Search Results

Search found 2372 results on 95 pages for 'significant whitespace'.

Page 33/95 | < Previous Page | 29 30 31 32 33 34 35 36 37 38 39 40  | Next Page >

  • In Sublime Text 2, how can I indent out to a straight column with multiple cursors on a ragged edge?

    - by mtoast
    Suppose I've got multiple cursors along several lines, like this: foo| barr| foobar| baz| How can I automatically push the whitespace at the end of each line out to a flat edge, like this?: foo | barr | foobar | baz | (In these examples, | is supposed to be my cursor.) EDIT #1 When you just Tab or Space from the initial arrangement, you get this: # Useful, but not what I'm looking for foo | barr | foobar | baz | That's useful, but not what I'm looking for. I'm looking for some kind of keyboard shortcut that will let me indent from a ragged multi-cursor insert out to a straight column.

    Read the article

  • After a domain change, what can I do to recover lost traffic, rankings, impressions etc? [duplicate]

    - by Felix
    This question already has an answer here: How do I rename a domain and preserve PageRank? 3 answers I moved my site to a legacy exact-match domain I purchased about a couple of months ago. I have seen significant reduction in traffic, impressions, and rankings. I did all the right steps/best practices: change of address in GWT, map old site hierarchy and match to new site for 301 redirects etc. Indexation has gone through the Google process: old site has all but dissappeared from he index and new site is indexed, albeit with some 404 errors which I am addressing. Does anyone else who has gone through eh domain change process have any thoughts/advice? Thanks!

    Read the article

  • Just Released: Oracle Instantis EnterpriseTrack 8.5

    - by Melissa Centurio Lopes
    Instantis EnterpriseTrack has been successfully integrated into the Oracle development process and the first release under Oracle is generally available. This release is a significant expansion of solution capabilities in resource management, project demand management, and project execution. It also includes customer requested product enhancements, reporting enhancements, performance optimizations, and user experience improvements. Key enhancements include: New Resource Calendar functionality provides more precise capacity visibility for resource planning and increases project plan reliability. Support for Activity Labor Cost Capitalization allows project teams to easily mark any WBS activity as CapEx or OpEx with Labor Expense Type and enforce proper classification of Labor Expense Type for activities by setting defaults through activity templates or at project level New Variable Resource Rates functionality allows project stakeholders to specify resource rate accurately over time and account for wage revisions Instantis EnterpriseTrack cloud and on-premise solutions provide a top-down approach to managing, tracking and reporting on enterprise strategies, projects, portfolios, processes, resources, and financials. Upgrade now or Visit the Instantis EnterpriseTrack site to learn more.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Oracle Solaris 11.1 Now Available; Learn More About It at November 7th Webcast

    - by Larry Wake
    Oracle Solaris 11.1 is now available for download -- as detailed earlier, this update to Oracle Solaris 11.1 provides new enhancements for enterprise cloud computing. Security, network, and provisioning advances, in addition to significant new performance features, make an already great release even better. For more information, you can't do better than the upcoming launch event webcast, featuring a live Q&A with Solaris engineering experts and three sessions covering what's new with Oracle Solaris 11.1 and Oracle Solaris Cluster. It's on Wednesday, November 7, at 8 AM PT; register today.

    Read the article

  • Centralizing Chart of Accounts Management Across Oracle ERP and EPM Applications with Oracle Hyperion Data Relationship Management

    Most enterprises today have multiple GL/ERP systems - each with their own set of accounts, structures and systems for financial and management reporting. Mergers, acquisitions and reorganizations inject constant change into the process - through new accounts, entities, and locations. Accommodating an organization's unique view of the business while still maintaining accurate collection, measurement and reporting at the corporate level makes synchronization of chart of accounts across multiple systems a challenge. In this podcast, you'll hear about how Oracle Hyperion Data Relationship Management allows you centralize and align different financial perspectives into your corporate reporting standards. This end-user oriented, technology agnostic hierarchy management solution enables organizations to coordinate the management of chart of accounts across the enterprise and save a significant amount of time and effort.

    Read the article

  • How do developers find the time to stay on top of latest technologies?

