Search Results

Search found 2372 results on 95 pages for 'significant whitespace'.

Page 32/95 | < Previous Page | 28 29 30 31 32 33 34 35 36 37 38 39  | Next Page >

  • Why Should I Avoid Inline Scripting?

    - by thesunneversets
    A knowledgeable friend recently looked at a website I helped launch, and commented something like "very cool site, shame about the inline scripting in the source code". I'm definitely in a position to remove the inline scripting where it occurs; I'm vaguely aware that it's "a bad thing". My question is: what are the real problems with inline scripting? Is there a significant performance issue, or is it mostly just a matter of good style? Can I justify immediate action on the inline scripting front to my superiors, when there are other things to work on that might have a more obvious impact on the site? If you pulled up to a website, and took a peek at the source code, what factors would lead you to say "hmm, professional work here", and what would cause you to recoil from an obviously amateurish job? Okay, that question turned into multiple questions in the writing. But basically, inline scripting - what's the deal?

    Read the article

  • Mouse cursor lag after lock screen, 64 bit 12.04

    - by Bill Jones
    Recently I have noticed that when I return to my computer after it has been "locked" for a while, the mouse pointer has significant lag. The cursor position appears to only update a few times a second. Moving the mouse results in the pointer "following" the movement in a jerky kind of way, and then continuing for some fraction of a second after I have stopped using the mouse. Replacing the mouse has no effect. (I have two differently branded and constructed usb optical mice). Plugging either mouse into a different usb port has no effect. Once the problem was resolved by "suspending" the system, and then re-starting it with the power switch, but this does not work every time. So far, the only fool-proof fix is to shut the system down and re-start it (re-boot). I have tried this suggested fix. It had no effect.

    Read the article

  • Earliest use of Comments as Semantically Meaningful Things in a Program?

    - by Alan Storm
    In certain corners of the PHP meta-programming world, it's become fashionable to use PHPDoc comments as a mechanism for providing semantically meaningful information to a program. That is, other code will parse the doc blocks and do something significant with the information encoded in those comments. Doctrine's annotations and code generation are an example of this. What's the earliest (or some early) use of this technique? I have vague memories of some early java Design by Contract implementations doing similar things, but I'm not sure of those folks were inventing the technique, or if they got it from somewhere. Mainly asking so I can provide some historical context for PHP developers who haven't come across the technique before, and are distrustful of it because it seems a little crazy pants.

    Read the article

  • NoSQL For The Rest Of Us

    No one would blame you for strictly associating NoSQL with performance. Most of the back and forth about NoSQL - an umbrella term given for non-relational storage mechanisms - has squarely put the focus on performance, sites with massive traffic, and server farms. It’s an interesting conversation, but one that risks alienating NoSQL from the majority of developers. The Problem Does NoSQL provide us simple developers with any tangible benefit? As a matter of fact, it can - one as significant...Did you know that DotNetSlackers also publishes .net articles written by top known .net Authors? We already have over 80 articles in several categories including Silverlight. Take a look: here.

    Read the article

  • Diff -b and -w difference

    - by dotancohen
    From the diff manpage: -b, --ignore-space-change ignore changes in the amount of white space -w, --ignore-all-space ignore all white space From this, I infer that the difference between the -b and -w options must be that -b is sensitive to the type of whitespace (tabs vs. spaces). However, that does not seem to be the case: $ diff 1.txt 2.txt 1,3c1,3 < Four spaces, changed to one tab < Eight Spaces, changed to two tabs < Four spaces, changed to two spaces --- > Four spaces, changed to one tab > Eight Spaces, changed to two tabs > Four spaces, changed to two spaces $ diff -b 1.txt 2.txt $ diff -w 1.txt 2.txt $ So, what is the difference between the -b and -w options? Tested with diffutils 3.2 on Kubuntu Linux 13.04.

    Read the article

  • Emacs stops taking input when a file has changed on disk [migrated]

    - by recf
    I'm using Emacs v24.3.1 on Windows 8. I had a file change on disk while I had an Emacs buffer open with that file. As soon as I attempt to make a change to the buffer, a message appears in the minibuffer. Fileblah.txt changed on disk; really edit the buffer? (y, n, r or C-h) I would expect to be able to hit r to have it reload the disk version of the file, but nothing happens. Emacs completely stops responding to input. None of the listed keys work, nor do any other keys as far as I can tell. I can't C-g out of the minibuffer. Alt-F4 doesn't work, not does Close window from the task bar. I have to kill the process from task manager. Anyone have any idea what I'm doing wrong here? In cases it's various modes not playing nice with each other, for reference, my init.el is here. Nothing complex. Here's the breakdown: better-defaults (ido-mode, remove menu-bar, uniquify buffer `forward, saveplace) recentf-mode custom frame title visual-line-mode require final newline and delete trailing whitespace on save Markdown mode with auto-mode-alist Flyspell with Aspell backend Powershell mode with auto-mode-alist Ruby auto-mode-alist Puppet mode with auto-mode-alist Feature (Gherkin) mode with auto-mode-alist The specific file was a markdown file with Github-flavored Markdown mode and Flyspell mode enabled.

