Search Results

Search found 29935 results on 1198 pages for 'open ldap'.

Page 361/1198 | < Previous Page | 357 358 359 360 361 362 363 364 365 366 367 368  | Next Page >

  • Virtual drivers with Windows Driver Model - where to begin?

    - by waitinforatrain
    I've never written drivers before but I'm starting an open-source project that involves creating virtual MIDI ports that will send the MIDI data over a network. For this, I presume I would be creating some sort of virtual driver using WDM (unless it's possible with kernel hooks?) - but being a beginner to driver development I don't know where to begin. Does anyone know any useful resources that would help me with this project? Or some open-source code from a similar project that I could fork as a starting point?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • how to show a html webpage in a GUI in Java

    - by Robert
    Dear all, I've recently worked on a project on search query,and I am only last step away from completion. Now I have a nice URL,and can open it in "cmd /c start" statement in Java,and it causes an IE window open. However,my advisor is not satisfied with that,he wants to see this webpage(actually,two webpages) opened in a GUI interface. So could you please give a detailed instruction on how to achieve this in Java,please?If you are trying to offer me a helpful package,would you please kindly also show how to use that as well,since I am new to this GUI development,and I only know the basics of Swing. Thanks a lot,it is dued within this week.

    Read the article

  • Ad/Banner Management/Rotation for Ruby on Rails?

    - by David N. Welton
    Hi, I have a niche site that I'd like to sell banners for directly, rather than going through adsense. I need a system to manage the whole process: displaying ads and an administrative interface to manage them. It doesn't have to be anything terribly fancy, although open source is greatly preferred so that I can grow the system as needs be. Since the site itself is in Rails, I would prefer something for that environment. Googling turns up bunches of them in PHP, but the results are a bit polluted and I didn't have any luck finding one that was done in/for Rails. If I don't find one, I suppose I'll see what I can do to hack together something and release it myself under an open license. Another possibility is this: http://www.google.com/admanager - anyone have anything to say about it? Is it right for someone just selling a few ads for a not-so-big site? Thanks, Dave

    Read the article

  • simple python file writing question

    - by aharon
    I'm learning Python, and have run into a bit of a problem. On my OSX install of Python 3.1, this happens in the console: >>> filename = "test" >>> reader = open(filename, 'r') >>> writer = open(filename, 'w') >>> reader.read() '' >>> writer.write("hello world\n") 12 >>> reader.read() '' And calling more test in BASH confirms that there is nothing in test. What's going on? Thanks.

    Read the article

  • Android: how to set click events on ListView?

    - by Capsud
    Hey there, I'm looking to be able to open up a new view or activity when I click on an item in my ListView. Currently I have a list of restaurants, and when i click on a particular restaurant I want it to open up another screen that will show its address, google map etc. What I need help with is knowing how to set click events on the items in the list. At the moment I dont have a database of the items, they're just Strings. Can someone help me with getting me to this stage? Thanks alot.

    Read the article

  • browser cookie issue

    - by George2
    Hello everyone, In my previous understanding, for a web site, only login user of a web site (no matter what login/authentication approach is used) could have cookie as persistent identifier, so that if the user close the browser, open browser again to go to the same web site, the web site could remember the user. But I learned recently that it seems for non-login user, there could still be a cookie associated with the user (after the user close browser, and then open the browser again to go to the same web site, the web site could remember the user), and it is called browser cookie? Is that true? If it is true, who is responsible to set the browser cookie? i.e. need some coding/config at web server side, client browser configuration (without coding from server side), or both? How could web server access such cookie? Appreciate if any code samples. thanks in advance, George

    Read the article

  • post data to a thickbox using ajax

    - by sqlchild
    I need to post data to a thickbox using ajax and open it immediately and display the posted data. The user would click on a link/button and the data i.e. value of the selected checkboxes would be posted to "my_thickbox.php" and the thickbox (url : my_thickbox.php) would open with checkbox values displayed. <div id="showthickbox" ><a href="my_thickbox.php" class="thickbox"></div> $('#showthickbox').click(function() { var data = $('input:checkbox:checked').map(function() { return this.value; }).get(); $.ajax({ type: 'POST', url: 'my_thickbox.php', data: data, success: success, dataType: dataType }); });

