Search Results

Search found 29935 results on 1198 pages for 'open ldap'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 359/1198 | < Previous Page | 355 356 357 358 359 360 361 362 363 364 365 366  | Next Page >

  • Python UTF-16 encoding hex representation

    - by Romeno
    I have a string in Python 2.7.2 say u"\u0638". When I write it to file: f = open("J:\\111.txt", "w+") f.write(u"\u0638".encode('utf-16')) f.close() In hex it looks like: FF FE 38 06 When i print such a string to stdout i will see: '\xff\xfe8\x06'. The querstion: Where is \x38 in the string output to stdout? In other words why the string output to stdout is not '\xff\xfe\x38\x06'? If I write the string to file twice: f = open("J:\\111.txt", "w+") f.write(u"\u0638".encode('utf-16')) f.write(u"\u0638".encode('utf-16')) f.close() The hex representation in file contains byte order mark (BOM) \xff\xfe twice: FF FE 38 06 FF FE 38 06 I wonder what is the techique to avoid writting BOM in UTF-16 encoded strings?

    Read the article

  • Excel 2010 Access to path is denied temp

    - by Chris Anderson
    I am using excel data reader to read data from an excel file. FileStream stream = File.Open(filePath, FileMode.Open, FileAccess.Read); //1. Reading from a binary Excel file ('97-2003 format; *.xls) IExcelDataReader excelReader = ExcelReaderFactory.CreateBinaryReader(stream); //2. Reading from a OpenXml Excel file (2007 format; *.xlsx) IExcelDataReader excelReader = ExcelReaderFactory.CreateOpenXmlReader(stream); http://exceldatareader.codeplex.com/ This reads excel 1997-2003 format and excel 2007 format on my local machine and when we move it to our test server. However, when moved to production, it works for excel 97-2003 files, but when I try to read 2007 files I receive the following error: Access to the path 'C:\Documents and Settings\PORTALS03\ASPNET\LOCALS~1\Temp\TMP_Z129388041687919815' is denied. How is it possible that the 97-2003 excel file can be read but the 2007 files throw access is denied?

    Read the article

  • How can I parse this configuration file format (allowing comments) in Perl?

    - by rockyurock
    I am reading some parameters (from user input) from a .txt file and want to make sure that my script could read it even a space or tab is left before that particular parameter by user. Also if I want to add a comment for each parameter followed by # , after the parameter (e.g 7870 # this is default port number) to let the user know about the parameter How can I achieve it in same file? Right now, I am using split /\|\s/. Code: $data_file="config.txt"; open(RAK, $data_file)|| die("Could not open file!"); @raw_data=<RAK>; @Ftp_Server =split(/\|\s/,$raw_data[32]); config.txt (user input file) PING_TTL | 1 CLIENT_PORT | 7870 FTP_SERVER | 192.162.522.222 Could any body suggest me a robust way to do it? /rocky

    Read the article

  • Web service reference location?

    - by Damien Dennehy
    I have a Visual Studio 2008 solution that's currently consisting of three projects: A DataFactory project for Business Logic/Data Access. A Web project consisting of the actual user interface, pages, controls, etc. A Web.Core project consisting of utility classes, etc. The application requires consuming a web service. Normally I'd add the service reference to the Web project, but I'm not sure if this is best practice or not. The following options are open to me: Add the reference to the Web project. Add the reference to the Web.Core project, and create a wrapper method that Web will call to consume the web service. Add a new project called Web.Services, and copy step 2. This project is expected to increase in size so I'm open to any suggestions.

    Read the article

  • Javascript/iframe/embed/object question

    - by thinkfuture
    OK, so here is my issue. I'm building a system which will allow people to embed lists of links on their pages. When the link is clicked, i'd like to use something like Lightview or Lightwindow to open it up over the whole window, not just in the iframe. I don't have access to the page that the user will be embedding this object into. Everything I've tried so far tells me that I can't open anything over the parent window, since I don't have access to it from the iframe or object, javacript security issue. However, I've seen sites that do that kind of overlay. so it must be possible. If anyone can point me to any resources that could help, that would be great. if it matters, i'm using Ruby on Rails... Thanks...chris

    Read the article

  • Algorithmic trading software safety guards

    - by Adal
    I'm working on an automatic trading system. What sorts of safe-guards should I have in place? The main idea I have is to have multiple pieces checking each other. I will have a second independent little process which will also connect to the same trading account and monitor simple things, like ensuring the total net position does not go over a certain limit, or that there are no more than N orders in 10 minutes for example, or more than M positions open simultaneously. You can also check that the actual open positions correspond to what the strategy process thinks it actually holds. As a bonus I could run this checker process on a different machine/network provider. Besides the checks in the main strategy, this will ensure that whatever weird bug occurs, nothing really bad can happen. Any other things I should monitor and be aware of?