    Read the article

  • Database Insider - June 2014 issue now available

    - by Javier Puerta
    The June issue of the Database Insider newsletter is now available. (Full newsletter here) NEWS June 10: Oracle CEO Larry Ellison Live on the Future of Database Performance At a live webcast on June 10 at Oracle’s headquarters, Oracle CEO Larry Ellison is expected to announce the upcoming availability of Oracle Database In-Memory, which dramatically accelerates business decision-making by processing analytical queries in memory without requiring any changes to existing applications.Read More New Study Confirms Capital Expenditure Savings with Oracle Multitenant A new study finds that Oracle Multitenant, an option of Oracle Database 12c, drives significant savings in capital expenditures by enabling the consolidation of a large number of databases on the same number or fewer hardware resources.  Read More Read full newsletter here

    Read the article

  • Upgrading an app to support iOS5, 6 and 7

    - by drekka
    We are looking at an app that needs an upgrade. Currently it runs on iOS4, 5 & 6. The upgrade will move to iOS5, 6 & 7. It will also involve some UI changes and new features. I've been reading stuff on iOS7 and looking at things like auto-layout. What we are trying to figure out is the best way to handle the differences between the various iOS versions. Auto-layout seems like a good idea, but it's not available on iOS 5. There are also API changes to consider between all 3 versions and other new features of iOS7. So the questions: How would you handle auto layout given iOS5 does not have it? Are there any significant differences between the SDKs that you think would cause issues? Would we be better off with separate code bases?

    Read the article

  • How do I justify upgrading to Windows Server 2008?

    - by thebunk
    We're just about to start a new greenfield project - it's a highly functional web application using ASP.NET MVC3, SQL Server etc. We're also going to be using Windows Workflow Foundation for the first time. Our client only wants to use his existing Windows Server 2003 web servers. My main issue (other than it is 8 years old) is that we don't much experierence of WWF development, but understand that using AppFabric (Server 2008 only) will improve WWF development. It's a significant cost to the client, as we need fail-over servers and a UAT environment as well. Am I correct in my understanding, and what methodologies can I use to justify the cost of upgrading?

    Read the article

  • Material tiling and offset in unity

    - by Simran kaur
    Ambiguity: What exactly is the difference between Tiling the material and Offset of material? Need to do: I need the material to be repeated n times on the object where I need to set the value of n via script.How do I do it? It seems to happen through Tiling(tried via inspector) but again what is difference between mainTextureOffset and setTextureOffset? Tried: Following is the line of code that I tried to repeat the texture n number of times on an object(repeat across the width of object), but it does nothing significant that I can see.

    Read the article

  • DotNetNuke 5.3.0 Released

    I am happy to announce that the DotNetNuke 5.3.0 release is now available for download. This release marks the fourth month in a row where we have hit our targeted release date. That is a huge accomplishment for the project as the DotNetNuke Corporation engineering team is really starting to gel. During this release cycle we also had a number of significant contributions by core team members. Over the past year, as our development methodology has undergone change and we have hired more members for...Did you know that DotNetSlackers also publishes .net articles written by top known .net Authors? We already have over 80 articles in several categories including Silverlight. Take a look: here.

    Read the article

  • Branding Changes for Java EE6

    - by Paul Sorensen
    Hi Everyone, As we move the Java EE6 exams from beta to production, you may notice that we have made a slight change in the branding. Instead of being branded Oracle Certified Professional (OCP), these new credentials are now branded Oracle Certified Expert (OCE). One area where we use the Expert brand is for credentials where the technology is advanced or broader than the path based credential requires. Some are high-end add-on certifications, and others have significant additional technological breadth. In these cases, the Expert brand is an indication that someone is tested in more advanced or in-depth skills - beyond the traditional path-based certification. A few examples are RAC Expert for DBAs, or SQL Expert - also for DBAs. Because (1) all of the Java EE6 credentials require that candidates become certified first in Java SE6, and (2) many people earn more than one Java EE credential, we felt that the Expert branding would be more appropriate. Thanks,