    Read the article

  • Posting an action works... but no image

    - by Brian Rice
    I'm able to post an open graph action to facebook using the following url: https://graph.facebook.com/me/video.watches with the following post data: video=http://eqnetwork.com/home/video.html?f=8e7b4f27-8cbd-4430-84df-d9ccb46da45f.mp4 It seems to be getting the title from the open graph metatags at the "video" object. But, it's not getting the image (even though one is specified in the metatag "og:image"). Also, if I add this to the post data: picture=http://eqnetwork.com/icons/mgen/overplayThumbnail.ms?drid=14282&subType=ljpg&w=120&h=120&o=1&thumbnail= still no image. Any thoughts? Brian

    Read the article

  • Avoiding nesting two for loops

    - by chavanak
    Hi, Please have a look at the code below: import string from collections import defaultdict first_complex=open( "residue_a_chain_a_b_backup.txt", "r" ) first_complex_lines=first_complex.readlines() first_complex_lines=map( string.strip, first_complex_lines ) first_complex.close() second_complex=open( "residue_a_chain_a_c_backup.txt", "r" ) second_complex_lines=second_complex.readlines() second_complex_lines=map( string.strip, second_complex_lines ) second_complex.close() list_1=[] list_2=[] for x in first_complex_lines: if x[0]!="d": list_1.append( x ) for y in second_complex_lines: if y[0]!="d": list_2.append( y ) j=0 list_3=[] list_4=[] for a in list_1: pass for b in list_2: pass if a==b: list_3.append( a ) kvmap=defaultdict( int ) for k in list_3: kvmap[k]+=1 print kvmap Normally I use izip or izip_longest to club two for loops, but this time the length of the files are different. I don't want a None entry. If I use the above method, the run time becomes incremental and useless. How am I supposed to get the two for loops going? Cheers, Chavanak

    Read the article

  • Python - Things I shouldn't be doing?

    - by cornjuliox
    I've got a few questions about best practices in Python. Not too long ago I would do something like this with my code: ... junk_block = "".join(open("foo.txt","rb").read().split()) ... I don't do this anymore because I can see that it makes code harder to read, but would the code run slower if I split the statements up like so: f_obj = open("foo.txt", "rb") f_data = f_obj.read() f_data_list = f_data.split() junk_block = "".join(f_data_list) I also noticed that there's nothing keeping you from doing an 'import' within a function block, is there any reason why I should do that?

    Read the article

  • Set a script to automatically detect character encoding in a plain-text-file in Python?

    - by Haidon
    I've set up a script that basically does a large-scale find-and-replace on a plain text document. At the moment it works fine with ASCII, UTF-8, and UTF-16 (and possibly others, but I've only tested these three) encoded documents so long as the encoding is specified inside the script (the example code below specifies UTF-16). Is there a way to make the script automatically detect which of these character encodings is being used in the input file and automatically set the character encoding of the output file the same as the encoding used on the input file? findreplace = [ ('term1', 'term2'), ] inF = open(infile,'rb') s=unicode(inF.read(),'utf-16') inF.close() for couple in findreplace: outtext=s.replace(couple[0],couple[1]) s=outtext outF = open(outFile,'wb') outF.write(outtext.encode('utf-16')) outF.close() Thanks!

    Read the article

  • New hire expectations... (Am I being unreasonable?)