    - by u2sonderzug
    I was a freelance web developer until circa 2004 when I started going down the management route but have decided to try to get back into development again (specifically JavaScript and HTML5 web/mobile web apps) and I really get the impression to be truly good at these and similar fast moving technologies a constant amount of time is required to be set aside to invest in getting better at existing skills in addition to learning new skills. I understand right now since I am getting back into things there is a pretty steep learning curve, but seeing how good many guys are out there - the only way I see of getting up there is putting in a serious amount of time. For those working as fulltime developers, what I am trying to understand is this - on most days, how much time in the office is spent actually grinding out code compared to learning/research. I could easily spend 2-4 hours daily getting on top of the best ways to go about doing things. Do most good developers who are employed full time invest significant hours outside of work sharpening their skills? Or maybe I'm looking at all of this completely wrong?

    Read the article

  • Issues with time slicing

    - by user12331
    I was trying to see the effect of time slicing. And how it can consume significant amount of time. Actually, I was trying to divide a certain work into number of threads and see the effect. I have a two core processor. So two threads can run in parallel. I was trying to see if I have a work w that is done by 2 threads, and if I have the same work done by t threads with each thread doing w/t of the work. How much does time slicing play a role in it As time slicing is time consuming process, I was expecting that when I do the same work using a two thread process or by a t thread process, the amount of time taken by the t thread process will be more Any suggestions?

    Read the article

  • What is the preferred/recommend way of running two version of ubuntu side by side

    - by GreyGeek
    I am running 14.04, but I need to run some corporate software/scripts that have been specifically designed for 12.04. I am aware of virtual box/vmware for full virtualization but I am looking for something more lightweight (on my windows machine both come at a significant cost in battery life) closer to os virtualization level. Ideally, I would like something like windows 7/8 compatibility mode: the ability to run a program as if I were on 12.04. Does Ubuntu/Linux have such mechanism? What is the preferred way of running programs/scripts designed for an older version of Ubuntu?

    Read the article

  • O'Reilly Deal of the day - 5/JSep/2012 - Programming Windows 8 Applications with C#

    - by TATWORTH
    Today's deal of the day from O'Reilly at http://shop.oreilly.com/product/0636920024200.do?code=DEAL is Programming Windows 8 Applications with C# ."With Early Release e-books, you get books in their earliest form — the author's raw and unedited content as he or she writes — so you can take advantage of these technologies long before the official release of these titles. You'll also receive updates when significant changes are made, new chapters as they're written, and the final e-book bundle. If you want to build Windows 8 applications for desktops and the forthcoming Microsoft Surface tablet PC, this book will show you how to work with the Metro design language and the Windows RT operating system. You’ll learn this new landscape step-by-step, including the minute system details and design specifications necessary to innovate and build a variety of Windows 8 apps. It’s ideal for .NET developers who use C#."

    Read the article

  • JET now available on OTN

    - by mramcha
    I know some of you have been waiting patiently, so I'm pleased to announce that the JET bundle is now available for download on the Oracle Technology Network. I've migrated most of the content from the old Sun wiki site, and got the download in a single handy location on OTN. Download JET now.  The version available is the current latest, which is 4.9.4. This version contains a number of updates, the most significant of which is the ability to specify slot locations instead of the traditional cXtYdZsN nomenclature. This is pretty useful when trying to Jumpstart multiple servers with SAS2.0 based HBAs, as they will have the WWN embedded in the cXtYdZsN name, and it's pretty difficult to guess what that will be until you've booted the server. The JetSDS and JetZFS modules have also been updated to use the slot terminology. Happy JETing,

    Read the article

  • Reducing the size of the EDB file.

    - by Toby
    I have hit an issue on a MS SBS machine where every morning the datastore for the exchange mailboxes dismounts itself. We believe the issue is that it has grown too large over time and needs cut down a bit. As part of this we have removed (purged) some mail files that were no longer needed, which should have given us a saving of roughly 3GB (more than enough saving for what we need). So I deleted the mailboxes, then purged them and noticed that the .edb file was still reporting the same size, I dismounted and remounted it to see if that would have any effect but it did not. Am I missing a step? I have read online that you can run offline defrag on the file but that seems to only save you a small amount of whitespace. Any help would be greatly appreciated.

    Read the article

  • Is there any Google Adsense revenue if a visitor rolls over (hovers) on an ad unit?

    - by torr
    I have noticed an increase in interactive flash animations especilly on 300px wide adsense ads. Many of them ask the visitor to rollover to either reveal what the ad is about, show a clip, etc. So I wonder: the visitor is giving attention to this ad, is viewing its message -- without clicking on it. In essence, the ad agency's objective is accomplished without a click, which would be a significant money saver if PPC is considered. This seems very ingenious on their part, and I wonder how this is handled by Google. Shouldn't there be a fee for a publisher if visitors interact with ads, regardless of clicks? CTR becomes irrelevant in this context. Are you aware of anything being discussed in this respect?