    Read the article

  • XSLT: How to escape square brackets in Urls

    - by ilariac
    I have a set of records from Solr where field[@name='url'] can have the following format: http://url/blabla/blabla.aspx?sv=[keyword%20keyword,%201] My understanding is that the square brackets denote an array syntax and I would like to use XSLT to remove the square brackets from all Urls. The reason for this is that I am using an Open URL resolver, which does not currently handle well those characters. The best option would be to strip the square brackets from all URLs before such resources are mediated by the Open URL resolver. There are cases where I have multiple occurrences of square brackets per Url. Can you please help me with this? Thanks for your help, I.

    Read the article

  • SharePoint 2010 is forcing me to safe PDF when opening from doc library

    - by Tobias Funke
    I have a document library with a PDF file. Whenever I click on the PDF file, I am prompted to save the file. I do not get the option of opening the file, I am forced to save it. What I want is for the PDF file to open, either in the browser or in a separate Adobe Reader window, depending on the Adobe Reader settings. I'm pretty sure SharePoint is responsible for this behavior, because if I put the PDF on my hard drive, then create a HTML file with a link to the file, it opens in the browser when I click on it. Please note: I looked at this question and did not help. I don't care if the PDF opens in the browser or in a separate Adobe Reader window, I just want it to open.

    Read the article

  • An unhandled exception of type 'System.StackOverflowException' occurred in mscorlib.dll

    - by Sahar
    Hello everybody i wrote a code in asp.net that read data from files and draw a graph. It worked but after awhile when i run the program, this exception arise "An unhandled exception of type 'System.StackOverflowException' occurred in mscorlib.dll" in this statement in the code: if (File.Exists(fName)) <----(here is the exception) { stream = File.Open(fName, FileMode.Open); g_day = Deserialize(stream); stream.Close(); int cn = 0; if (g_day.Values.Count != 0) cn = g_day.Values[g_day.Values.Count - 1].Value; Label1.Text = cn.ToString(); } can u help me

    Read the article

  • Access Denied Java FileWriter / FileInputStream

    - by Matt
    My program downloads a websites source code, modifies it, creates the file, and then reuploads it through the FTP. However, I receive the following error when trying to open the created file: java.io.FileNotFoundException: misc.html (Access is denied) at java.io.FileInputStream.open(Native Method) at java.io.FileInputStream.<init>(Unknown Source) at Manipulator.uploadSource(Manipulator.java:63) at Start.addPicture(Start.java:130) at Start$2.actionPerformed(Start.java:83) at javax.swing.AbstractButton.fireActionPerformed(Unknown Source) at javax.swing.AbstractButton$Handler.actionPerformed(Unknown Source) at javax.swing.DefaultButtonModel.fireActionPerformed(Unknown Source) at javax.swing.DefaultButtonModel.setPressed(Unknown Source) at javax.swing.plaf.basic.BasicButtonListener.mouseReleased(Unknown Source) at java.awt.Component.processMouseEvent(Unknown Source) at javax.swing.JComponent.processMouseEvent(Unknown Source) at java.awt.Component.processEvent(Unknown Source) at java.awt.Container.processEvent(Unknown Source) at java.awt.Component.dispatchEventImpl(Unknown Source) at java.awt.Container.dispatchEventImpl(Unknown Source) at java.awt.Component.dispatchEvent(Unknown Source) at java.awt.LightweightDispatcher.retargetMouseEvent(Unknown Source) at java.awt.LightweightDispatcher.processMouseEvent(Unknown Source) at java.awt.LightweightDispatcher.dispatchEvent(Unknown Source) at java.awt.Container.dispatchEventImpl(Unknown Source) at java.awt.Window.dispatchEventImpl(Unknown Source) at java.awt.Component.dispatchEvent(Unknown Source) at java.awt.EventQueue.dispatchEvent(Unknown Source) at java.awt.EventDispatchThread.pumpOneEventForFilters(Unknown Source) at java.awt.EventDispatchThread.pumpEventsForFilter(Unknown Source) at java.awt.EventDispatchThread.pumpEventsForHierarchy(Unknown Source) at java.awt.EventDispatchThread.pumpEvents(Unknown Source) at java.awt.EventDispatchThread.pumpEvents(Unknown Source) at java.awt.EventDispatchThread.run(Unknown Source) When I navigate to the folder directory and attempt to open "misc.html" with Notepad I receive Access is Denied. My code is fairly simple: File f = new File(page.sourceFileName); try { FileWriter out = new FileWriter(f); out.write(page.source); out.close(); } catch (IOException e) { e.printStackTrace(); } InputStream input = new FileInputStream(f); This is the vital excerpt from my program. I have copied this into a different test program and it works fine, I create a misc.html file and reopen it with both FileInputStream and manually. I would be worried about Administrator rights but the Test program works fine when I run it RIGHT after the problem program. I also have checked if the file exists and is a file with File methods and it is as well. Is this a result of me not closing a previous Input/Output properly? I've tried to check everything and I am fairly positive I close all streams as soon as they finish... Help! :)

