Search Results

Search found 101795 results on 4072 pages for 'encrypting file system'.

Page 29/4072 | < Previous Page | 25 26 27 28 29 30 31 32 33 34 35 36  | Next Page >

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • Uninstalling demo/trial of Visual Studio 2008 Team System

    - by Ian Ringrose
    I wish to uninstall the trail copy of VS 2008 Team System, as the trial is coming to its end. I had VS 2008 Professional Edition installed on the machine to start with and it still shows up in Add/Remove Problems. I am hoping that when I uninstall VS 2008 Team System I will be left with a working VS 2008 Professional Edition. When I try to uninstall VS 2008 Team System, I very quickly get an error dialog that says: A problem has been encountered while loading the setup components. Canceling setup. Help! Progress or lack there of so fare I have done dir %temp%*.log in a command prompt and can see any log files that are recent I am going to read http://en.wikipedia.org/wiki/Windows_Installer#Diagnostic_logging to see if I can get any logging Aaron Stebner's WebLog has a post on where VS put's is log files, he also has a post on were some other products put there log files gives some info about where VS setup puts it's logs etc Aaron Ruckman provided me with the solution after I sent him the log files.

    Read the article

  • system() copy fails, while cmd copy works

    - by Mike
    In cmd.exe, I can execute the command "copy c:\hello.txt c:\hello2.txt" and it worked fine. But in my C program, I ran this piece of code and got the following error: #include <iostream> using namespace std; int main() { system("copy c:\hello.txt c:\hello2.txt"); system("pause"); return 0; } Output: The system cannot find the file specified. Anybody know what is going on here?

    Read the article

  • Delete System Files containing string

    - by Fuzz Evans
    I am trying to write a batch file that will examine a given directory, read each file for a given string "Example" and then delete any files that contain the string. The files are also System Files so I don't know what the exact extension is or if that matters (maybe you can just omit a file type filter and have it read all files?). Some of the files will be locked from reading as well so it needs to handle access denial errors if that occurs, not sure how batch files handle that.

    Read the article

  • Reading data from text file in C

    - by themake
    I have a text file which contains words separated by space. I want to take each word from the file and store it. So i have opened the file but am unsure how to assign the word to a char. FILE *fp; fp = fopen("file.txt", "r"); //then i want char one = the first word in the file char two = the second word in the file

    Read the article

  • opening and viewing a file in php

    - by Christian Burgos
    how do i open/view for editing an uploaded file in php? i have tried this but it doesn't open the file. $my_file = 'file.txt'; $handle = fopen($my_file, 'r'); $data = fread($handle,filesize($my_file)); i've also tried this but it wont work. $my_file = 'file.txt'; $handle = fopen($my_file, 'w') or die('Cannot open file: '.$my_file); $data = 'This is the data'; fwrite($handle, $data); what i have in mind is like when you want to view an uploaded resume,documents or any other ms office files like .docx,.xls,.pptx and be able to edit them, save and close the said file. edit: latest tried code... <?php // Connects to your Database include "configdb.php"; //Retrieves data from MySQL $data = mysql_query("SELECT * FROM employees") or die(mysql_error()); //Puts it into an array while($info = mysql_fetch_array( $data )) { //Outputs the image and other data //Echo "<img src=localhost/uploadfile/images".$info['photo'] ."> <br>"; Echo "<b>Name:</b> ".$info['name'] . "<br> "; Echo "<b>Email:</b> ".$info['email'] . " <br>"; Echo "<b>Phone:</b> ".$info['phone'] . " <hr>"; //$file=fopen("uploadfile/images/".$info['photo'],"r+"); $file=fopen("Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt","r") or exit("unable to open file");; } ?> i am getting the error: Warning: fopen(Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt): failed to open stream: No such file or directory in /Applications/XAMPP/xamppfiles/htdocs/uploadfile/view.php on line 17 unable to open file the file is in that folder, i don't know it wont find it.

    Read the article

  • How to run system-commands in the background?