    Read the article

  • Anyone can suggest some Game Frameworks for GNU/Linux? [closed]

    - by dysoco
    So I've been developing a little bit with XNA + C# in Windows, not really much: just some 2D stuff, but I've found that XNA is a really good framework. I'm a GNU/Linux user, and I'm definitely migrating my desktop to Gentoo Linux (I've been using Arch in my laptop for a while now). But, of course, I need a C# + XNA alternative... I'm not really an expert in any language, so I can really pick up anything (except, maybe, Functional ones), I prefer C-Like languages like Java or Ruby, I tried Python but found the Whitespace syntax confusing. I would like to hear some of you'r suggestions, I'm not asking for "the best", but for "some suggestions", so I think this is objective enough. Probably you're going to suggest C++ + SDL, but I would prefer something more "High Level" like XNA, but I'm open to discuss anything. So... any ideas ? Note: I think this questions meets the guidelines for this site, if it doesn't: please not only downvote this question, but comment on what can I do to improve it. Thanks. PS: 2D Games, not 3D

    Read the article

  • Performance impact of not implementing relationships at the database level?

    - by JVerstry
    Let's imagine a data model with customers and invoices. There is a 1 to n relationship between a customer and its invoices. We uses an ORM (like Hibernate). One can explicitely implement the 1-n relationship (using JPA for example) or not. If not, then one must do a bit more work to fetch invoices. However, it is much easier to maintain, improve and develop the data model of applications where relationships between objects are not explicitely implemented in the database. My question is, has anyone noticed a significant performance impact when not implementing the relationships in the database?

    Read the article

  • Miss Oracle Open World? View the PeopleSoft Roadmap Presentation Here

    - by John Webb
    If you were unable to attend Oracle Open World in September, you missed out on some important PeopleSoft messages.   Don't despair!  You now have a chance to receive an update on PeopleSoft's presence at Oracle OpenWorld 2013 and the key messages delivered there. You can view the “PeopleSoft Update and Roadmap” webcast found here on the Quest Users Group site.  (Note: this is available with a FREE subscriber account.  Anyone can sign up here at no cost. This webcast recording presents the significant adoption and momentum behind PeopleSoft 9.2.  Viewers will also learn about the new release model for continuously delivering new capabilities to PeopleSoft customers at a lower cost enabled by the new PeopleSoft Update Manager.  There are also compelling live demonstrations of the major investment areas for PeopleSoft including a new PeopleSoft user experience enabling mobile solutions as well as In-Memory PeopleSoft applications. You can view all presentations ns in the Oracle Open World 2013 Content Catalog.

    Read the article

  • Miss Open World? View this Roadmap Presentation

    - by PeopleTools Strategy
    If you were unable to attend Oracle Open World in September, you missed out on some important PeopleSoft messages.  Don't despair!  You now have a chance to receive an update on PeopleSoft’s presence at Oracle OpenWorld 2013 and the key messages delivered there. You can view the “PeopleSoft Update and Roadmap” webcast found here on the Quest Users Group site.  (Note: this is available with a FREE subscriber account.  Anyone can sign up here at no cost. This webcast recording presents the significant adoption and momentum behind PeopleSoft 9.2.  Viewers will also learn about the new release model for continuously delivering new capabilities to PeopleSoft customers at a lower cost enabled by the new PeopleSoft Update Manager.  There are also compelling live demonstrations of the major investment areas for PeopleSoft including a new PeopleSoft user experience enabling mobile solutions as well as In-Memory PeopleSoft applications.

    Read the article

  • What's the reason exceptions are heavily used in managed (C# and Java) languages but not in C++? [on hold]

    - by ZijingWu
    AFAIK, a lot of C++ projects don't allow exceptions and deny them in coding guidelines. I have a lot of reasons, for example, exception is hard to handle correctly if your binary needs to be compiled by separate and different compilers. But it doesn't fully convince me, there is a lot of projects which are just using one compiler. Compared to C++, exceptions are heavily used in C# and Java and the reason can only be that exception are not bringing enough benefit. One point is debugbility in practice. Exception can not get the call stack in C++ code, but in C# and Java you can get the call stack from exception, it is significant and makes debugging easier. No-callstack is not the fault of the exception, it is the language difference, but it impacts the exception usage. So what's the reason that exceptions are frowned upon in c++ programs?

    Read the article

  • What's the difference between a "Release" Xbox 360 build and a "Debug" one?