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Running a service with a user from a different domain not working

    - by EWood
    I've been stuck on this for a while, not sure what permission I'm missing. I've got domain A and domain B, A trusts B, but B does not trust A. I'm trying to run a service in domain A with a user account from domain B and I keep getting Access is Denied. I'm using the FQDN after the username and the password is correct. The user account from domain B is a local administrator on the domain A server, the user account has the logon locally, and as a service permissions. Must. Get. This. Working. Update: I found something interesting in the logs I must have missed. This ought to get me pointed in the right direction. Event ID: 40961 - LsaSrv : The Security System could not establish a secured connection with the server ldap/{server fqdn/fqdn@fqdn} No authentication protocol was available. I've found a few fixes for 40961 but nothing has worked so far. I've verified reverse lookup zones. nslookup resolves the correct dc properly. still workin' at it. Upadte: In response to Evan; I ran " runas /env /user:ftp_user@fqdn "notepad" " then entered the users password and notepad came up. It seems to work successfully. This issue is now resolved. The problem is visible in the screenshot. Windows tries to use the UPN for the user account if you dig your user out of AD with the Browse button. This fails every time even with the right user and password. Simply using the SAM format (Domain\User) works. So simple, yet so annoying. Can't believe I missed this. Thanks to everyone who helped.

    Read the article

  • How to limit results in a SharePoint XSL query

    - by David
    Hello all, I am creating a SharePoint site that we will use to report issues with trucks used in our business. Linked to the list I have created will be a page that will display an overview of the trucks and a little truck icon will show the trucks current status. Green and the truck is okay (no open issues), Red and the truck have an open issue with status "Undrivable", Orange and there is two issues open that requires the user to look further into the truck before using it and finally a Gray truck for when there is a new issue created that has not been looked into (not sure if it is drivable or not). I have managed to create the "Dashboard" and with my limit XSL/XPATH knowledge been able to add a truck and replicate the description above but... in my test I have created 4 issues, for example if three of them are changed to status Closed and one left to Undrivable I will get four icons on the page, three with Green trucks and the last one Red. So in theory it works but I obviously only want to see the last truck, one truck. I am not interested in seeing the others. <xsl:template name="dvt_1.rowview"> <xsl:variable name="CountReport" select="count(/dsQueryResponse/Rows/Row[@Highloader='GGEU12' and @Status!='Closed'])" /> <xsl:variable name="MoreThan" select="$CountReport &gt; 1" /> <xsl:variable name="NoReports" select="$CountReport = 0" /> <xsl:variable name="Closed" select=" @Highloader='GGEU12' and @Status='Closed'" /> <xsl:choose> <xsl:when test="$MoreThan"> <div class="ms-vb"><img title='More than one report exist!' border='0' alt='In Progress' src='highloader/Library/hl-orange.png' /></div> </xsl:when> <xsl:otherwise> <div class="ms-vb"><xsl:value-of disable-output-escaping="yes" select="@Icon" /></div> </xsl:otherwise> </xsl:choose> </xsl:template> My hope is that someone with slightly more knowledge can find the last piece of the puzzle for me! Thanks for reading and asking questions to fill any gap I left above. David