    - by sid_com
    #!/usr/bin/env perl use warnings; use strict; use 5.012; use IPC::System::Simple qw(system); system( 'xterm', '-geometry', '80x25-5-5', '-bg', 'green', '&' ); say "Hello"; say "World"; I tried this to run the xterm-command in the background, but it doesn't work: No absolute path found for shell: & What would be the right way to make it work?

    Read the article

  • Copied a file with winscp; only winscp can see it

    - by nilbus
    I recently copied a 25.5GB file from another machine using WinSCP. I copied it to C:\beth.tar.gz, and WinSCP can still see the file. However no other app (including Explorer) can see the file. What might cause this, and how can I fix it? The details that might or might not matter WinSCP shows the size of the file (C:\beth.tar.gz) correctly as 27,460,124,080 bytes, which matches the filesize on the remote host Neither explorer, cmd (command line prompt w/ dir C:\), the 7Zip archive program, nor any other File Open dialog can see the beth.tar.gz file under C:\ I have configured Explorer to show hidden files I can move the file to other directories using WinSCP If I try to move the file to Users/, UAC prompts me for administrative rights, which I grant, and I get this error: Could not find this item The item is no longer located in C:\ When I try to transfer the file back to the remote host in a new directory, the transfer starts successfully and transfers data The transfer had about 30 minutes remaining when I left it for the night The morning after the file transfer, I was greeted with a message saying that the connection to the server had been lost. I don't think this is relevant, since I did not tell it to disconnect after the file was done transferring, and it likely disconnected after the file transfer finished. I'm using an old version of WinSCP - v4.1.8 from 2008 I can view the file properties in WinSCP: Type of file: 7zip (.gz) Location: C:\ Attributes: none (Ready-only, Hidden, Archive, or Ready for indexing) Security: SYSTEM, my user, and Administrators group have full permissions - everything other than "special permissions" is checked under Allow for all 3 users/groups (my user, Administrators, SYSTEM) What's going on?!

    Read the article

  • C++, Ifstream opens local file but not file on HTTP Server

    - by fammi
    Hi, I am using ifstream to open a file and then read from it. My program works fine when i give location of the local file on my system. for eg /root/Desktop/abc.xxx works fine But once the location is on the http server the file fails to open. for eg http://192.168.0.10/abc.xxx fails to open. Is there any alternate for ifstream when using a URL address? thanks. part of the code where having problem: bool readTillEof = (endIndex == -1) ? true : false; // Open the file in binary mode and seek to the end to determine file size ifstream file ( fileName.c_str ( ), ios::in|ios::ate|ios::binary ); if ( file.is_open ( ) ) { long size = (long) file.tellg ( ); long numBytesRead; if ( readTillEof ) { numBytesRead = size - startIndex; } else { numBytesRead = endIndex - startIndex + 1; } // Allocate a new buffer ptr to read in the file data BufferSptr buf (new Buffer ( numBytesRead ) ); mpStreamingClientEngine->SetResponseBuffer ( nextRequest, buf ); // Seek to the start index of the byte range // and read the data file.seekg ( startIndex, ios::beg ); file.read ( (char *)buf->GetData(), numBytesRead ); // Pass on the data to the SCE // and signal completion of request mpStreamingClientEngine->HandleDataReceived( nextRequest, numBytesRead); mpStreamingClientEngine->MarkRequestCompleted( nextRequest ); // Close the file file.close ( ); } else { // Report error to the Streaming Client Engine // as unable to open file AHS_ERROR ( ConnectionManager, " Error while opening file \"%s\"\n", fileName.c_str ( ) ); mpStreamingClientEngine->HandleRequestFailed( nextRequest, CONNECTION_FAILED ); } }

    Read the article

  • How do I open a file in such a way that if the file doesn't exist it will be created and opened automatically?

    - by snakile
    Here's how I open a file for writing+ : if( fopen_s( &f, fileName, "w+" ) !=0 ) { printf("Open file failed\n"); return; } fprintf_s(f, "content"); If the file doesn't exist the open operation fails. What's the right way to fopen if I want to create the file automatically if the file doesn't already exist? EDIT: If the file does exist, I would like fprintf to overwrite the file, not to append to it.

