Search Results

Search found 35327 results on 1414 pages for 'string concatenation'.

Page 371/1414 | < Previous Page | 367 368 369 370 371 372 373 374 375 376 377 378  | Next Page >

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Auto not being recognised by the compiler, what would be the best replacement?

    - by user1719605
    So I have wrote a program that uses auto however the compiler doesn't seem to recognize it, probably it is an earlier compiler. I was wondering for my code, with are suitable variables to fix my code so that I do not need to use the auto keyword? I'm thinking a pointer to a string? or a string iterator, though I am not sure. #include <cstdlib> #include <string> #include <iostream> #include <unistd.h> #include <algorithm> using namespace std; int main(int argc, char* argv[]) { enum MODE { WHOLE, PREFIX, SUFFIX, ANYWHERE, EMBEDDED } mode = WHOLE; bool reverse_match = false; int c; while ((c = getopt(argc, argv, ":wpsaev")) != -1) { switch (c) { case 'w': // pattern matches whole word mode = WHOLE; break; case 'p': // pattern matches prefix mode = PREFIX; break; case 'a': // pattern matches anywhere mode = ANYWHERE; break; case 's': // pattern matches suffix mode = SUFFIX; break; case 'e': // pattern matches anywhere mode = EMBEDDED; break; case 'v': // reverse sense of match reverse_match = true; break; } } argc -= optind; argv += optind; string pattern = argv[0]; string word; int matches = 0; while (cin >> word) { switch (mode) { case WHOLE: if (reverse_match) { if (pattern != word) { matches += 1; cout << word << endl; } } else if (pattern == word) { matches += 1; cout << word << endl; } break; case PREFIX: if (pattern.size() <= word.size()) { auto res = mismatch(pattern.begin(), pattern.end(), word.begin()); if (reverse_match) { if (res.first != word.end()) { matches += 1; cout << word << endl; } } else if (res.first == word.end()) { matches += 1; cout << word << endl; } } break; case ANYWHERE: if (reverse_match) { if (!word.find(pattern) != string::npos) { matches += 1; cout << word << endl; } } else if (word.find(pattern) != string::npos) { matches += 1; cout << word << endl; } break; case SUFFIX: if (pattern.size() <= word.size()) { auto res = mismatch(pattern.rbegin(), pattern.rend(), word.rbegin()); if (reverse_match) { if (res.first != word.rend()) { matches = +1; cout << word << endl; } } else if (res.first == word.rend()) { matches = +1; cout << word << endl; } } break; case EMBEDDED: if (reverse_match) { if (!pattern.find(word) != string::npos) { matches += 1; cout << word << endl;} } else if (pattern.find(word) != string::npos) { matches += 1; cout << word << endl; } break; } } return (matches == 0) ? 1 : 0; } Thanks in advance!