    Read the article

  • VB6 ADODB Fails with SQL Compact: Multipe-Step operation generated errors

    - by Belliez
    Hi, I am converting an old application to use SQL Compact database (it works ok with SQ Server 2005 and 2008) and using the following code gives an error when attempting to execute a simple select command: Private Const mSqlProvider As String = "Provider=Microsoft.SQLSERVER.CE.OLEDB.3.5;" Private Const mSqlHost As String = "Data Source=C:\database.sdf;" Private mCmd As ADODB.Command ' For executing SQL' Private mDbConnection As ADODB.Connection Private Sub Command1_Click() Dim DbConnectionString As String DbConnectionString = mSqlProvider & _ mSqlHost Set mDbConnection = New ADODB.Connection mDbConnection.CursorLocation = adUseClient Call mDbConnection.Open(DbConnectionString) If mDbConnection.State = adStateOpen Then Debug.Print (" Database is open") ' Initialise the command object' Set mCmd = New ADODB.Command mCmd.ActiveConnection = mDbConnection End If mCmd.CommandText = "select * from myTable" mCmd.CommandType = adCmdText mCmd.Execute ' FAILS HERE! ' End Sub I have referenced Microsoft ActiveX Data Access Object 6.0 Library in the project. The error I get is: Run-Time error -2147217887 (80040e21) Multipe-Step operation generated errors. Check each status value Just wondering if anyone has any suggestions? Thanks

    Read the article

  • Upload and parse csv file with "universal newline" in python on Google App Engine

    - by greg
    Hi, I'm uploading a csv/tsv file from a form in GAE, and I try to parse the file with python csv module. Like describe here, uploaded files in GAE are strings. So I treat my uploaded string a file-like object : file = self.request.get('catalog') catalog = csv.reader(StringIO.StringIO(file),dialect=csv.excel_tab) But new lines in my files are not necessarily '\n' (thanks to excel..), and it generated an error : Error: new-line character seen in unquoted field - do you need to open the file in universal-newline mode? Does anyone know how to use StringIO.StringIO to treat strings like files open in universal-newline?

    Read the article

  • MySQL UNION query from one table + ORDER BY

    - by ilnur777
    I have one table with two queries and I need to sort it with descending type using ORDER BY. Here is my MySQL query that does not work properly: (SELECT `text` FROM `comments` WHERE user_fr='".$user."' && archive='1' ORDER BY `is_new_fr` DESC) UNION (SELECT `text` FROM `message` WHERE user_to='".$user."' && archive='1' ORDER BY `is_new_to` DESC) Description! is_new_fr and is_new_to counts total new messages. Here is my table contant: user_fr | user_to | archive | is_new_fr | is_new_to| text name1 | name2 | 1 | 2 | 0 | testing... name2 | name1 | 1 | 0 | 5 | testing ... I want to make an order that 1st will display note that has more messages to few, or by another words using DESCending type. This is the display on the page I want to do: Open dialog with name2. Messages (5) Open dialog with name1. Messages (2) Thank you!

    Read the article

  • AIR:- Desktop Application related to Window Component (Need some work around)