    Read the article

  • Problem with File uplolad in javascript.

    - by Nikhil
    I have used javascript to upload more than one file. when user clicks on 'add more' javascript appends new object to older div using innerHTML. Now the problem is if I select a file and then click on "add more" then new file button exist but older selected file removes and two blank file buttons display. I want this old file must be selected when user add new file button. If anybody can, Help Plz!!! tnX.

    Read the article

  • Windows 8 Stuck on Start Screen File Search

    - by baturayd
    I have been searching someone else having the same issue but I couldn't find any. Here is my problem: I'm using Windows 8 Pro with Media Center. File search screen does not close itself after I make a file search within start screen. It stuck on that screen. I can't go back to desktop, therefore, task manager is inaccessible. Only way to get out of it is to sign out. It also looks like non-operational. It doesn't give me any result at all. It's just a blank screen with "Files" title. It used to work perfectly. Things I have done before coming here: Safe mode minimal boot to ensure no other 3rd party software interferes. sfc haven't found any inconsistencies. Search index has been rebuild. Normal boot with all 3rd party services and start-up items disabled. System restore to a date that I know this feature was functional. And by the way, I have installed all updates released so far. I strongly used file search via start menu back in Windows 7. This is an absolute game changer for me. I'm curious what causes this. I'll do a "system refresh" if I can't fix this. I'm working on it, I'll keep this thread updated should I find any fix. First update: I just discovered that file search screen gets stuck if it's invoked by typing query directly in start screen. It doesn't get stuck if it's invoked from win + x menu. I was able to "escape" from stuck screen with invoking it again by win + x menu. After rebuilding search index again, search suggestions started to appear again but still there is no file search functionality. Second update: "Results for" expression appears only for a second near to "Files" title when search is initialized. Third update: As a last resort, I finally tried to do a "System Refresh" which has also failed to refresh by giving an error after waiting almost 20 minutes at 99%. (Seriously?) After cold boot it began to undo changes. After changes were reverted, I boot the machine without doing anything further and bingo! Search began acting normal again. This is a totally weird solution. It obviously fixed certain system files during failed refresh, and kept those changes untouched because they were supposed to be that way at the first place. I'll keep this thread alive should anyone comes with a more logical explanation. Forth update: After a windows update, search functionality again stopped responding. It happened after a system update for the first time. Now I have a pretty good suspicion about system update, though I have no solid proof of its involvement with this problem.

    Read the article

  • excel cannot open the file xxx.xlsx' because the file format is not valid error

    - by Yavuz
    I have difficulty open opening word and excel files suddenly. Only particular office file give me the problem. These files were previously scanned by combo fix and I believe they were damaged. The error response that I from office is Excel cannot open the file xxx.xlsx because the file format is not valid. Verify that the file has not been corrupted and that the file extension matches the format of the file. This is for excel and a similar kind of error response comes for word. The file looks fine. I mean the size vise... Please help me with this problem. I really appreciate your help and time....

    Read the article

  • Upon clicking on a file, excel opens but not the file itself

    - by william
    Platform: Windows XP SP2, Excel 2007 Problem description: Upon clicking on a file in Windows Explorer (file is either .xls or .xlsx) Excel 2007 opens, but does not open the file itself. I need either to click on a file again in Windows Explorer or open it manually with File/Open ... from Excel. Does anyone know what could cause this rather strange behaviour ? The old versions of Excel worked "normally" ... i.e. upon clicking on a file, an Excel would open along with the file. Please, help !

    Read the article

  • How to write files in specific order?