    - by user295841
    I work for a very small custom software shop. We currently consist me and my boss. My boss is an old FoxPro DOS developer and OOP makes him uncomfortable. He is planning on taking a back seat in the next few years to hopefully enjoy a “partial retirement”. I will be taking over the day to day operations and we are now desperately looking for more help. We tried Monster.com, Dice.com, and others a few years ago when we started our search. We had no success. We have tried outsourcing overseas (total disaster), hiring kids right out of college (mostly a disaster but that’s where I came from), interns (good for them, not so good for us) and hiring laid off “experienced” developers (there was a reason they were laid off). I have heard hiring practices discussed on podcasts, blogs, etc... and have tried a few. The “Fizz Buzz” test was a good one. One kid looked physically ill before he finally gave up. I think my problem is that I have grown so much as a developer since I started here that I now have a high standard. I hear/read very intelligent people podcasts and blogs and I know that there are lots of people out there that can do the job. I don’t want to settle for less than a “good” developer. Perhaps my expectations are unreasonable. I expect any good developer (entry level or experienced) to be billable (at least paying their own wage) in under one month. I expect any good developer to be able to be productive (at least dangerous) in any language or technology with only a few days of research/training. I expect any good developer to be able to take a project from initial customer request to completion with little or no help from others. Am I being unreasonable? What constitutes a valuable developer? What should be expected of an entry level developer? What should be expected of an experienced developer? I realize that everyone is different but there has to be some sort of expectations standard, right? I have been giving the test project below to potential canidates to weed them out. Good idea? Too much? Too little? Please let me know what you think. Thanks. Project ID: T00001 Description: Order Entry System Deadline: 1 Week Scope The scope of this project is to develop a fully function order entry system. Screen/Form design must be user friendly and promote efficient data entry and modification. User experience (Navigation, Screen/Form layouts, Look and Feel…) is at the developer’s discretion. System may be developed using any technologies that conform to the technical and system requirements. Deliverables Complete source code Database setup instructions (Scripts or restorable backup) Application installation instructions (Installer or installation procedure) Any necessary documentation Technical Requirements Server Platform – Windows XP / Windows Server 2003 / SBS Client Platform – Windows XP Web Browser (If applicable) – IE 8 Database – At developer’s discretion (Must be a relational SQL database.) Language – At developer’s discretion All data must be normalized. (+) All data must maintain referential integrity. (++) All data must be indexed for optimal performance. System must handle concurrency. System Requirements Customer Maintenance Customer records must have unique ID. Customer data will include Name, Address, Phone, etc. User must be able to perform all CRUD (Create, Read, Update, and Delete) operations on the Customer table. User must be able to enter a specific Customer ID to edit. User must be able to pull up a sortable/queryable search grid/utility to find a customer to edit. Validation must be performed prior to database commit. Customer record cannot be deleted if the customer has an order in the system. (++) Inventory Maintenance Part records must have unique ID. Part data will include Description, Price, UOM (Unit of Measure), etc. User must be able to perform all CRUD operations on the part table. User must be able to enter a specific Part ID to edit. User must be able to pull up a sortable/queryable search grid/utility to find a part to edit. Validation must be performed prior to database commit. Part record cannot be deleted if the part has been used in an order. (++) Order Entry Order records must have a unique auto-incrementing key (Order Number). Order data must be split into a header/detail structure. (+) Order can contain an infinite number of detail records. Order header data will include Order Number, Customer ID (++), Order Date, Order Status (Open/Closed), etc. Order detail data will include Part Number (++), Quantity, Price, etc. User must be able to perform all CRUD operations on the order tables. User must be able to enter a specific Order Number to edit. User must be able to pull up a sortable/queryable search grid/utility to find an order to edit. User must be able to print an order form from within the order entry form. Validation must be performed prior to database commit. Reports Customer Listing – All Customers in the system. Inventory Listing – All parts in the system. Open Order Listing – All open orders in system. Customer Order Listing – All orders for specific customer. All reports must include sorts and filter functions where applicable. Ex. Customer Listing by range of Customer IDs. Open Order Listing by date range.

    Read the article

  • Yes, another thread question...

