Search Results

Search found 48557 results on 1943 pages for 'oracle text'.

Page 350/1943 | < Previous Page | 346 347 348 349 350 351 352 353 354 355 356 357  | Next Page >

  • Oracle VM provisioning from dnsmasq

    - by Mircea Vutcovici
    I have Oracle VM 2.2.0 and a provisioning server (dhcp/tftp/http) based on dnsmasq. A VM that it is configure too boot from the network, is receiving the IP, but it is failing to boot. The error displayed by gPXE 0.9.3+ is: No filename or root path specified

    Read the article

  • Mac OSX: Adobe Flash player 10.1.85.3 text issue

    - by sparkey
    Running Flash Player 10.1.85.3. on OS-X 10.6.4 I've run into a very strange issue with Adobe/Macromedia Flash. Text in dialogs sometimes is not displayed, and the containing boxes are distorted. It occurs in all browsers. This is best demonstrated on YouTube in some of their ads, as well as in Google Analytics overlays on graphs. You can see the issue here: As you can see, where I have moused over the high point, there should be a dialog with some text, but instead it is quite broken. I've tried uninstalling and reinstalling the Flash plugin several times, reinstalling Google Chrome, validating my fonts with FontBook (removed all dupes/ fonts with warnings). Also as a last resort I checked/ repaired perms on my disk. What should I do?

    Read the article

  • Windows apps keep switching to accented text

    - by Josh Kelley
    Somehow I keep hitting a shortcut key (or something similar) that enables the input of accented text. Whenever this accented text mode is enabled, pressing ' doesn't respond immediately; instead, the ' key is remembered, so if I press a vowel after that, I get the vowel with an acute accent mark, and if I press any other key, I immediately get an apostrophe followed by the other key. I don't want this to happen. It's very annoying. How do I disable this mode? I only remember seeing this in Firefox 3.6.3 and Pidgin 2.6.6, so maybe it's a GTK feature. It apparently happens on a per-application basis, and restarting the application fixes it. I checked Windows 7's "Region and Language" control panel and didn't see anything relevant (although I'm not intimately familiar with all of those settings, so I may have overlooked something).

    Read the article

  • how to find out which servers are accessing Oracle Internet Directory ?

    - by mad sammy
    Hi, We have a OID which is maintaining data about various users. This OID is being accessed by many weblogic servers. Weblogic servers are getting authenticated using this LDAP, but when a particular server authentication fails it causes authentication process failure for all servers, so we want to track that specific server which is causing this error. Is there any facility to know which servers are using the OID or i would like to know that does OID maintains any LOGs of its usage for security purpose.. Thanks.

    Read the article

  • How to color highlight text in a black/white document easily

    - by Lateron
    I am editing a 96 chapter book. The text is in normal black letters on a white background. What I want to be able to do is: I want to have any changes or additions automatically shown in another (per-selected) color. Without having to a)high lite a word or phrase to be changed or added and then b)going to the toolbar and clicking on the font color In other words I want the original color of the text to remain as it is and any additions or changes to be visible in another color without having to use the toolbar. Can this be done? I use OpenOffice or Word 2007 in Windows 7.

    Read the article

  • Text template or tool for documentation of computer configurations

    - by mjustin
    I regularly write and update technical documentation which will be used to set up a new virtual machine, or to have a lookup for system dependencies in networks with around 20-50 (server-side) computers. At the moment I use OpenOffice Writer with text tables, and create one document per intranet domain. To improve this documentation, I would like to collect some examples to identify areas where my documents can be improved, regarding general structure and content, to make it easy to read and use not only for me but also for technical staff, helpdesk etc. Are there simple text templates (for example for OpenOffice Writer) or tools (maybe database-driven) for structured documentation of a computer configuration? Such a template / tool should provide required and optional configuration sections, like 'operating system', 'installed services', 'mapped network drives', 'scheduled tasks', 'remote servers', 'logon user account', 'firewall settings', 'hard disk size' ... It is not so much low-level hardware docs but more infrastructure / integration information in these documents (no BIOS settings, MAC addresses).

    Read the article

  • logfile deleted on Oracle database how to re-create it?