    Read the article

  • where do you track team Decisions

    - by rerun
    I have been on many development teams and as the team matures decisions about direction are made. These decisions often come back up over and over. Like why don't we fill in this field why didn't we use memcache over a custom solutions. These decisions add up over time and become a significant part of style guides coding standards and unit tests. My question is I have never run into a good way of tracking these decisions or the discovery that went into making them. Does anyone have a best practice.

    Read the article

  • 1000 most visited sites on the web: A Google Analysis

    Google has released an analysis on the 1000 most visited sites on the web. Considering that we own/operate 3 of the top 10 sites and has a significant interest in Facebook, plus this recent report that states that Microsoft employees are the most social-media-savvy will go to great lengths to show how well we can operate in our cloud and social media integration and collaboration strategies. William Tay 2000-2010 | Swinging Technologist http://www.softwaremaker.net/blog...Did you know that DotNetSlackers also publishes .net articles written by top known .net Authors? We already have over 80 articles in several categories including Silverlight. Take a look: here.

    Read the article

  • Monitor screen size and programming ease

    - by rrazd
    I recently heard that a big part in successful/quick debugging and easing the process of programming is to use a big screen. I may be purchasing a new computer in the future and this has me wondering: 1)Is the aforementioned statement actually true or is it a bit of a stretch? 2)Have you noticed that this plays a significant enough part to buy a bigger screen if the bigger screen is significantly more expensive? 3)Is it common for developers to work on 13'' laptop screen as their main (and only) workstation (this is what I currently develop on) or is this actually disadvantageous? This may be subjective but any professional opinions/experiences would be greatly appreciated!

    Read the article

  • What's the reason in your mind Exception are heavily used in Managed (C# and Java) language but not in C++?

    - by ZijingWu
    AFAIK, a lot of C++ projects don't allow exceptions and deny them in coding guidelines. I have a lot of reasons, for example, Exception is hard to handle correctly if your binary needs to be compiled by separate and different compilers. But it doesn't fully convince me, there is a lot of projects which are just using one compiler. Compared to C++, Exceptions are heavily used in C# and Java and the reason can only be that Exception are not bringing enough benefit. One point is Debugbility in practice. Exception can not get the call stack in C++ code, but in C# and Java you can get the call stack from Exception, it is significant and makes debugging easier. No-CallStack is not the fault of the Exception, it is the language difference , but it impacts the Exception usage. So what's the reason that exceptions are frowned upon in c++ programs?

    Read the article

  • I was going to get an iPhone, BUT ..

    My cell phone contract expires in a couple weeks and I was all set to buy an iPhone. The iPhone had started to take off when I got my current phone / contract but at that the time Microsoft paid for a significant portion of my phone bill so staying with a Windows powered phone was appropriate (I like to be a good team player.)  Budget tightening as changed the expense policy and now Microsofts contribution to my cell phone expenses is limited to $35. So, I figured Id get an iPhone, its...Did you know that DotNetSlackers also publishes .net articles written by top known .net Authors? We already have over 80 articles in several categories including Silverlight. Take a look: here.

    Read the article

  • Local Small Businesses Are in Need of Your SEO Skills

    Local Small Businesses are in need of your skills to get a web presence that is ranked highly in search engines. What if I told you that you could make significant, even full-time income in one of the biggest online markets, and I told you that this big market is least competitive too. You don't even need to have your own product or your own mailing list for this to work. Here is one of the most important parts, you don't need to sell these products to make profit either, and no this is not affiliate marketing.

    Read the article

  • What's New in JMS 2 - Part 1

    - by reza_rahman
    JMS 2 is one of the most significant parts of Java EE 7. One of the principal goals of the JMS 2 API is improving developer productivity by reducing the amount of code to work with JMS by adopting programming paradigms like higher level abstractions, dependency injection, annotations, runtime exceptions, the builder pattern and intelligent defaults. In a recent OTN article, JMS 2 specification lead Nigel Deakin covers the ease-of-use changes in detail. The article is the first of a two part series on JMS 2. For more visual folks, there is my JMS 2 slide deck: What’s New in Java Message Service 2 from Reza Rahman You can also check out the official specification yourself or try things out with the newly released Java EE 7 SDK.