    - by Michael
    I can't understand why I am loosing control of my GUI even though I am implementing a thread to play a .wav file. Can someone pin point what is incorrect? #!/usr/bin/env python import wx, pyaudio, wave, easygui, thread, time, os, sys, traceback, threading import wx.lib.delayedresult as inbg isPaused = False isStopped = False class Frame(wx.Frame): def __init__(self): print 'Frame' wx.Frame.__init__(self, parent=None, id=-1, title="Jasmine", size=(720, 300)) #initialize panel panel = wx.Panel(self, -1) #initialize grid bag sizer = wx.GridBagSizer(hgap=20, vgap=20) #initialize buttons exitButton = wx.Button(panel, wx.ID_ANY, "Exit") pauseButton = wx.Button(panel, wx.ID_ANY, 'Pause') prevButton = wx.Button(panel, wx.ID_ANY, 'Prev') nextButton = wx.Button(panel, wx.ID_ANY, 'Next') stopButton = wx.Button(panel, wx.ID_ANY, 'Stop') #add widgets to sizer sizer.Add(pauseButton, pos=(1,10)) sizer.Add(prevButton, pos=(1,11)) sizer.Add(nextButton, pos=(1,12)) sizer.Add(stopButton, pos=(1,13)) sizer.Add(exitButton, pos=(5,13)) #initialize song time gauge #timeGauge = wx.Gauge(panel, 20) #sizer.Add(timeGauge, pos=(3,10), span=(0, 0)) #initialize menuFile widget menuFile = wx.Menu() menuFile.Append(0, "L&oad") menuFile.Append(1, "E&xit") menuBar = wx.MenuBar() menuBar.Append(menuFile, "&File") menuAbout = wx.Menu() menuAbout.Append(2, "A&bout...") menuAbout.AppendSeparator() menuBar.Append(menuAbout, "Help") self.SetMenuBar(menuBar) self.CreateStatusBar() self.SetStatusText("Welcome to Jasime!") #place sizer on panel panel.SetSizer(sizer) #initialize icon self.cd_image = wx.Image('cd_icon.png', wx.BITMAP_TYPE_PNG) self.temp = self.cd_image.ConvertToBitmap() self.size = self.temp.GetWidth(), self.temp.GetHeight() wx.StaticBitmap(parent=panel, bitmap=self.temp) #set binding self.Bind(wx.EVT_BUTTON, self.OnQuit, id=exitButton.GetId()) self.Bind(wx.EVT_BUTTON, self.pause, id=pauseButton.GetId()) self.Bind(wx.EVT_BUTTON, self.stop, id=stopButton.GetId()) self.Bind(wx.EVT_MENU, self.loadFile, id=0) self.Bind(wx.EVT_MENU, self.OnQuit, id=1) self.Bind(wx.EVT_MENU, self.OnAbout, id=2) #Load file usiing FileDialog, and create a thread for user control while running the file def loadFile(self, event): foo = wx.FileDialog(self, message="Open a .wav file...", defaultDir=os.getcwd(), defaultFile="", style=wx.FD_MULTIPLE) foo.ShowModal() self.queue = foo.GetPaths() self.threadID = 1 while len(self.queue) != 0: self.song = myThread(self.threadID, self.queue[0]) self.song.start() while self.song.isAlive(): time.sleep(2) self.queue.pop(0) self.threadID += 1 def OnQuit(self, event): self.Close() def OnAbout(self, event): wx.MessageBox("This is a great cup of tea.", "About Jasmine", wx.OK | wx.ICON_INFORMATION, self) def pause(self, event): global isPaused isPaused = not isPaused def stop(self, event): global isStopped isStopped = not isStopped class myThread (threading.Thread): def __init__(self, threadID, wf): self.threadID = threadID self.wf = wf threading.Thread.__init__(self) def run(self): global isPaused global isStopped self.waveFile = wave.open(self.wf, 'rb') #initialize stream self.p = pyaudio.PyAudio() self.stream = self.p.open(format = self.p.get_format_from_width(self.waveFile.getsampwidth()), channels = self.waveFile.getnchannels(), rate = self.waveFile.getframerate(), output = True) self.data = self.waveFile.readframes(1024) isPaused = False isStopped = False #main play loop, with pause event checking while self.data != '': # while isPaused != True: # if isStopped == False: self.stream.write(self.data) self.data = self.waveFile.readframes(1024) # elif isStopped == True: # self.stream.close() # self.p.terminate() self.stream.close() self.p.terminate() class App(wx.App): def OnInit(self): self.frame = Frame() self.frame.Show() self.SetTopWindow(self.frame) return True def main(): app = App() app.MainLoop() if __name__=='__main__': main()