    - by Daniel
    for my database assignment we were looking into 'database corruption' and I was asked to delete the second redo log file which I have done with the command: rm log02a.rdo this was in the $HOME/ORADATA/u03 directory. Now I started up my database using startup pfile=$PFILE nomount then I mounted it using the command alter database mount; now when I try to open it alter database open; it gives me the error: ORA-03113: end-of-file on communication channel Process ID: 22125 Session ID: 25 Serial number: 1 I am assuming this is because the second redo log file is missing. There is still log01a.rdo, but not the one I have deleted. How can I go about recovering this now so that I can open my database again? I have looked into the database created scripts, and it specified the log02a.rdo file to be size 10M and part of group 2. If I do select group#, member from v$logfile; I get: 1 /oradata/student_db/user06/ORADATA/u03/log01a.rdo 2 /oradata/student_db/user06/ORADATA/u03/log02a.rdo 3 /oradata/student_db/user06/ORADATA/u03/log03a.rdo 4 /oradata/student_db/user06/ORADATA/u03/log04a.rdo So it is part of group 2. If I try to add the log02a.rdo file again "already part of the database". If I drop group 2 and then add it again with these commands: ALTER DATABASE ADD LOGFILE GROUP 2 ('$HOME/ORADATA/u03/log02a.rdo') SIZE 10M; Nothing. Supposedly alters the database, but it still won't start up. Any ideas what I can do to re-create this and be able to open my database again?

    Read the article

  • Text on Cisco ASA console is garbled/missing letters

    - by Some Linux Nerd
    I've actually looked up a number of solutions for this problem and none of them work. There's this Cisco ASA 5505 that I'd like to use, that outputs mildly garbled text with missing characters. I did some googling and found that the most likely problem is a bad baud rate, so I tried all the baud rates, 7N1, 8N2... basically every possibility minicom had. Then I figured (since I can type ok, just not read) that if I factory reset it that it would fix whatever is set wrong with the terminal. That didn't work either. This usb-db9 adapter and console cable work fine on the catalyst switch in our office. My serial settings are 9600 8N1 with no flow control. Anyone know how to fix this? I have an example of the text on pastebin: http://pastebin.com/MAJF0mVU - it's just lots of "Dfaut cnfiuraionfil cotais 1enty." instead of "Default configuration blah blah"

    Read the article

  • SQL Server 2008 R2 Writing To Text File

    - by zzzzzzzzzzzzzzzzzzzzzzzzzzzzzz
    I used to write to text files from SQL Server using the code listed below: DECLARE @FS INT --File System Object DECLARE @OLEResult INT --Result message/code DECLARE @FileID INT --Pointer to file --Create file system object (OLE Object) EXECUTE @OLEResult = sp_OACreate 'Scripting.FileSystemObject', @FS OUT IF @OLEResult <> 0 PRINT 'Scripting.FileSystemObject.Failed' -----OPEN FILE----- EXECUTE @OLEResult = sp_OAMethod @FS, 'OpenTextFile', @FileID OUT, @FileName, 8, 1 IF @OLEResult <> 0 PRINT 'OpenTextFile.Failed' It appears this is no longer supported in sql server 2008 r2. How should I export to text files in sql server 2008 r2? Link claiming this is no longer supported: http://social.msdn.microsoft.com/Forums/en/transactsql/thread/f8512bec-915c-44a2-ba9d-e679f98ba313

    Read the article

  • Oracle Virtualbox on statically compiled kernel

    - by aking1012
    I can't seem to find any documentation on the subject. I'm working on putting together a linux install for a fairly "dirty" environment. Best practice there would be a statically compiled kernel with no module support. I can already do the customizations to strip out unnecessary drivers/etc to get the performance and disable module support. Does anyone have a link or any ideas on how to get the Oracle Virtualbox module (not the OSE one, I need USB passthrough) compiled in?

    Read the article

  • Converting PDF portfolios to plain text (pdftotext?)

    - by Andrea
    I am trying to convert a large number of PDFs (~15000) to plain text using pdftotext. This is working pretty well except for a few of the PDFs (~600) which, I guess, are "PDF portfolios." When I run these PDFs through pdftotext, it just outputs: For the best experience, open this PDF portfolio in Acrobat 9 or Adobe Reader 9, or later. Get Adobe Reader Now! If I do open these PDFs in Adobe Reader, they look like two or more PDFs inside a single file. Has anyone encountered this issue before? Is there any tool I can use to convert these PDFs automatically? (Either directly to text or at least to regular PDFs that pdftotext can then understand.)