    - by Bernie
    Okay, here's a weird problem -- My wife just bought a 2014 Nissan Altima. So, I took her iTunes library and converted the .m4a files to .mp3, since the car audio system only supports .mp3 and .wma. So far so good. Then I copied the files to a DOS FAT-32 formatted USB thumb drive, and connected the drive to the car's USB port, only to find all of the tracks were out of sequence. All tracks begin with a two digit numeric prefix, i.e., 01, 02, 03, etc. So you would think they would be in order. So I called Nissan Connect support and the rep told me that there is a known problem with reading files in the correct order. He said the files are read in the same order they are written. So, I manually copied a few albums with the tracks in a predetermined order, and sure enough he was correct. So I copied about 6 albums for testing, then changed to the top level directory and did a "find . music.txt". Then I passed this file to rsync like this: rsync -av --files-from=music.txt . ../Marys\ Music\ Sequenced/ The files looked like they were copied in order, but when I listed the files in order of modified time, they were in the same sequence as the original files: ../Marys Music Sequenced/Air Supply/Air Supply Greatest Hits ls -1rt 01 Lost In Love.mp3 04 Every Woman In The World.mp3 03 Chances.mp3 02 All Out Of Love.mp3 06 Here I Am (Just When I Thought I Was Over You).mp3 05 The One That You Love.mp3 08 I Want To Give It All.mp3 07 Sweet Dreams.mp3 11 Young Love.mp3 So the question is, how can I copy files listed in a file named music.txt, and copy them to a destination, and ensure the modification times are in the same sequence as the files are listed?

    Read the article

  • Error in Encrypting web.config connection string

    - by Mohan
    Hi everybody, I am encrypting web.config file. My code is below. Configuration config = WebConfigurationManager.OpenWebConfiguration("~"); ConfigurationSection section = config.GetSection("connectionStrings"); if (!section.SectionInformation.IsProtected) { section.SectionInformation.ProtectSection("RSAProtectedConfigurationProvider"); config.Save(); } but this gives me error Object already exists. Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.Security.Cryptography.CryptographicException: Object already exists.

    Read the article

  • rename files with the same name

    - by snorpey
    Hi. I use the following function to rename thumbnails. For example, if I upload a file called "image.png" to an upload folder, and this folder already has a file named "image.png" in it, the new file automatically gets renamed to "image-copy-1.png". If there also is a file called "image-copy-1.png" it gets renamed to "image-copy-2.png" and so on. The following function returns the new filename. At least that's what it is supposed to do... The renaming doesn't seeem to work correctly, though. Sometimes it produces strange results, like: 1.png 1-copy-1.png 1-copy-2.png 1-copy-2-copy-1.png 1-copy-2-copy-3.png I hope you understand my problem, despite my description being somewhat complex... Can you tell me what went wrong here? (bonus question: Is regular expressions the right tool for doing this kind of stuff?) <?php function renameDuplicates($path, $file) { $fileName = pathinfo($path . $file, PATHINFO_FILENAME); $fileExtension = "." . pathinfo($path . $file, PATHINFO_EXTENSION); if(file_exists($path . $file)) { $fileCopy = $fileName . "-copy-1"; if(file_exists($path . $fileCopy . $fileExtension)) { if ($contains = preg_match_all ("/.*?(copy)(-)(\\d+)/is", $fileCopy, $matches)) { $copyIndex = $matches[3][0]; $fileName = substr($fileCopy, 0, -(strlen("-copy-" . $copyIndex))) . "-copy-" . ($copyIndex + 1); } } else { $fileName .= "-copy-1"; } } $returnValue = $fileName . $fileExtension; return $returnValue; }?>

    Read the article

  • Encrypting Files with AES, Encrypting Key with RSA - Am I on the right track?

    - by Shawn Steward
    Overview: I'm trying to design an application that will encrypt files to safely send through the mail. I'm planning on using AES/RijndaelManaged encryption from .Net to encrypt the files initially, using a randomly generated key using RNGCryptoServiceProvider. I'm then encrypting this random AES key with a RSA Public key. The receiver of the data is the only one with the RSA Private key to decrypt it. My question: Is this the proper way to do something like this? If so, is it safe to send this RSA-Encrypted key with the data since it requires the private key to decrypt? Also - when having the end user generate their Public/Private key pair, what is the best way to save the Private key? I do not want it to be only accessible from one machine, so I am trying to avoid using the user's key store. But MSDN says it is not safe to save the key to a file, so how else can you accomplish this?