    Read the article

  • Ubuntu 11.10 boot: xhost: unable to open display

    - by paulus_almighty
    I've had this papercut for a while now, it's time it was fixed. When I boot up Ubuntu, choosing "Ubuntu...generic" from the grub screen, Ubuntu fails to load. It just sits at the driver/module loading screen. What seems to be the most significant line in this output is "xhost: unable to open display" If I choose "Ubuntu...(recovery mode)" from grub then it loads OK. I don't get why this is. Out of interest I tried enabling boot error logging with #/etc/default/bootlogd BOOTLOGD_ENABLE=Yes but I'm not seeing anything in that file. ETA: I've had this problem since fresh install of 11.10. Here's lshw: $ sudo lshw -C display *-display description: VGA compatible controller product: GF104 [GeForce GTX 460] vendor: nVidia Corporation physical id: 0 bus info: pci@0000:03:00.0 version: a1 width: 64 bits clock: 33MHz capabilities: pm msi pciexpress vga_controller bus_master cap_list rom configuration: driver=nvidia latency=0 resources: irq:16 memory:f6000000-f7ffffff memory:e0000000-e7ffffff memory:ec000000-efffffff ioport:bf00(size=128) memory:e8000000-e807ffff

    Read the article

  • overriding ctype<wchar_t>

    - by Potatoswatter
    I'm writing a lambda calculus interpreter for fun and practice. I got iostreams to properly tokenize identifiers by adding a ctype facet which defines punctuation as whitespace: struct token_ctype : ctype<char> { mask t[ table_size ]; token_ctype() : ctype<char>( t ) { for ( size_t tx = 0; tx < table_size; ++ tx ) { t[tx] = isalnum( tx )? alnum : space; } } }; (classic_table() would probably be cleaner but that doesn't work on OS X!) And then swap the facet in when I hit an identifier: locale token_loc( in.getloc(), new token_ctype ); … locale const &oldloc = in.imbue( token_loc ); in.unget() >> token; in.imbue( oldloc ); There seems to be surprisingly little lambda calculus code on the Web. Most of what I've found so far is full of unicode ? characters. So I thought to try adding Unicode support. But ctype<wchar_t> works completely differently from ctype<char>. There is no master table; there are four methods do_is x2, do_scan_is, and do_scan_not. So I did this: struct token_ctype : ctype< wchar_t > { typedef ctype<wchar_t> base; bool do_is( mask m, char_type c ) const { return base::do_is(m,c) || (m&space) && ( base::do_is(punct,c) || c == L'?' ); } const char_type* do_is (const char_type* lo, const char_type* hi, mask* vec) const { base::do_is(lo,hi,vec); for ( mask *vp = vec; lo != hi; ++ vp, ++ lo ) { if ( *vp & punct || *lo == L'?' ) *vp |= space; } return hi; } const char_type *do_scan_is (mask m, const char_type* lo, const char_type* hi) const { if ( m & space ) m |= punct; hi = do_scan_is(m,lo,hi); if ( m & space ) hi = find( lo, hi, L'?' ); return hi; } const char_type *do_scan_not (mask m, const char_type* lo, const char_type* hi) const { if ( m & space ) { m |= punct; while ( * ( lo = base::do_scan_not(m,lo,hi) ) == L'?' && lo != hi ) ++ lo; return lo; } return base::do_scan_not(m,lo,hi); } }; (Apologies for the flat formatting; the preview converted the tabs differently.) The code is WAY less elegant. I does better express the notion that only punctuation is additional whitespace, but that would've been fine in the original had I had classic_table. Is there a simpler way to do this? Do I really need all those overloads? (Testing showed do_scan_not is extraneous here, but I'm thinking more broadly.) Am I abusing facets in the first place? Is the above even correct? Would it be better style to implement less logic?

    Read the article

  • Using SQLXML Bulk Load in .NET Environment - Error with One to Many relationship on Complex Type