    Read the article

  • Replace special text with sed?

    - by user143822
    I'm using CMD on Windows Xp to replace special text with Sed. I'm using this command for replace special characters like $ or * : sed -i "s/\*/123/g;" 1.txt But how command must i use to replace this strings with ciao! in my text files? Is possible? \\ \\\ "" sed.exe -i "s/{\*)(//123/ sed -i "s/\\/123/g;" 1.txt the previous command does not work because i have \, " and other special strings that sed use to make regex.

    Read the article

  • Can I prevent Oracle users from creating public synonyms but allow private ones?

    - by ninesided
    I've had a few issues where users have mistakenly created public synonyms which have led to people thinking some objects are in one schema when they're actually in another schema. Everyone knows they should be using private synonyms, but occasionally they forget or they make a mistake and someone gets burned. Is it possible to GRANT users the permission to create private synonyms but disallow public ones?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Create text file named after a cell containing other cell data

    - by user143041
    I tried using the code below for the Excel program on my `Mac Mini using the OS X Version 10.7.2 and it keeps saying Error due to file name / path: (The Excel file I am creating is going to be a template with my formulas and macros installed which will be used over and over). Sub CreateFile() Do While Not IsEmpty(ActiveCell.Offset(0, 1)) MyFile = ActiveCell.Value & ".txt" fnum = FreeFile() Open MyFile For Output As fnum Print #fnum, ActiveCell.Offset(0, 1) & " " & ActiveCell.Offset(0, 2) Close #fnum ActiveCell.Offset(1, 0).Select Loop End Sub What Im trying to do: 1st Objective I would like to have the following data to be used to create a text file. A:A is what I need the name of the file to be. B:2 is the content I need in the text file. So, A2 - "repair-video-game-Glassboro-NJ-08028.txt" is the file name and B2 to be the content in the file. Next, A3 is the file name and B3 is the content for the file, etc. ONCE the content reads what is in cell A16 and B16 (length will vary), the file creation should stop, if not then I can delete the additional files created. This sheet will never change. Is there a way to establish the excel macro to always go to this sheet instead of have to select it with the mouse to identify the starting point? 2nd Objective I would like to have the following data to be used to create a text file. A:1 is what I need the name of the file to be. B:B is the content I want in the file. So, A2 - is the file name "geo-sitemap.xml" and B:B to be the content in the file (ignore the .xml file extension in the photo). ONCE the content cell reads what is in cell "B16" (length will vary), the file creation should stop, if not then I can adjust the cells that have need content (formulated content you see in the image is preset for 500 rows). This sheet will never change. Is there a way to establish the excel macro to always go to this sheet instead of have to select it with the mouse to identify the starting point? I can Provide the content in the cells that are filled in by excel formulas that are not not to be included in the .txt files. It is ok if it is not possible. I can delete the extra cells that are not populated (based on the data sheet). Please let me know if you need any more additional information or clarity and I will be happy to provide it.

    Read the article

  • Trouble with Ubuntu on Oracle VM

    - by Rosarch
    I'm running Ubuntu on an Oracle VirtualBox virtual machine. I clicked the "install Ubuntu" button, and it took me through a wizard. I am currently on the following step: Unfortunately, the "forward" button is disabled. What's up with this? I tried entering different data for the form on this step, going back and redoing part of the wizard, and rebooting the machine. Nothing worked. My host OS is Windows 7.

    Read the article

  • Oracle error when logging into database

    - by Bryan
    When I try to log into my db with a specific user I get this message. Below is from the alert log. I can login as system just fine. Anyone know how to figure out what is causing this? Thanks in advance for the help. ----- Error Stack Dump ----- ORA-00604: error occurred at recursive SQL level 1 ORA-01438: value larger than specified precision allowed for this column ORA-06512: at line 2 Oracle 10g OEL 5.5

    Read the article

  • How to put text in same row but different column if a certain text is present in the same row?

    - by melai
    How can I put text in the same row but different column if a certain text is present in the same row? Issue Area Correction Done Process changed bin Process skip lap converted to global Security done global migration Process changed bin How can I code this in a macro? For example: If the correction done is in the cell, the Issue should be Process automatically. If the word global is present the Issue should be Security. I have 500 rows and I want to have the code until row 500.

    Read the article

< Previous Page | 346 347 348 349 350 351 352 353 354 355 356 357  | Next Page >