    - by Mahesh Parate
    Create custom component which contains Combobox and Datagrid. Application conations two button 1) Same Window and 2) New Window. (Label of two button) When you click on “Same Window” button your custom component should get added dynamically in your application. And when you click on “New Window” button your custom component should get open in different window (it should get shifted from application and should appear in Window component). Issue faced:- Clicking on Combobox, list is not getting open as change event doesn’t get fired in Native Window as it looses reference from main application. Issue with DataGrid in Native window (AIR). • DataGridEvent.COLUMN_STRETCH event get affected if try to open datagrid in Native Window. • DataGridEvent get fired but takes long time or even stuck while column stretch Note: Application is an Desktop Application. Only one instance is created in Application for your custom component to preserve current state on your custom component it can be Style, data, or other subcomponent state of your custom component (as above mentioned 2 component are just sample). Please find sample code below:- DataGridStretchIssue.mxml:- < ?xml version="1.0" encoding="utf-8"? < mx:WindowedApplication xmlns:mx="http://www.adobe.com/2006/mxml" layout="absolute" xmlns:local="*" width="800" height="500" < mx:Script < ![CDATA[ import mx.events.FlexEvent; import mx.core.Window; private var dgComp:DataGridComp = new DataGridComp(); private var win:Window; private function clickHandler(event:Event):void{ dgComp.percentWidth = 100; dgComp.percentHeight = 100; dgComp.x = 50; dgComp.y = 100; if(win){ win.close(); } this.addChild(dgComp); } private function openClickHandler(event:MouseEvent):void{ dgComp.x = 50; dgComp.y = 100; win = new Window();; win.width = 800; win.height = 500; win.addChild(dgComp); dgComp.percentWidth = 100; dgComp.percentHeight = 100; dgComp.x = 50; dgComp.y = 100; win.open(true) } ]]> < /mx:Script < mx:HBox <mx:Button id="btnID" click="clickHandler(event)" label="Same Window"/> <mx:Button id="btnIDOpen" click="openClickHandler(event)" label="New Window"/> < /mx:HBox < /mx:WindowedApplication DataGridComp.mxml < ?xml version="1.0" encoding="utf-8"? < mx:Canvas xmlns:mx="http://www.adobe.com/2006/mxml" width="100%" height="100%" <mx:Script> <![CDATA[ import mx.events.DataGridEvent; import mx.collections.ArrayCollection; [Bindable] public var cards:ArrayCollection = new ArrayCollection( [ {label:"Visa", data:1}, {label:"MasterCard", data:2}, {label:"American Express", data:3} ]); private function stretchFn(event:DataGridEvent):void{ trace("--- Stretched---") } ]]> </mx:Script> <mx:HBox> <mx:ComboBox dataProvider="{cards}" width="150"/> <mx:DataGrid columnStretch="stretchFn(event)" > <mx:ArrayCollection> <mx:Object> <mx:Artist>Pavement</mx:Artist> <mx:Price>11.99</mx:Price> <mx:Album>Slanted and Enchanted</mx:Album> </mx:Object> <mx:Object> <mx:Artist>Pavement</mx:Artist> <mx:Album>Brighten the Corners</mx:Album> <mx:Price>11.99</mx:Price> </mx:Object> </mx:ArrayCollection> </mx:DataGrid> </mx:HBox> < /mx:Canvas Can any one suggest me some work around to make my code workable... :)

    Read the article

  • Proxy calls across a DMZ

    - by John
    We need to determine a quick way for our web application deployed in a DMZ to communicate to our SQL server that lives in the protected network. Only port 80 is open and available, and no direct SQL traffic is allowed across the firewall. So take the following simple system. A web page (default.aspx) makes a call (string GetData()) that resides in an assembly (Simple.DLL). GetData() uses ADO.NET to open a connection, execute a SQL call, retrieve the data, and return the data to the caller. However, since only port 80 is available and no SQL traffic is allowed, what could we do to accomplish our goal? I believe a .NET remoting solution would work, and I have heard of an architecture where a remoting layer proxies the call from Simple.DLL in the DMZ to another Simple.DLL that runs on the protected side. The remoting layer handles the communication between the two DLL’s. Can someone shed some light on how WCF/remoting can help us and how to get started with a solution?