    Read the article

  • properies profile when writing word file

    - by avani-nature
    Hai frnds i am new to php i am having following problems in my coding... 1.Actually i am opening word document with com object and storing it in textarea. 2.when content gets opened in textarea i am editing that content and saving the document 3.actually when i edited that file and done save after that if i open word document then file properties-custom the old content getting removed i wannt to retain that even if i edited the word document..please do the needful i am using below code <?php $filename = 'C:/xampp/htdocs/mts/sites/default/files/a.doc'; //echo $filename; if(isset($_REQUEST['Save'])){ $somecontent = stripslashes($_POST['somecontent']); // Let's make sure the file exists and is writable first. if (is_writable($filename)) { // In our example we're opening $filename in append mode. // The file pointer is at the bottom of the file hence // that's where $somecontent will go when we fwrite() it. if (!$handle = fopen($filename, 'w')) { echo "Cannot open file ($filename)"; exit; } // Write $somecontent to our opened fi<form action="" method="get"></form>le. if (fwrite($handle, $somecontent) === FALSE) { echo "Cannot write to file ($filename)"; exit; } echo "Success, wrote ($somecontent) to file ($filename) <a href=".$_SERVER['PHP_SELF']."> - Continue - "; fclose($handle); } else { echo "The file $filename is not writable"; } } else{ // get contents of a file into a string $handle = fopen($filename, "r"); $somecontent = fread($handle, filesize($filename)); $word = new COM("word.application") or die ("Could not initialise MS Word object."); $word->Documents->Open(realpath("$filename")); // Extract content. $somecontent = (string) $word->ActiveDocument->Content; //echo $somecontent; $word->ActiveDocument->Close(false); $word->Quit(); $word = null; unset($word); fclose($handle); } ?> <h6>Edit file --------><? $filenam=explode("/",$filename);$filename=$filename[7]; echo $filename ;?></h6> <form name="form1" method="post" action=""> <p> <textarea name="somecontent" cols="100" rows="20"><? echo $somecontent ;?></textarea> </p> <div style='padding-left:250px;'><input type="submit" name="Save" value="Save"></div> </p> </form> <? } ?>

    Read the article

  • Panel widget overlapping other contents in android

    - by walker
    I'm trying to utilize the Panel widget introduced in android-misc-widgets. It's been good so far. Now the problem is the sliding panel overlaps my top menu bar. For clarification look at the following screenshots. This is when I open panel using drag gesture (no problem here): This is when I open the panel with a single tap (look at the icons overlapping the top menu): There is one other problem, If there is any content inside the activity, opening the panel pushes that content out of the screen!

    Read the article

  • C++ iostream not setting eof bit even if gcount returns 0

    - by raph.amiard
    Hi I'm developping an application under windows, and i'm using fstreams to read and write to the file. I'm writing with fstream opened like this : fs.open(this->filename.c_str(), std::ios::in|std::ios::out|std::ios::binary); and writing with this command fs.write(reinterpret_cast<char*>(&e.element), sizeof(T)); closing the file after each write with fs.close() Reading with ifstream opened like this : is.open(filename, std::ios::in); and reading with this command : is.read(reinterpret_cast<char*>(&e.element), sizeof(T)); The write is going fine. However, i read in a loop this way : while(!is.eof()) { is.read(reinterpret_cast<char*>(&e.element), sizeof(T)); } and the program keeps reading, even though the end of file should be reached. istellg pos is 0, and gcount is equal to 0 too, but the fail bit and eof bit are both ok. I'm running crazy over this, need some help ...

    Read the article

  • Why compressed xps are corrupt?

    - by Gio
    compressed xps documents do not pass isxps.exe test and do not display in xpsviewer. i'm using Windows 7 and vs2010. Dim ms = New MemoryStream() Dim P As Package = Package.Open(ms, FileMode.Create, FileAccess.ReadWrite) Dim DocumentUri As Uri = New Uri("pack://document.xps") PackageStore.AddPackage(DocumentUri, P) Dim document As XpsDocument = New XpsDocument(P, CompressionOption.Maximum, DocumentUri.AbsoluteUri) If i change CompressionOption.Maximum to CompressionOption.None all works perfectly. IsXps.exe says "Unable to open Zip archive Error code: 0x8000FFFF", same with default W7 XpsViewer. what i'm doing wrong? (i've also installed latest 7zip program, but i do not think that it may corrupt the default windows zip capability......or not?)

    Read the article

  • How to retrieve email from GMail account using PHP?