    Read the article

  • Retrieving Json Array

    - by Rahul Varma
    Hi, I am trying to retrieve the values from the following url: http://rentopoly.com/ajax.php?query=Bo. I want to get the values of all the suggestions to be displayed in a list view one by one. This is how i want to do... public class AlertsAdd { public ArrayList<JSONObject> retrieveJSONArray(String urlString) { String result = queryRESTurl(urlString); ArrayList<JSONObject> ALERTS = new ArrayList<JSONObject>(); if (result != null) { try { JSONObject json = new JSONObject(result); JSONArray alertsArray = json.getJSONArray("suggestions"); for (int a = 0; a < alertsArray.length(); a++) { JSONObject alertitem = alertsArray.getJSONObject(a); ALERTS.add(alertitem); } return ALERTS; } catch (JSONException e) { Log.e("JSON", "There was an error parsing the JSON", e); } } JSONObject myObject = new JSONObject(); try { myObject.put("suggestions",myObject.getJSONArray("suggestions")); ALERTS.add(myObject); } catch (JSONException e1) { Log.e("JSON", "There was an error creating the JSONObject", e1); } return ALERTS; } private String queryRESTurl(String url) { // URLConnection connection; HttpClient httpclient = new DefaultHttpClient(); HttpGet httpget = new HttpGet(url); HttpResponse response; try { response = httpclient.execute(httpget); HttpEntity entity = response.getEntity(); if (entity != null) { InputStream instream = entity.getContent(); String result = convertStreamToString(instream); instream.close(); return result; } } catch (ClientProtocolException e) { Log.e("REST", "There was a protocol based error", e); } catch (IOException e) { Log.e("REST", "There was an IO Stream related error", e); } return null; } /** * To convert the InputStream to String we use the * BufferedReader.readLine() method. We iterate until the BufferedReader * return null which means there's no more data to read. Each line will * appended to a StringBuilder and returned as String. */ private String convertStreamToString(InputStream is) { BufferedReader reader = new BufferedReader(new InputStreamReader(is)); StringBuilder sb = new StringBuilder(); String line = null; try { while ((line = reader.readLine()) != null) { sb.append(line + "\n"); } } catch (IOException e) { e.printStackTrace(); } finally { try { is.close(); } catch (IOException e) { e.printStackTrace(); } } return sb.toString(); } } Here's the adapter code... public class AlertsAdapter extends ArrayAdapter<JSONObject> { public AlertsAdapter(Activity activity, List<JSONObject> alerts) { super(activity, 0, alerts); } @Override public View getView(int position, View convertView, ViewGroup parent) { Activity activity = (Activity) getContext(); LayoutInflater inflater = activity.getLayoutInflater(); View rowView = inflater.inflate(R.layout.list_text, null); JSONObject imageAndText = getItem(position); TextView textView = (TextView) rowView.findViewById(R.id.last_build_stat); try { textView.setText((String)imageAndText.get("suggestions")); } catch (JSONException e) { textView.setText("JSON Exception"); } return rowView; } } Here's the logcat... 04-30 13:09:46.656: INFO/ActivityManager(584): Starting activity: Intent { act=android.intent.action.MAIN cat=[android.intent.category.LAUNCHER] flg=0x10000000 cmp=com.WorldToyota/.Alerts } 04-30 13:09:50.417: ERROR/JSON(924): There was an error parsing the JSON 04-30 13:09:50.417: ERROR/JSON(924): org.json.JSONException: JSONArray[0] is not a JSONObject. 04-30 13:09:50.417: ERROR/JSON(924): at org.json.JSONArray.getJSONObject(JSONArray.java:268) 04-30 13:09:50.417: ERROR/JSON(924): at com.WorldToyota.AlertsAdd.retrieveJSONArray(AlertsAdd.java:30) 04-30 13:09:50.417: ERROR/JSON(924): at com.WorldToyota.Alerts.onCreate(Alerts.java:20) 04-30 13:09:50.417: ERROR/JSON(924): at android.app.Instrumentation.callActivityOnCreate(Instrumentation.java:1123) 04-30 13:09:50.417: ERROR/JSON(924): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:2364) 04-30 13:09:50.417: ERROR/JSON(924): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:2417) 04-30 13:09:50.417: ERROR/JSON(924): at android.app.ActivityThread.access$2100(ActivityThread.java:116) 04-30 13:09:50.417: ERROR/JSON(924): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:1794) 04-30 13:09:50.417: ERROR/JSON(924): at android.os.Handler.dispatchMessage(Handler.java:99) 04-30 13:09:50.417: ERROR/JSON(924): at android.os.Looper.loop(Looper.java:123) 04-30 13:09:50.417: ERROR/JSON(924): at android.app.ActivityThread.main(ActivityThread.java:4203) 04-30 13:09:50.417: ERROR/JSON(924): at java.lang.reflect.Method.invokeNative(Native Method) 04-30 13:09:50.417: ERROR/JSON(924): at java.lang.reflect.Method.invoke(Method.java:521) 04-30 13:09:50.417: ERROR/JSON(924): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:791) 04-30 13:09:50.417: ERROR/JSON(924): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:549) 04-30 13:09:50.417: ERROR/JSON(924): at dalvik.system.NativeStart.main(Native Method) 04-30 13:09:50.688: ERROR/JSON(924): There was an error creating the JSONObject 04-30 13:09:50.688: ERROR/JSON(924): org.json.JSONException: JSONObject["suggestions"] not found. 04-30 13:09:50.688: ERROR/JSON(924): at org.json.JSONObject.get(JSONObject.java:287) 04-30 13:09:50.688: ERROR/JSON(924): at org.json.JSONObject.getJSONArray(JSONObject.java:362) 04-30 13:09:50.688: ERROR/JSON(924): at com.WorldToyota.AlertsAdd.retrieveJSONArray(AlertsAdd.java:41) 04-30 13:09:50.688: ERROR/JSON(924): at com.WorldToyota.Alerts.onCreate(Alerts.java:20) 04-30 13:09:50.688: ERROR/JSON(924): at android.app.Instrumentation.callActivityOnCreate(Instrumentation.java:1123) 04-30 13:09:50.688: ERROR/JSON(924): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:2364) 04-30 13:09:50.688: ERROR/JSON(924): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:2417) 04-30 13:09:50.688: ERROR/JSON(924): at android.app.ActivityThread.access$2100(ActivityThread.java:116) 04-30 13:09:50.688: ERROR/JSON(924): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:1794) 04-30 13:09:50.688: ERROR/JSON(924): at android.os.Handler.dispatchMessage(Handler.java:99) 04-30 13:09:50.688: ERROR/JSON(924): at android.os.Looper.loop(Looper.java:123) 04-30 13:09:50.688: ERROR/JSON(924): at android.app.ActivityThread.main(ActivityThread.java:4203) 04-30 13:09:50.688: ERROR/JSON(924): at java.lang.reflect.Method.invokeNative(Native Method) 04-30 13:09:50.688: ERROR/JSON(924): at java.lang.reflect.Method.invoke(Method.java:521) 04-30 13:09:50.688: ERROR/JSON(924): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:791) 04-30 13:09:50.688: ERROR/JSON(924): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:549) 04-30 13:09:50.688: ERROR/JSON(924): at dalvik.system.NativeStart.main(Native Method) Plz help me parsing this script and displaying the values in list format....