    - by Sebastian Gray
    I've got a build of my game that works on Windows under a release and debug build as expected. When I deploy the debug version of the game to the Xbox, it works as expected and runs the same as on Windows - however when I deploy the release version to the XBOX I get different behaviour within the game. I'm using a 3rd party library for the collisions (which is where I am seeing differences between the release and debug versions of my game); so I can't see what's actually different but I suspect they have some compiler directive for Debug on the Xbox to the Release version on the Xbox. As such, I'm thinking that I may need to release my game with the Debug build instead of the Release build but I want to know what issues I can expect by doing so? Are there any significant performance issues between the two build profiles?

    Read the article

  • How to create a bookmark under "computer" in the Sidebar of the nautilus file manager in 12.04?

    - by Jiskya
    Somehow, I removed the Downloads bookmark in the Sidebar under "Computer". Is there any way I can make a new one? Possibly with the same icon? I still have my Downloads directory. I just don't have the bookmark under "Computer" anymore, and it has the ordinary folder icon. I know it's not the most significant question, but it's a question nonetheless. Also, I'm not sure, but it may be important to note that I'm using unity 2d.

    Read the article

  • Is there any diff tool for XML files?

    - by qedi
    Are there any good (Linux) tools for diffing two XML files? Ideally, I would like to be able configure it to some things strict, or loosen some things, like whitespace, or attribute order. I'll often care that the files are functionally the same, but diff by itself, would be annoying to use, especially if the XML file doesn't have a lot of linebreaks. For example, the following should really be okay to me: <tag att1="one" att2="two"> content </tag> <tag att2="two" att1="one"> content </tag>

    Read the article

  • 2012 JCP Awards

    - by Tori Wieldt
    Nominations are now open for the 2012 JCP Awards. Submit nominations to PMO at JCP dot ORG or use this form.  The Java Community Process (JCP) program celebrates success. Members of the community nominate worthy participants, Spec Leads, and Java Specification Requests (JSRs) in order to cheer on the hard work and creativity that produces ground-breaking results for the community and industry in the Java Standard Edition (SE), Java Enterprise Edition (EE), or Java Micro Edition (ME) platforms. The community gets together every year at the JavaOne conference to applaud in person the winners of three awards: JCP Member/Participant of the Year, Outstanding Spec Lead, and Most Significant JSR. This year’s unveiling will occur Tuesday evening, 2 October, at the Annual JCP Community Party held in San Francisco during JavaOne. Nominations close on 16 July 2012. More details are on the JCP blog.

    Read the article

  • 10th Annual JCP Award Winners Announced

    - by heathervc
    The 10th JCP Annual Awards were presented in three categories yesterday evening at the JCP Party during JavaOne.  Congratulations to the winners and the nominees for the contributions to the Java Community! JCP Member/Participant of the Year London Java Community and SouJava For their historic contribution to the Adopt a JSR program and supporting Java developers through the JCP. Outstanding Spec Lead Victor Grazi, Credit Suisse, (JSR 354, Money and Currency API) For his dedicated, focused expertise in solving issues representing Money and Currencies. Most Significant JSR JSR 348, JSR 355 and JSR 358, JCP.Next, These three JSRs will set the direction and procedures for the next-generation JCP. You can view profiles of all the nominees on jcp.org.

    Read the article

  • Context-specific remap

    - by dotancohen
    I have the following handy VIM map: inoremap ( ()<Left> However, sometimes I will enter Insert mode to add a function call around a variable, like so: Was: $sql = "SELECT * FROM " . $someTable; To: $sql = "SELECT * FROM " . mysql_real_escape_string($someTable); The mapping makes a redundant ) after mysql_real_escape_string(. Is there any way to refactor the mapping so that if there exists a character after the cursor, and the character after the cursor is not whitespace, then )<left> is not appended to (? Thanks.

    Read the article

  • Oracle Solaris 11.1 Now Available; Learn More About It at November 7th Webcast

    - by Larry Wake
    Oracle Solaris 11.1 is now available for download -- as detailed earlier, this update to Oracle Solaris 11.1 provides new enhancements for enterprise cloud computing. Security, network, and provisioning advances, in addition to significant new performance features, make an already great release even better. For more information, you can't do better than the upcoming launch event webcast, featuring a live Q&A with Solaris engineering experts and three sessions covering what's new with Oracle Solaris 11.1 and Oracle Solaris Cluster. It's on Wednesday, November 7, at 8 AM PT; register today.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

< Previous Page | 28 29 30 31 32 33 34 35 36 37 38 39  | Next Page >