    - by Tatu Ulmanen
    Hi, I'm trying to automatically retrieve some email from my GMail account for further parsing, but I can't get my head around on how to do that. I've searched the internets and it suggested that I use PHP's imap functions, like this: $server = '{imap.gmail.com:993/ssl}'; $connection = imap_open($server, '[email protected]', 'password'); But using that code, I get: Warning: imap_open() [function.imap-open]: Couldn't open stream {imap.gmail.com:993/ssl} Any idea what I am doing wrong? Any server setting that might be preventing me from making a connection to GMail (I'm using a shared service)? Is the address even right? Has anyone ever managed to do something like this? I've found tons of examples on how to send email via GMail, but very little of retrieving. Any help is much appreciated.

    Read the article

  • Ruby Thread with "watchdog"

    - by Sergio Campamá
    I'm implementing a ruby server for handling sockets being created from GPRS modules. The thing is that when the module powers down, there's no indication that the socket closed. I'm doing threads to handle multiple sockets with the same server. What I'm asking is this: Is there a way to use a timer inside a thread, reset it after every socket input, and that if it hits the timeout, closes the thread? Where can I find more information about this? EDIT: Code example that doesn't detect the socket closing require 'socket' server = TCPServer.open(41000) loop do Thread.start(server.accept) do |client| puts "Client connected" begin loop do line = client.readline open('log.txt', 'a') { |f| f.puts line.strip } end rescue puts "Client disconnected" end end end

    Read the article

  • Problem writing HTML content to Word document in ASP.NET

    - by saran
    I am trying to export the HTML page contents to Word. My Html display page is: What is your favourite color? NA List the top three school ? one National two Devs three PS And a button for click event. The button click event will open MS word and paste the page contents in word. The word page contains the table property of html design page. It occurs only in Word 2003. But in word 2007 the word document contains the text with out table property. How can I remove this table property in word 2003. I am not able to add the snapshots. Else i will make you clear. I am designing the web page by aspx. I am exporting the web page content by the following code. protected void Button1_Click(object sender, EventArgs e) { Response.ContentEncoding = System.Text.Encoding.UTF7; System.Text.StringBuilder SB = new System.Text.StringBuilder(); System.IO.StringWriter SW = new System.IO.StringWriter(); System.Web.UI.HtmlTextWriter htmlTW = new System.Web.UI.HtmlTextWriter(SW); tbl.RenderControl(htmlTW); string strBody = "<html>" + "<body>" + "<div><b>" + htmlTW.InnerWriter.ToString() + "</b></div>" + "</body>" + "</html>"; Response.AppendHeader("Content-Type", "application/msword"); Response.AppendHeader("Content-disposition", "attachment; filename=" + fileName); Response.ContentEncoding = System.Text.Encoding.UTF7; string fileName1 = "C://Temp/Excel" + DateTime.Now.Millisecond.ToString(); BinaryWriter writer = new BinaryWriter(File.Open(fileName1, FileMode.Create)); writer.Write(strBody); writer.Close(); FileStream fs = new FileStream(fileName1, FileMode.Open, FileAccess.Read); byte[] renderedBytes; // Create a byte array of file stream length renderedBytes = new byte[fs.Length]; //Read block of bytes from stream into the byte array fs.Read(renderedBytes, 0, System.Convert.ToInt32(fs.Length)); //Close the File Stream fs.Close(); FileInfo TheFile = new FileInfo(fileName1); if (TheFile.Exists) { File.Delete(fileName1); } Response.BinaryWrite(renderedBytes); Response.Flush(); Response.End(); }

    Read the article

  • what's the purpose of fcntl with parameter F_DUPFD

    - by Daniel
    I traced an oracle process, and find it first open a file /etc/netconfig as file handle 11, and then duplicate it as 256 by calling fcntl with parameter F_DUPFD, and then close the original file handle 11. Later it read using file handle 256. So what's the point to duplicate the file handle? Why not just work on the original file handle? 12931: 0.0006 open("/etc/netconfig", O_RDONLY|O_LARGEFILE) = 11 12931: 0.0002 fcntl(11, F_DUPFD, 0x00000100) = 256 12931: 0.0001 close(11) = 0 12931: 0.0002 read(256, " # p r a g m a i d e n".., 1024) = 1024 12931: 0.0003 read(256, " t s t p i _ c".., 1024) = 215 12931: 0.0002 read(256, 0x106957054, 1024) = 0 12931: 0.0001 lseek(256, 0, SEEK_SET) = 0 12931: 0.0002 read(256, " # p r a g m a i d e n".., 1024) = 1024 12931: 0.0003 read(256, " t s t p i _ c".., 1024) = 215 12931: 0.0003 read(256, 0x106957054, 1024) = 0 12931: 0.0001 close(256) = 0

