  My problem happened when I attempted to install Windows 7 on it's own SSD. The Linux OS I used which has knowledge of the software RAID system is on a SSD that I disconnected prior to the install. This was so that windows (or I) wouldn't inadvertently mess it up. However, and in retrospect, foolishly, I left the RAID disks connected, thinking that windows wouldn't be so ridiculous as to mess with a HDD that it sees as just unallocated space. Boy was I wrong! After copying over the installation files to the SSD (as expected and desired), it also created an ntfs partition on one of the RAID disks. Both unexpected and totally undesired! . I changed out the SSDs again, and booted up in linux. mdadm didn't seem to have any problem assembling the array as before, but if I tried to mount the array, I got the error message: mount: wrong fs type, bad option, bad superblock on /dev/md0, missing codepage or helper program, or other error In some cases useful info is found in syslog - try dmesg | tail or so dmesg: EXT4-fs (md0): ext4_check_descriptors: Block bitmap for group 0 not in group (block 1318081259)! EXT4-fs (md0): group descriptors corrupted! I then used qparted to delete the newly created ntfs partition on /dev/sdd so that it matched the other three /dev/sd{b,c,e}, and requested a resync of my array with echo repair > /sys/block/md0/md/sync_action This took around 4 hours, and upon completion, dmesg reports: md: md0: requested-resync done. A bit brief after a 4-hour task, though I'm unsure as to where other log files exist (I also seem to have messed up my sendmail configuration). In any case: No change reported according to mdadm, everything checks out. mdadm -D /dev/md0 still reports: Version : 1.2 Creation Time : Wed May 23 22:18:45 2012 Raid Level : raid6 Array Size : 3907026848 (3726.03 GiB 4000.80 GB) Used Dev Size : 1953513424 (1863.02 GiB 2000.40 GB) Raid Devices : 4 Total Devices : 4 Persistence : Superblock is persistent Update Time : Mon May 26 12:41:58 2014 State : clean Active Devices : 4 Working Devices : 4 Failed Devices : 0 Spare Devices : 0 Layout : left-symmetric Chunk Size : 4K Name : okamilinkun:0 UUID : 0c97ebf3:098864d8:126f44e3:e4337102 Events : 423 Number Major Minor RaidDevice State 0 8 16 0 active sync /dev/sdb 1 8 32 1 active sync /dev/sdc 2 8 48 2 active sync /dev/sdd 3 8 64 3 active sync /dev/sde Trying to mount it still reports: mount: wrong fs type, bad option, bad superblock on /dev/md0, missing codepage or helper program, or other error In some cases useful info is found in syslog - try dmesg | tail or so and dmesg: EXT4-fs (md0): ext4_check_descriptors: Block bitmap for group 0 not in group (block 1318081259)! EXT4-fs (md0): group descriptors corrupted! I'm a bit unsure where to proceed from here, and trying stuff "to see if it works" is a bit too risky for me. This is what I suggest I should attempt to do: Tell mdadm that /dev/sdd (the one that windows wrote into) isn't reliable anymore, pretend it is newly re-introduced to the array, and reconstruct its content based on the other three drives. I also could be totally wrong in my assumptions, that the creation of the ntfs partition on /dev/sdd and subsequent deletion has changed something that cannot be fixed this way. My question: Help, what should I do? If I should do what I suggested , how do I do that? From reading documentation, etc, I would think maybe: mdadm --manage /dev/md0 --set-faulty /dev/sdd mdadm --manage /dev/md0 --remove /dev/sdd mdadm --manage /dev/md0 --re-add /dev/sdd However, the documentation examples suggest /dev/sdd1, which seems strange to me, as there is no partition there as far as