    - by user331111
    Hi, I have an error when I am importing an XML file using SQLXMLBulkLoad, wondering if anyone could help. Error: Data mapping to column 'Attribute' was already found in the data. Make sure that no two schema definitions map to the same column Full files and details can be found here http://www.experts-exchange.com/Microsoft/Development/MS-SQL-Server/SQL-Server-2005/Q_26102239.html Exert from XSD: <sql:relationship name="EnvironmentDECAttributes" parent="Environment" parent-key="intEnvironmentID" child="DECAttributes" child-key="intEnvironmentID"/> <complexType name="Environment"> <sequence> <element name="ESANumber" minOccurs="0"> <annotation> <documentation> Environmentally Sensitive Area Number </documentation> </annotation> <simpleType> <restriction base="string"> <maxLength value="15"/> <whiteSpace value="collapse"/> </restriction> </simpleType> </element> <element name="Conditions" minOccurs="0" sql:relation="Conditions" sql:relationship="EnvironmentConditions"> <complexType> <sequence> <element name="Condition" type="vms:EnvironmentalConditions" minOccurs="0" maxOccurs="5"/> </sequence> </complexType> </element> <element name="DECDistrict" minOccurs="0"> <annotation> <documentation> Department of Environment &amp; Conservation District </documentation> </annotation> <simpleType> <restriction base="string"> <maxLength value="31"/> <whiteSpace value="collapse"/> </restriction> </simpleType> </element> <element name="DECAttributes" minOccurs="0" maxOccurs="1" sql:relation="DECAttributes" sql:relationship="EnvironmentDECAttributes"> <complexType> <sequence> <element name="Attribute" type="vms:DECAttributes" minOccurs="0" maxOccurs="unbounded" sql:field="Attribute"> <annotation> <documentation> Department of Environment &amp; Conservation attributes. </documentation> </annotation> </element> </sequence> </complexType> </element> </sequence> </complexType> Exert from XML: <Environment> <DECAttributes> <Attribute>WA</Attribute> <Attribute>SA</Attribute> </DECAttributes> </Environment> Any help/ comments would be appreciated Thanks C

    Read the article

  • XmlException - inserting attribute gives "unexpected token" exception

    - by Anders Svensson
    Hi, I have an XmlDocument object in C# that I transform, using XslTransform, to html. In the stylesheet I insert an id attribute in a span tag, taking the id from an element in the XmlDocument. Here is the template for the element: <xsl:template match="word"> <span> <xsl:attribute name="id"><xsl:value-of select="@id"></xsl:value-of></xsl:attribute> <xsl:apply-templates/> </span> </xsl:template> But then I want to process the result document as an xhtml document (using the XmlDocument dom). So I'm taking a selected element in the html, creating a range out of it, and try to load the element using XmlLoad(): wordElem.LoadXml(range.htmlText); But this gives me the following exception: "'598' is an unexpected token. The expected token is '"' or '''. Line 1, position 10." And if I move the cursor over the range.htmlText, I see the tags for the element, and the "id" shows without quotes, which confuses me (i.e.SPAN id=598 instead of SPAN id="598"). To confuse the matter further, if I insert a blank space or something like that in the value of the id in the stylesheet, it works fine, i.e.: <span> <xsl:attribute name="id"><xsl:text> </xsl:text> <xsl:value-of select="@id"></xsl:value-of></xsl:attribute> <xsl:apply-templates/> </span> (Notice the whitespace in the xsl:text element). Now if I move the cursor over the range.htmlText, I see an id with quotes as usual in attributes (and as it shows if I open the html file in notepad or something). What is going on here? Why can't I insert an attribute this way and have a result that is acceptable as xhtml for XmlDocument to read? I feel I am missing something fundamental, but all this surprises me, since I do this sort of transformations using xsl:attribute to insert attributes all the time for other types of xsl transformations. Why doesn't XmlDocument accept this value? By the way, it doesn't matter if it is an id attribute. i have tried with the "class" attribute, "style" etc, and also using literal values such as "style" and setting the value to "color:red" and so on. The compiler always complains it is an unvalid token, and does not include quotes for the value unless there is a whitespace or something else in there (linebreaks etc.). I hope I have provided enough information. Any help will be greatly appreciated. Basically, what I want to accomplish is set an id in a span element in html, select a word in a webbrowser control with this document loaded, and get the id attribute out of the selected element. I've accomplished everything, and can actually do what I want, but only if I use regex e.g. to get the attribute value, and I want to be able to use XmlDocument instead to simply get the value out of the attribute directly. I'm sure I'm missing something simple, but if so please tell me. Regards, Anders

    Read the article

  • C#/WPF - RoutedEvent in WPF class that isn't a UIElement

    - by Andreas
    I have a class that needs to notify that something significant has occured. The class is in a WPF-project, even though this specific class, is lookless (and doesn't inherit from UIElement, neither directly or indirectly). Normally, I just register a RoutedEvent to get this functionality but as this class neither has AddHandler nor RemoveHandler, I can't get it to work. Anyone knows of another way of get the RoutedEvent behaviour?

    Read the article

< Previous Page | 29 30 31 32 33 34 35 36 37 38 39 40  | Next Page >