    Read the article

  • Asp.Net Random Error

    - by John Boker
    At random times, twice in the past two weeks, the we application will start to error and not work until I recycle the app pool in IIS. The specific error and stacktrace are: System.Web.HttpUnhandledException: Exception of type 'System.Web.HttpUnhandledException' was thrown. ---> System.InvalidCastException: Unable to cast object of type 'System.Guid' to type 'System.String'. at System.Data.Linq.SqlClient.SqlProvider.Execute(Expression query, QueryInfo queryInfo, IObjectReaderFactory factory, Object[] parentArgs, Object[] userArgs, ICompiledSubQuery[] subQueries, Object lastResult) at System.Data.Linq.SqlClient.SqlProvider.ExecuteAll(Expression query, QueryInfo[] queryInfos, IObjectReaderFactory factory, Object[] userArguments, ICompiledSubQuery[] subQueries) at System.Data.Linq.SqlClient.SqlProvider.System.Data.Linq.Provider.IProvider.Execute(Expression query) at System.Data.Linq.DataQuery`1.System.Linq.IQueryProvider.Execute[S](Expression expression) at System.Linq.Queryable.FirstOrDefault[TSource](IQueryable`1 source) at DigitalScout.WEDS.Business.Slug.GetTeamPath(String teamID) at DigitalScout.WEDS.WebApp.Code.Navigator.TeamNavigator.Home(String teamID) at ASP.management_default_aspx.__DataBind__control7(Object sender, EventArgs e) at System.Web.UI.Control.OnDataBinding(EventArgs e) at System.Web.UI.Control.DataBind(Boolean raiseOnDataBinding) at System.Web.UI.Control.DataBindChildren() at System.Web.UI.Control.DataBind(Boolean raiseOnDataBinding) at System.Web.UI.WebControls.Repeater.CreateControlHierarchy(Boolean useDataSource) at System.Web.UI.WebControls.Repeater.OnDataBinding(EventArgs e) at System.Web.UI.Control.DataBindChildren() at System.Web.UI.Control.DataBind(Boolean raiseOnDataBinding) at System.Web.UI.WebControls.Repeater.CreateControlHierarchy(Boolean useDataSource) at System.Web.UI.WebControls.Repeater.OnDataBinding(EventArgs e) at DigitalScout.WEDS.WebApp.Management._default.Page_Load(Object sender, EventArgs e) at System.Web.Util.CalliHelper.EventArgFunctionCaller(IntPtr fp, Object o, Object t, EventArgs e) at System.Web.Util.CalliEventHandlerDelegateProxy.Callback(Object sender, EventArgs e) at System.Web.UI.Control.OnLoad(EventArgs e) at DigitalScout.WEDS.WebApp.Code.BaseClass.Pages.ManagementPage.OnLoad(EventArgs e) at System.Web.UI.Control.LoadRecursive() at System.Web.UI.Page.ProcessRequestMain(Boolean includeStagesBeforeAsyncPoint, Boolean includeStagesAfterAsyncPoint) --- End of inner exception stack trace --- at System.Web.UI.Page.HandleError(Exception e) at System.Web.UI.Page.ProcessRequestMain(Boolean includeStagesBeforeAsyncPoint, Boolean includeStagesAfterAsyncPoint) at System.Web.UI.Page.ProcessRequest(Boolean includeStagesBeforeAsyncPoint, Boolean includeStagesAfterAsyncPoint) at System.Web.UI.Page.ProcessRequest() at System.Web.UI.Page.ProcessRequest(HttpContext context) at ASP.management_default_aspx.ProcessRequest(HttpContext context) at System.Web.HttpApplication.CallHandlerExecutionStep.System.Web.HttpApplication.IExecutionStep.Execute() at System.Web.HttpApplication.ExecuteStep(IExecutionStep step, Boolean& completedSynchronously) This error happens for every user of the system until the app pool is recycled. Any help on this would be helpful as we are not able to reproduce the error.