linux is concerned, just unallocated space. Maybe these commands won't work without. Maybe it makes sense to mirror the partition table of one of the other raid devices that weren't touched, before --re-add. Something like: sfdisk -d /dev/sdb | sfdisk /dev/sdd Bonus question: Why would the Windows 7 installation do something so st...potentially dangerous? Update I went ahead and marked /dev/sdd as faulty, and removed it (not physically) from the array: # mdadm --manage /dev/md0 --set-faulty /dev/sdd # mdadm --manage /dev/md0 --remove /dev/sdd However, attempting to --re-add was disallowed: # mdadm --manage /dev/md0 --re-add /dev/sdd mdadm: --re-add for /dev/sdd to /dev/md0 is not possible --add, was fine. # mdadm --manage /dev/md0 --add /dev/sdd mdadm -D /dev/md0 now reports the state as clean, degraded, recovering, and /dev/sdd as spare rebuilding. /proc/mdstat shows the recovery progress: md0 : active raid6 sdd[4] sdc[1] sde[3] sdb[0] 3907026848 blocks super 1.2 level 6, 4k chunk, algorithm 2 [4/3] [UU_U] [>....................] recovery = 2.1% (42887780/1953513424) finish=348.7min speed=91297K/sec nmon also shows expected output: ¦sdb 0% 87.3 0.0| > |¦ ¦sdc 71% 109.1 0.0|RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR > |¦ ¦sdd 40% 0.0 87.3|WWWWWWWWWWWWWWWWWWWW > |¦ ¦sde 0% 87.3 0.0|> || It looks good so far. Crossing my fingers for another five+ hours :) Update 2 The recovery of /dev/sdd finished, with dmesg output: [44972.599552] md: md0: recovery done. [44972.682811] RAID conf printout: [44972.682815] --- level:6 rd:4 wd:4 [44972.682817] disk 0, o:1, dev:sdb [44972.682819] disk 1, o:1, dev:sdc [44972.682820] disk 2, o:1, dev:sdd [44972.682821] disk 3, o:1, dev:sde Attempting mount /dev/md0 reports: mount: wrong fs type, bad option, bad superblock on /dev/md0, missing codepage or helper program, or other error In some cases useful info is found in syslog - try dmesg | tail or so And on dmesg: [44984.159908] EXT4-fs (md0): ext4_check_descriptors: Block bitmap for group 0 not in group (block 1318081259)! [44984.159912] EXT4-fs (md0): group descriptors corrupted! I'm not sure what do do now. Suggestions? Output of dumpe2fs /dev/md0: dumpe2fs 1.42.8 (20-Jun-2013) Filesystem volume name: Atlas Last mounted on: /mnt/atlas Filesystem UUID: e7bfb6a4-c907-4aa0-9b55-9528817bfd70 Filesystem magic number: 0xEF53 Filesystem revision #: 1 (dynamic) Filesystem features: has_journal ext_attr resize_inode dir_index filetype extent flex_bg sparse_super large_file huge_file uninit_bg dir_nlink extra_isize Filesystem flags: signed_directory_hash Default mount options: user_xattr acl Filesystem state: clean Errors behavior: Continue Filesystem OS type: Linux Inode count: 244195328 Block count: 976756712 Reserved block count: 48837835 Free blocks: 92000180 Free inodes: 243414877 First block: 0 Block size: 4096 Fragment size: 4096 Reserved GDT blocks: 791 Blocks per group: 32768 Fragments per group: 32768 Inodes per group: 8192 Inode blocks per group: 512 RAID stripe width: 2 Flex block group size: 16 Filesystem created: Thu May 24 07:22:41 2012 Last mount time: Sun May 25 23:44:38 2014 Last write time: Sun May 25 23:46:42 2014 Mount count: 341 Maximum mount count: -1 Last checked: Thu May 24 07:22:41 2012 Check interval: 0 (<none>) Lifetime writes: 4357 GB Reserved blocks uid: 0 (user root) Reserved blocks gid: 0 (group root) First inode: 11 Inode size: 256 Required extra isize: 28 Desired extra isize: 28 Journal inode: 8 Default directory hash: half_md4 Directory Hash Seed: e177a374-0b90-4eaa-b78f-d734aae13051 Journal backup: inode blocks dumpe2fs: Corrupt extent header while reading journal super block