    Read the article

  • ASP.NET. MVC2. Entity Framework. Cannot pass primary key value back from view to [HttpPost]

    - by Paul Connolly
    I pass a ViewModel (which contains a "Person" object) from the "EditPerson" controller action into the view. When posted back from the view, the ActionResult receives all of the Person properties except the ID (which it says is zero instead of say its real integer) Can anyone tell me why? The controllers look like this: public ActionResult EditPerson(int personID) { var personToEdit = repository.GetPerson(personID); FormationViewModel vm = new FormationViewModel(); vm.Person = personToEdit; return View(vm); } [HttpPost] public ActionResult EditPerson(FormationViewModel model) <<Passes in all properties except ID { // Persistence code } The View looks like this: <%@ Page Title="" Language="C#" MasterPageFile="~/Views/Shared/Site.Master" Inherits="System.Web.Mvc.ViewPage<Afp.Models.Formation.FormationViewModel>" %> <% using (Html.BeginForm()) {% <%= Html.ValidationSummary(true) % <fieldset> <legend>Fields</legend> <div class="editor-label"> <%= Html.LabelFor(model => model.Person.Title) %> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Person.Title) %> <%= Html.ValidationMessageFor(model => model.Person.Title) %> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.Person.Forename)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Person.Forename)%> <%= Html.ValidationMessageFor(model => model.Person.Forename)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.Person.Surname)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Person.Surname)%> <%= Html.ValidationMessageFor(model => model.Person.Surname)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.DOB) %> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.DOB, String.Format("{0:g}", Model.DOB)) <%= Html.ValidationMessageFor(model => model.DOB) %> </div>--%> <div class="editor-label"> <%= Html.LabelFor(model => model.Person.Nationality)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Person.Nationality)%> <%= Html.ValidationMessageFor(model => model.Person.Nationality)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.Person.Occupation)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Person.Occupation)%> <%= Html.ValidationMessageFor(model => model.Person.Occupation)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.Person.CountryOfResidence)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Person.CountryOfResidence)%> <%= Html.ValidationMessageFor(model => model.Person.CountryOfResidence)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.Person.PreviousNameForename)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Person.PreviousNameForename)%> <%= Html.ValidationMessageFor(model => model.Person.PreviousNameForename)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.Person.PreviousSurname)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Person.PreviousSurname)%> <%= Html.ValidationMessageFor(model => model.Person.PreviousSurname)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.Person.Email)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Person.Email)%> <%= Html.ValidationMessageFor(model => model.Person.Email)%> </div> <p> <input type="submit" value="Save" /> </p> </fieldset> <% } % And the Person class looks like: [MetadataType(typeof(Person_Validation))] public partial class Person { public Person() { } } [Bind(Exclude = "ID")] public class Person_Validation { public int ID { get; private set; } public string Title { get; set; } public string Forename { get; set; } public string Surname { get; set; } public System.DateTime DOB { get; set; } public string Nationality { get; set; } public string Occupation { get; set; } public string CountryOfResidence { get; set; } public string PreviousNameForename { get; set; } public string PreviousSurname { get; set; } public string Email { get; set; } } And ViewModel: public class FormationViewModel { public Company Company { get; set; } public Address RegisteredAddress { get; set; } public Person Person { get; set; } public PersonType PersonType { get; set; } public int CurrentStep { get; set; } } }