    Read the article

  • Silverlight WinDg Memory Release Issue

    - by Chris Newton
    Hi, I have used WinDbg succesfully on a number of occasions to track down and fix memory leaks (or more accurately the CLRs inability to garbage collect a released object), but am stuck with one particular control. The control is displayed within a child window and when the window is closed a reference to the control remains and cannot be garbage collected. I have resolved what I believe to be the majority of the issues that could have caused the leak, but the !gcroot of the affected object is not clear (to me at least) as to what is still holding on to this object. The ouput is always the same regardless of the content being presented in the child window: DOMAIN(03FB7238):HANDLE(Pinned):79b12f8:Root: 06704260(System.Object[])- 05719f00(System.Collections.Generic.Dictionary2[[System.IntPtr, mscorlib],[System.Object, mscorlib]])-> 067c1310(System.Collections.Generic.Dictionary2+Entry[[System.IntPtr, mscorlib],[System.Object, mscorlib]][])- 064d42b0(System.Windows.Controls.Grid)- 064d4314(System.Collections.Generic.Dictionary2[[MS.Internal.IManagedPeerBase, System.Windows],[System.Object, mscorlib]])-> 064d4360(System.Collections.Generic.Dictionary2+Entry[[MS.Internal.IManagedPeerBase, System.Windows],[System.Object, mscorlib]][])- 064d3860(System.Windows.Controls.Border)- 064d4218(System.Collections.Generic.Dictionary2[[MS.Internal.IManagedPeerBase, System.Windows],[System.Object, mscorlib]])-> 064d4264(System.Collections.Generic.Dictionary2+Entry[[MS.Internal.IManagedPeerBase, System.Windows],[System.Object, mscorlib]][])- 064d3bfc(System.Windows.Controls.ContentPresenter)- 064d3d64(System.Collections.Generic.Dictionary2[[MS.Internal.IManagedPeerBase, System.Windows],[System.Object, mscorlib]])-> 064d3db0(System.Collections.Generic.Dictionary2+Entry[[MS.Internal.IManagedPeerBase, System.Windows],[System.Object, mscorlib]][])- 064d3dec(System.Collections.Generic.Dictionary2[[System.UInt32, mscorlib],[System.Windows.DependencyObject, System.Windows]])-> 064d3e38(System.Collections.Generic.Dictionary2+Entry[[System.UInt32, mscorlib],[System.Windows.DependencyObject, System.Windows]][])- 06490b04(Insurer.Analytics.SharedResources.Controls.HistoricalKPIViewerControl) If anyone has any ideas about what could potentially be the problem, or if you require more information, please let me know. Kind Regards, Chris

    Read the article

  • Encrypting password in compiled C or C++ code

    - by Daniel
    Hello!, I know how to compile C and C++ Source files using GCC and CC in the terminal, however i would like to know if its safe to include passwords in these files, once compiled. For example.. i check user input for a certain password e.g 123, but it appears compiled C/C++ programs is possible to be decompiled. Is there anyway to compile a C/C++ source file, while keeping the source completely hidden.. If not, could anyone provide a small example of encrypting the input, then checking against the password e.g: (SHA1, MD5)

    Read the article

  • Best way of obfuscating / encrypting form data on the iPhone

    - by cannyboy
    I want to create an app which holds sensitive information (imagine it's bank account details, thought it's not). The user enters this information on a form the first time the app starts up. I want this info to be saved, and available, any time the user uses the app (without having to enter a password). However, if the iPhone has a password lock on it, and is stolen, I don't want the data to be easily accessible from the file system. What is the best way of encrypting or obfuscating the data? There is not a lot of data, just a dozen NSStrings from the UITextFields on the form. I'm aware there are encryption export restrictions on the iPhone for non-US developers (I am in UK), so I would prefer to avoid going jumping through any of Apple's app submission hoops to get it on the store.

    Read the article

< Previous Page | 25 26 27 28 29 30 31 32 33 34 35 36  | Next Page >