  Read the article

• Formatting when copying SQL data and pasting in Excel

  - by Mary-Chan

  I want to copy a sql result set and paste it in Excel. But the data I paste in to the spreadsheet doesn't want to recognize Excel formatting. So if I change a column to currency, it doesn't do anything. But...if I double click on a cell, THEN it applies the currency format. But only to that cell. How can I make it automatically recognize the Excel format? I must be something I'm missing. Hopefully somebody can help. :-)

  Read the article

• Subversion pre-commit hook to clean XML from WebDAV autocommit client

  - by rjmunro

  I know that it isn't normally safe to modify a commit from a pre-commit hook in Subversion because SVN clients will not see the version that has been committed, and will cache the wrong thing, but I'd like to clean the code from a versioning-naïve WebDAV client that won't keep a local cached copy. The idea is that when I look at the repository with an SVN client, the diffs are clean. The client, by the way is MS Word, using 2003 XML format files. We're already using this format in a WebDAV system, but we'd like to add a versioning capability for expert users. Everywhere I look for documentation on how to modify the code in a pre-commit hook, I get the answer "Don't do this", not the answer "Here's how to do this, but it's reccomeded you don't", so I can't even easily try it to see if it's going to cause me problems.

  Read the article

• How to obtain the first cluster of the directory's data in FAT using C# (or at least C++) and Win32A

  - by DarkWalker

  So I have a FAT drive, lets say H: and a directory 'work' (full path 'H:\work'). I need to get the NUMBER of the first cluster of that directory. The number of the first cluster is 2-bytes value, that is stored in the 26th and 27th bytes of the folder enty (wich is 32 bytes). Lets say I am doing it with file, NOT a directory. I can use code like this: static public string GetDirectoryPtr(string dir) { IntPtr ptr = CreateFile(@"H:\Work\dover.docx", GENERIC_READ, FILE_SHARE_READ | FILE_SHARE_WRITE, IntPtr.Zero, OPEN_EXISTING, 0,//FILE_FLAG_BACKUP_SEMANTICS, IntPtr.Zero); try { const uint bytesToRead = 2; byte[] readbuffer = new byte[bytesToRead]; if (ptr.ToInt32() == -1) return String.Format("Error: cannot open direcotory {0}", dir); if (SetFilePointer(ptr, 26, 0, 0) == -1) return String.Format("Error: unable to set file pointer on file {0}", ptr); uint read = 0; // real count of read bytes if (!ReadFile(ptr, readbuffer, bytesToRead, out read, 0)) return String.Format("cant read from file {0}. Error #{1}", ptr, Marshal.GetLastWin32Error()); int result = readbuffer[0] + 16 * 16 * readbuffer[1]; return result.ToString();//ASCIIEncoding.ASCII.GetString(readbuffer); } finally { CloseHandle(ptr); } } And it will return some number, like 19 (quite real to me, this is the only file on the disk). But I DONT need a file, I need a folder. So I am puttin FILE_FLAG_BACKUP_SEMANTICS param for CreateFile call... and dont know what to do next =) msdn is very clear on this issue http://msdn.microsoft.com/en-us/library/aa365258(v=VS.85).aspx It sounds to me like: "There is no way you can get a number of the folder's first cluster". The most desperate thing is that my tutor said smth like "You are going to obtain this or you wont pass this course". The true reason why he is so sure this is possible is because for 10 years (or may be more) he recieved the folder's first cluster number as a HASH of the folder's addres (and I was stupid enough to point this to him, so now I cant do it the same way) PS: This is the most spupid task I have ever had!!! This value is not really used anythere in program, it is only fcking pointless integer.

  Read the article

• Is it possible to convert Gregorian to Hijri date in Vb ?

  - by ahmed

  Hi, I have a table in sql where the date format is stored in Hijri. Now I am working on a vb.net application where I have to let the user update that dateField. So is it possible that if I place a datepicker(which is in Gregorian) and user selects the date and its converts into Hijri date before updating. I mean when the user selects the date and clicks the save button the date should be updated in hijri format in the sql . For now , the user is entering the date manually on a tms AdvEdit. Is there any code available to accomplish this task. Thanking you all in advance for your time and consideration.

  Read the article

• SMS Receiving using DOTNET C#

  - by sheery

  Hi dears, I have build an application using C# to send and receive sms, my application works fine for sending sms but when i try to read sms from my mobile through my application i get following error "Error: Phone reports generic communication error or syntax error." can any one help me in this matter, my syntax for reading sms is private void btnReadMessages_Click(object sender, System.EventArgs e) { Cursor.Current = Cursors.WaitCursor; string storage = GetMessageStorage(); try { // Read all SMS messages from the storage DecodedShortMessage[] messages = comm.ReadMessages(PhoneMessageStatus.All, storage); foreach(DecodedShortMessage message in messages) { Output(string.Format("Message status = {0}, Location = {1}/{2}", StatusToString(message.Status), message.Storage, message.Index)); ShowMessage(message.Data); Output(""); } Output(string.Format("{0,9} messages read.", messages.Length.ToString())); Output(""); } catch(Exception ex) { ShowException(ex); } Cursor.Current = Cursors.Default; }

  Read the article

• Creating avatar from uploaded image

  - by mamu

  We are using asp.net with .net 4.0 We want to allow users to upload any image and we want to create tiny avatar for uploaded image? What is the best way to convert uploaded images for avatar? We want to keep the same height width ratio if we can convert gif, bmp, jpg, png to one standard format it would be greate. Which could be the best format to convert it to? i think converting gif would be best option. am i correct? any open source option i can look at

  Read the article

• What is the fastest way to display an image in QT on X11 without OpenGL?

  - by msh

  I need to display a raw image in a QT widget. I'm running X11 on a framebuffer, so OpenGL is not available. Both the image and the framebuffer are in the same format - RGB565, but I can change it to any other format if needed. I don't need blending or scaling. I just need to display pixels as is. I'm using QPainter::drawImage, but it converts QImage to QPixmap and this conversion seems to be very slow. Also it is backed by Xrender and I think there is unnecessary overhead required to support blending in Xrender which I don't really need Is there any better way? If it is not available in QT, I can use Xlib or any other library or protocol. I can modify the driver, X server or anything else.

  Read the article

< Previous Page | 279 280 281 282 283 284 285 286 287 288 289 290  | Next Page >