    Read the article

  • creating objects from trivial graph format text file. java. dijkstra algorithm.

    - by user560084
    i want to create objects, vertex and edge, from trivial graph format txt file. one of programmers here suggested that i use trivial graph format to store data for dijkstra algorithm. the problem is that at the moment all the information, e.g., weight, links, is in the sourcecode. i want to have a separate text file for that and read it into the program. i thought about using a code for scanning through the text file by using scanner. but i am not quite sure how to create different objects from the same file. could i have some help please? the file is v0 Harrisburg v1 Baltimore v2 Washington v3 Philadelphia v4 Binghamton v5 Allentown v6 New York # v0 v1 79.83 v0 v5 81.15 v1 v0 79.75 v1 v2 39.42 v1 v3 103.00 v2 v1 38.65 v3 v1 102.53 v3 v5 61.44 v3 v6 96.79 v4 v5 133.04 v5 v0 81.77 v5 v3 62.05 v5 v4 134.47 v5 v6 91.63 v6 v3 97.24 v6 v5 87.94 and the dijkstra algorithm code is Downloaded from: http://en.literateprograms.org/Special:Downloadcode/Dijkstra%27s_algorithm_%28Java%29 */ import java.util.PriorityQueue; import java.util.List; import java.util.ArrayList; import java.util.Collections; class Vertex implements Comparable<Vertex> { public final String name; public Edge[] adjacencies; public double minDistance = Double.POSITIVE_INFINITY; public Vertex previous; public Vertex(String argName) { name = argName; } public String toString() { return name; } public int compareTo(Vertex other) { return Double.compare(minDistance, other.minDistance); } } class Edge { public final Vertex target; public final double weight; public Edge(Vertex argTarget, double argWeight) { target = argTarget; weight = argWeight; } } public class Dijkstra { public static void computePaths(Vertex source) { source.minDistance = 0.; PriorityQueue<Vertex> vertexQueue = new PriorityQueue<Vertex>(); vertexQueue.add(source); while (!vertexQueue.isEmpty()) { Vertex u = vertexQueue.poll(); // Visit each edge exiting u for (Edge e : u.adjacencies) { Vertex v = e.target; double weight = e.weight; double distanceThroughU = u.minDistance + weight; if (distanceThroughU < v.minDistance) { vertexQueue.remove(v); v.minDistance = distanceThroughU ; v.previous = u; vertexQueue.add(v); } } } } public static List<Vertex> getShortestPathTo(Vertex target) { List<Vertex> path = new ArrayList<Vertex>(); for (Vertex vertex = target; vertex != null; vertex = vertex.previous) path.add(vertex); Collections.reverse(path); return path; } public static void main(String[] args) { Vertex v0 = new Vertex("Nottinghill_Gate"); Vertex v1 = new Vertex("High_Street_kensignton"); Vertex v2 = new Vertex("Glouchester_Road"); Vertex v3 = new Vertex("South_Kensignton"); Vertex v4 = new Vertex("Sloane_Square"); Vertex v5 = new Vertex("Victoria"); Vertex v6 = new Vertex("Westminster"); v0.adjacencies = new Edge[]{new Edge(v1, 79.83), new Edge(v6, 97.24)}; v1.adjacencies = new Edge[]{new Edge(v2, 39.42), new Edge(v0, 79.83)}; v2.adjacencies = new Edge[]{new Edge(v3, 38.65), new Edge(v1, 39.42)}; v3.adjacencies = new Edge[]{new Edge(v4, 102.53), new Edge(v2, 38.65)}; v4.adjacencies = new Edge[]{new Edge(v5, 133.04), new Edge(v3, 102.53)}; v5.adjacencies = new Edge[]{new Edge(v6, 81.77), new Edge(v4, 133.04)}; v6.adjacencies = new Edge[]{new Edge(v0, 97.24), new Edge(v5, 81.77)}; Vertex[] vertices = { v0, v1, v2, v3, v4, v5, v6 }; computePaths(v0); for (Vertex v : vertices) { System.out.println("Distance to " + v + ": " + v.minDistance); List<Vertex> path = getShortestPathTo(v); System.out.println("Path: " + path); } } } and the code for scanning file is import java.util.Scanner; import java.io.File; import java.io.FileNotFoundException; public class DataScanner1 { //private int total = 0; //private int distance = 0; private String vector; private String stations; private double [] Edge = new double []; /*public int getTotal(){ return total; } */ /* public void getMenuInput(){ KeyboardInput in = new KeyboardInput; System.out.println("Enter the destination? "); String val = in.readString(); return val; } */ public void readFile(String fileName) { try { Scanner scanner = new Scanner(new File(fileName)); scanner.useDelimiter (System.getProperty("line.separator")); while (scanner.hasNext()) { parseLine(scanner.next()); } scanner.close(); } catch (FileNotFoundException e) { e.printStackTrace(); } } public void parseLine(String line) { Scanner lineScanner = new Scanner(line); lineScanner.useDelimiter("\\s*,\\s*"); vector = lineScanner.next(); stations = lineScanner.next(); System.out.println("The current station is " + vector + " and the destination to the next station is " + stations + "."); //total += distance; //System.out.println("The total distance is " + total); } public static void main(String[] args) { /* if (args.length != 1) { System.err.println("usage: java TextScanner2" + "file location"); System.exit(0); } */ DataScanner1 scanner = new DataScanner1(); scanner.readFile(args[0]); //int total =+ distance; //System.out.println(""); //System.out.println("The total distance is " + scanner.getTotal()); } }