    Read the article

  • SSL confirmation dialog popup auto closes in IE8 when re-accessing a JNLP file

    - by haylem
    I'm having this very annoying problem to troubleshoot and have been going at it for way too many days now, so have a go at it. The Environment We have 2 app-servers, which can be located on either the same machine or 2 different machines, and use the same signing certificate, and host 2 different web-apps. Though let's say, for the sake of our study case here, that they are on the same physical machine. So, we have: https://company.com/webapp1/ https://company.com/webapp2/ webapp1 is GWT-based rich-client which contains on one of its screens a menu with an item that is used to invoke a Java WebStart Client located on webapp2. It does so by performing a simple window.open call via this GWT call: Window.open("https://company.com/webapp2/app.jnlp", "_blank", null); Expected Behavior User merrilly goes to webapp1 User navigates to menu entry to start the WebStart app and clicks on it browser fires off a separate window/dialog which, depending on the browser and its security settings, will: request confirmation to navigate to this secure site, directly download the file, and possibly auto-execute a javaws process if there's a file association, otherwise the user can simply click on the file and start the app (or go about doing whatever it takes here). If you close the app, close the dialog, and re-click the menu entry, the same thing should happen again. Actual Behavior On Anything but God-forsaken IE 8 (Though I admit there's also all the god-forsaken pre-IE8 stuff, but the Requirements Lords being merciful we have already recently managed to make them drop these suckers. That was close. Let's hold hands and say a prayer of gratitude.) Stuff just works. JNLP gets downloaded, app executes just fine, you can close the app and re-do all the steps and it will restart happily. People rejoice. Puppies are safe and play on green hills in the sunshine. Developers can go grab a coffee and move on to more meaningful and rewarding tasks, like checking out on SO questions. Chrome doesn't want to execute the JNLP, but who cares? Customers won't get RSI from clicking a file every other week. On God-forsaken IE8 On the first visit, the dialog opens and requests confirmation for the user to continue to webapp2, though it could be unsafe (here be dragons, I tell you). The JNLP downloads and auto-opens, the app start. Your breathing is steady and slow. You close the app, close that SSL confirmation dialog, and re-click the menu entry. The dialog opens and auto-closes. Nothing starts, the file wasn't downloaded to any known location and Fiddler just reports the connection was closed. If you close IE and reach that menu item to click it again, it is now back to working correctly. Until you try again during the same session, of course. Your heart-rate goes up, you get some more coffee to make matters worse, and start looking for plain tickets online and a cheap but heavy golf-club on an online auction site to go clubbing baby polar seals to avenge your bloodthirst, as the gates to the IE team in Redmond are probably more secured than an ice block, as one would assume they get death threats often. Plus, the IE9 and IE10 teams are already hard at work fxing the crap left by their predecessors, so maybe you don't want to be too hard on them, and you don't have money to waste on a PI to track down the former devs responsible for this mess. Added Details I have come across many problems with IE8 not downloading files over SSL when it uses a no-cache header. This was indeed one of our problems, which seems to be worked out now. It downloads files fine, webapp2 uses the following headers to serve the JNLP file: response.setHeader("Cache-Control", "private, must-revalidate"); // IE8 happy response.setHeader("Pragma", "private"); // IE8 happy response.setHeader("Expires", "0"); // IE8 happy response.setHeader("Access-Control-Allow-Origin", "*"); // allow to request via cross-origin AJAX response.setContentType("application/x-java-jnlp-file"); // please exec me As you might have inferred, we get some confirmation dialog because there's something odd with the SSL certificate. Unfortunately I have no control over that. Assuming that's only temporary and for development purposes as we usually don't get our hands on the production certs. So the SSL cert is expired and doesn't specify the server. And the confirmation dialog. Wouldn't be that bad if it weren't for IE, as other browsers don't care, just ask for confirmation, and execute as expected and consistantly. Please, pretty please, help me, or I might consider sacrificial killings as an option. And I think I just found a decently prized stainless steel golf-club, so I'm right on the edge of gore. Side Notes Might actually be related to IE8 window.open SSL Certificate issue. Though it doesn't explain why the dialog would auto-close (that really is beyong me...), it could help to not have the confirmation dialog and not need the dialog at all. For instance, I was thinking that just having a simple URL in that menu instead of have it entirely managed by GWT code to invoke a Window.open would solve the problem. But I don't have control on that menu, and also I'm very curious how this could be fixed otherwise and why the hell it happens in the first place...

    Read the article

  • How can I load a file into a DataBag from within a Yahoo PigLatin UDF?