    Read the article

  • STDOUT can not return to Screen

    - by rockyurock
    STDOUT can not return to Screen Hello all below is the part of my code, my code enters "if loop" with $value =1 and output of the process "iperf.exe" is getting into my_output.txt. As i am timing out the process after alram(20sec) time,also wanted to capture the output of this process only. then after i want to continue to the command prompt but i am not able to return to the command promt... not only this code itself does not PRINT on the command prompt , rather it is priniting on the my_output.txt file (i am looping this if loop through rest of my code) output.txt ========== inside value loop2 ------------------------------------------------------------ Server listening on UDP port 5001 Receiving 1470 byte datagrams UDP buffer size: 8.00 KByte (default) ------------------------------------------------------------ [160] local 10.232.62.151 port 5001 connected with 10.232.62.151 port 1505 [ ID] Interval Transfer Bandwidth Jitter Lost/Total Datagrams [160] 0.0- 5.0 sec 2.14 MBytes 3.59 Mbits/sec 0.000 ms 0/ 1528 (0%) inside value loop3 clue1 clue2 inside value loop4 one iperf completed Transfer Transfer Starting: Intent { act=android.settings.APN_SETTINGS } ******AUTOMATION COMPLETED****** Looks some problem with reinitializing the STDOUT.. even i tried to use close(STDOUT); but again it did not return to STDOUT could sombbody please help out ?? /rocky CODE:: if($value) { my $file = 'my_output.txt'; use Win32::Process; print"inside value loop\n"; # redirect stdout to a file open STDOUT, '>', $file or die "can't redirect STDOUT to <$file> $!"; Win32::Process::Create(my $ProcessObj, "iperf.exe", "iperf.exe -u -s -p 5001", 0, NORMAL_PRIORITY_CLASS, ".") || die ErrorReport(); $alarm_time = $IPERF_RUN_TIME+2; #20sec print"inside value loop2\n"; sleep $alarm_time; $ProcessObj->Kill(0); sub ErrorReport{ print Win32::FormatMessage( Win32::GetLastError() ); } print"inside value loop3\n"; print"clue1\n"; #close(STDOUT); print"clue2\n"; print"inside value loop4\n"; print"one iperf completed\n"; } my $data_file="my_output.txt"; open(ROCK, $data_file)|| die("Could not open file!"); @raw_data=<ROCK>; @COUNT_PS =split(/ /,$raw_data[7]); my $LOOP_COUNT_PS_4 = $COUNT_PS[9]; my $LOOP_COUNT_PS_5 = $COUNT_PS[10]; print "$LOOP_COUNT_PS_4\n"; print "$LOOP_COUNT_PS_5\n"; my $tput_value = "$LOOP_COUNT_PS_4"." $LOOP_COUNT_PS_5"; print "$tput_value"; close(ROCK); print FH1 "\n $count \| $tput_value \n"; regds rakesh

    Read the article

  • What is preferred accessible and semantically correct method to code this type of data design?

    - by jitendra
    What is preferred accessible and semantically correct method to code this type of data design? Table UL, LI DIV,SPAN For icons should i use for each place or i should is icon from CSS sprites? If we use css sprite here then how to code, and what will happen when images will be disabled ? Every link will open in new window and I have to indicate about file size also for both sighted and blind users? So what is the best method to make this design and what is best method to show icon and to indicate all type of users that file will open in new window and what is file size? Content of table should be accessible and understandable in as good as possible manner in all conditions For sighted user even if images are disabled for screen user for text browser user and if css is disabled And What is the role of Filenames of PDF, video, audio here?

    Read the article

< Previous Page | 357 358 359 360 361 362 363 364 365 366 367 368  | Next Page >