    Read the article

  • Font serialization in vb.net

    - by jovany
    Hello all, as the title says , I need to serialize my font. I have tried the following approach unfortunately to no avail. This is what I have and what happens; I have a drawing application and certain variables and properties need to be serialized. (So , Xml.Serialization has been used.) Now this has already been done in a huge portion and I've created some other attributes which needed to be serialized and it works. There is one base class and classes such as drawablestar, drawableeclipse ,etc. all inherit from this class. As does my drawabletextboxclass. The base class is Serializable as can be seen in the sample below. It looks like this... Imports System.Xml.Serialization <Serializable()> _ Public MustInherit Class Drawable ' Drawing characteristics. 'Font characteristics <XmlIgnore()> Public FontFamily As String <XmlIgnore()> Public FontSize As Integer <XmlIgnore()> Public FontType As Integer <XmlIgnore()> Public ForeColor As Color <XmlIgnore()> Public FillColor As Color <XmlAttributeAttribute()> Public LineWidth As Integer = 0 <XmlAttributeAttribute()> Public X1 As Integer <XmlAttributeAttribute()> Public Y1 As Integer <XmlAttributeAttribute()> Public X2 As Integer <XmlAttributeAttribute()> Public Y2 As Integer ' attributes for size textbox <XmlAttributeAttribute()> Public widthLabel As Integer <XmlAttributeAttribute()> Public heightLabel As Integer '<XmlTextAttribute()> Public FontFamily As String '<XmlAttributeAttribute()> Public FontSize As Integer 'this should actually not be here.. <XmlAttributeAttribute()> Public s_InsertLabel As String ' Indicates whether we should draw as selected. <XmlIgnore()> Public IsSelected As Boolean = False ' Constructors. Public Sub New() ForeColor = Color.Black FillColor = Color.White 'FontFamily = "Impact" 'FontSize = 12 End Sub Friend WriteOnly Property _Label() As String Set(ByVal Value As String) s_InsertLabel = Value End Set End Property Public Sub New(ByVal fore_color As Color, ByVal fill_color As Color, Optional ByVal line_width As Integer = 0) LineWidth = line_width ForeColor = fore_color FillColor = fill_color ' FontFamily = Font_Family ' FontSize = Font_Size End Sub ' Property procedures to serialize and ' deserialize ForeColor and FillColor. <XmlAttributeAttribute("ForeColor")> _ Public Property ForeColorArgb() As Integer Get Return ForeColor.ToArgb() End Get Set(ByVal Value As Integer) ForeColor = Color.FromArgb(Value) End Set End Property <XmlAttributeAttribute("BackColor")> _ Public Property FillColorArgb() As Integer Get Return FillColor.ToArgb() End Get Set(ByVal Value As Integer) FillColor = Color.FromArgb(Value) End Set End Property 'Property procedures to serialize and 'deserialize Font <XmlAttributeAttribute("InsertLabel")> _ Public Property InsertLabel_() As String Get Return s_InsertLabel End Get Set(ByVal value As String) s_InsertLabel = value End Set End Property <XmlAttributeAttribute("FontSize")> _ Public Property FontSizeGet() As Integer Get Return FontSize End Get Set(ByVal value As Integer) FontSize = value End Set End Property <XmlAttributeAttribute("FontFamily")> _ Public Property FontFamilyGet() As String Get Return FontFamily End Get Set(ByVal value As String) FontFamily = value End Set End Property <XmlAttributeAttribute("FontType")> _ Public Property FontType_() As Integer Get Return FontType End Get Set(ByVal value As Integer) FontType = value End Set End Property #Region "Methods to override" Public MustOverride Sub Draw(ByVal gr As Graphics) ' Return the object's bounding rectangle. Public MustOverride Function GetBounds() As Rectangle ...... ........ ..... End Class [/code] My textbox class which looks like this , is the one that needs to save it's font. Imports System.Math Imports System.Xml.Serialization Imports System.Windows.Forms <Serializable()> _ Public Class DrawableTextBox Inherits Drawable Private i_StringLength As Integer Private i_StringWidth As Integer Private drawFont As Font = New Font(FontFamily, 12, FontStyle.Regular) Private brsTextColor As Brush = Brushes.Black Private s_insertLabelTextbox As String = "label" ' Constructors. Public Sub New() End Sub Public Sub New(ByVal objCanvas As PictureBox, ByVal fore_color As Color, ByVal fill_color As Color, Optional ByVal line_width As Integer = 0, Optional ByVal new_x1 As Integer = 0, Optional ByVal new_y1 As Integer = 0, Optional ByVal new_x2 As Integer = 1, Optional ByVal new_y2 As Integer = 1) MyBase.New(fore_color, fill_color, line_width) Dim objGraphics As Graphics = objCanvas.CreateGraphics() X1 = new_x1 Y1 = new_y1 'Only rectangles ,circles and stars can resize for now b_Movement b_Movement = True Dim frm As New frmTextbox frm.MyFont = drawFont frm.ShowDialog() If frm.DialogResult = DialogResult.OK Then FontFamily = frm.MyFont.FontFamily.Name FontSize = frm.MyFont.Size FontType = frm.MyFont.Style 'drawFont = frm.MyFont drawFont = New Font(FontFamily, FontSize) drawFont = FontAttributes() brsTextColor = New SolidBrush(frm.txtLabel.ForeColor) s_InsertLabel = frm.txtLabel.Text i_StringLength = s_InsertLabel.Length 'gefixtf Dim objSizeF As SizeF = objGraphics.MeasureString(s_InsertLabel, drawFont, New PointF(X2 - X1, Y2 - Y1), New StringFormat(StringFormatFlags.NoClip)) Dim objPoint As Point = objCanvas.PointToClient(New Point(X1 + objSizeF.Width, Y1 + objSizeF.Height)) widthLabel = objSizeF.Width heightLabel = objSizeF.Height X2 = X1 + widthLabel Y2 = Y1 + heightLabel Else Throw New ApplicationException() End If End Sub ' Draw the object on this Graphics surface. Public Overrides Sub Draw(ByVal gr As System.Drawing.Graphics) ' Make a Rectangle representing this rectangle. Dim rectString As Rectangle rectString = New Rectangle(X1, Y1, widthLabel, heightLabel) rectString = GetBounds() ' See if we're selected. If IsSelected Then gr.DrawString(s_InsertLabel, drawFont, brsTextColor, X1, Y1) 'gr.DrawRectangle(Pens.Black, rect) ' Pens.Transparent gr.DrawRectangle(Pens.Black, rectString) ' Draw grab handles. DrawGrabHandle(gr, X1, Y1) DrawGrabHandle(gr, X1, Y2) DrawGrabHandle(gr, X2, Y2) DrawGrabHandle(gr, X2, Y1) Else gr.DrawString(s_InsertLabel, drawFont, brsTextColor, X1, Y1) 'gr.DrawRectangle(Pens.Black, rect) ' Pens.Transparent gr.DrawRectangle(Pens.Black, rectString) End If End Sub 'get fontattributes Public Function FontAttributes() As Font Return New Font(FontFamily, 12, FontStyle.Regular) End Function ' Return the object's bounding rectangle. Public Overrides Function GetBounds() As System.Drawing.Rectangle Return New Rectangle( _ Min(X1, X1), _ Min(Y1, Y1), _ Abs(widthLabel), _ Abs(heightLabel)) End Function ' Return True if this point is on the object. Public Overrides Function IsAt(ByVal x As Integer, ByVal y As Integer) As Boolean Return (x >= Min(X1, X2)) AndAlso _ (x <= Max(X1, X2)) AndAlso _ (y >= Min(Y1, Y2)) AndAlso _ (y <= Max(Y1, Y2)) End Function ' Move the second point. Public Overrides Sub NewPoint(ByVal x As Integer, ByVal y As Integer) X2 = x Y2 = y End Sub ' Return True if the object is empty (e.g. a zero-length line). Public Overrides Function IsEmpty() As Boolean Return (X1 = X2) AndAlso (Y1 = Y2) End Function End Class The coordinates ( X1 ,X2,Y1, Y2 ) are needed to draw a circle , rectangle etc. ( in the other classes ).This all works. If I load my saved file it shows me the correct location and correct size of drawn objects. If I open my xml file I can see all values are correctly saved ( including my FontFamily ). Also the color which can be adjusted is saved and then properly displayed when I load a previously saved drawing. Of course because the coordinates work, if I insert a textField ,the location where it is being displayed is correct. However here comes the problem , my fontSize and fontfamily don't work. As you can see I created them in the base class, However this does not work. Is my approach completely off? What can I do ? Before saving img14.imageshack.us/i/beforeos.jpg/ After loading the Font jumps back to Sans serif and size 12. I could really use some help here.. Edit: I've been using the sample from this website http://www.vb-helper.com/howto_net_drawing_framework.html