    - by Cervo
    I have a Pig program where I am trying to compute the minimum center between two bags. In order for it to work, I found I need to COGROUP the bags into a single dataset. The entire operation takes a long time. I want to either open one of the bags from disk within the UDF, or to be able to pass another relation into the UDF without needing to COGROUP...... Code: # **** Load files for iteration **** register myudfs.jar; wordcounts = LOAD 'input/wordcounts.txt' USING PigStorage('\t') AS (PatentNumber:chararray, word:chararray, frequency:double); centerassignments = load 'input/centerassignments/part-*' USING PigStorage('\t') AS (PatentNumber: chararray, oldCenter: chararray, newCenter: chararray); kcenters = LOAD 'input/kcenters/part-*' USING PigStorage('\t') AS (CenterID:chararray, word:chararray, frequency:double); kcentersa1 = CROSS centerassignments, kcenters; kcentersa = FOREACH kcentersa1 GENERATE centerassignments::PatentNumber as PatentNumber, kcenters::CenterID as CenterID, kcenters::word as word, kcenters::frequency as frequency; #***** Assign to nearest k-mean ******* assignpre1 = COGROUP wordcounts by PatentNumber, kcentersa by PatentNumber; assignwork2 = FOREACH assignpre1 GENERATE group as PatentNumber, myudfs.kmeans(wordcounts, kcentersa) as CenterID; basically my issue is that for each patent I need to pass the sub relations (wordcounts, kcenters). In order to do this, I do a cross and then a COGROUP by PatentNumber in order to get the set PatentNumber, {wordcounts}, {kcenters}. If I could figure a way to pass a relation or open up the centers from within the UDF, then I could just GROUP wordcounts by PatentNumber and run myudfs.kmeans(wordcount) which is hopefully much faster without the CROSS/COGROUP. This is an expensive operation. Currently this takes about 20 minutes and appears to tack the CPU/RAM. I was thinking it might be more efficient without the CROSS. I'm not sure it will be faster, so I'd like to experiment. Anyway it looks like calling the Loading functions from within Pig needs a PigContext object which I don't get from an evalfunc. And to use the hadoop file system, I need some initial objects as well, which I don't see how to get. So my question is how can I open a file from the hadoop file system from within a PIG UDF? I also run the UDF via main for debugging. So I need to load from the normal filesystem when in debug mode. Another better idea would be if there was a way to pass a relation into a UDF without needing to CROSS/COGROUP. This would be ideal, particularly if the relation resides in memory.. ie being able to do myudfs.kmeans(wordcounts, kcenters) without needing the CROSS/COGROUP with kcenters... But the basic idea is to trade IO for RAM/CPU cycles. Anyway any help will be much appreciated, the PIG UDFs aren't super well documented beyond the most simple ones, even in the UDF manual.

    Read the article

  • Subversion (20014)Internal error: database is locked on NFS

    - by Niraj Gurjar
    i have subversion setup using apache and DAV. OS is RHEL 4. Repository is created on NFS server mounted on this machine. when i try to access this repository i get following error in apache logs (20014)Internal error: database is locked Could not fetch resource information. [500, #0] Could not open the requested SVN filesystem [500, #200030] Could not open the requested SVN filesystem [500, #200030] The URI does not contain the name of a repository. [403, #190001] i did 'chmod' on that mounted partition but problem still persists. any help?

    Read the article

  • Problem extracting text from RSS feeds

    - by Gautam
    Hi, I am new to the world of Ruby and Rails. I have seen rails cast 190 and I just started playing with it. I used selector gadget to find out the CSS and XPath I have the following code.. require 'rubygems' require 'nokogiri' require 'open-uri' url = "http://www.telegraph.co.uk/sport/football/rss" doc = Nokogiri::HTML(open(url)) doc.xpath('//a').each do |paragraph| puts paragraph.text end When I extracted text from a normal HTML page with css, I could get the extracted text on the console. But when I try to do the same either with CSS or XPath for the RSS Feed for the following URL mentioned in the code above, I dont get any output. How do you extract text from RSS feeds?? I also have another silly question. Is there a way to extract text from 2 different feeds and display it on the console something like url1 = "http://www.telegraph.co.uk/sport/football/rss" url2 = "http://www.telegraph.co.uk/sport/cricket/rss" Looking forward for your help and suggestions Thank You Gautam

    Read the article

  • Firefox proxy authentication with Kerberos: one service ticket per connection (Linux)

    - by Dari
    I am trying to enable proxy authentication via Kerberos for Firefox. The setup is: Active Directory domain (for LDAP and Kerberos; this works and I can log in the computer and get Kerberos tickets without problems) Microsoft Windows witness machine (on which Firefox runs fine with no ticket problem) CentOS 6.3 system with Firefox (the tests were performed with both the 10.0.1 ESR found in the CentOS package repositories and the 15.0.1 downloaded from Mozilla's website) BlueCoat proxy with Kerberos authentication enabled For the moment, Firefox requests an element of a website, gets an HTTP error code of "407 Proxy Authentication Required" from the proxy, gets a ticket granting service (TGS) from the domain for the proxy and performs the request again while passing the ticket. The transaction runs fine. However, when more elements are requested (in parallel), Firefox requests one more ticket per proxy connection. And this takes many DNS queries, Kerberos interactions with domain controllers and costs a lot of time (for example, the home page of Adobe takes several minutes to load and at the end, I have about 30 valid Kerberos tickets). I am stuck on this since a while, and help would be greatly appreciated. Minor information: the CentOS operating system is virtualized with VMware Player 3.1.3, but I do not think this would be a game changer.

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 355 356 357 358 359 360 361 362 363 364 365 366  | Next Page >