    Read the article

  • In Flex, how to drag a component into a column of DataGrid (not the whole DataGrid)?

    - by Yousui
    Hi guys, I have a custom component: <?xml version="1.0" encoding="utf-8"?> <s:Group xmlns:fx="http://ns.adobe.com/mxml/2009" xmlns:s="library://ns.adobe.com/flex/spark" xmlns:mx="library://ns.adobe.com/flex/mx"> <fx:Declarations> </fx:Declarations> <fx:Script> <![CDATA[ [Bindable] public var label:String = "don't know"; [Bindable] public var imageName:String = "x.gif"; ]]> </fx:Script> <s:HGroup paddingLeft="8" paddingTop="8" paddingRight="8" paddingBottom="8"> <mx:Image id="img" source="assets/{imageName}" /> <s:Label text="{label}"/> </s:HGroup> </s:Group> and a custom render, which will be used in my DataGrid: <?xml version="1.0" encoding="utf-8"?> <s:MXDataGridItemRenderer xmlns:fx="http://ns.adobe.com/mxml/2009" xmlns:s="library://ns.adobe.com/flex/spark" xmlns:mx="library://ns.adobe.com/flex/mx" focusEnabled="true" xmlns:components="components.*"> <s:VGroup> <components:Person label="{dataGridListData.label}"> </components:Person> </s:VGroup> </s:MXDataGridItemRenderer> This is my application: <?xml version="1.0" encoding="utf-8"?> <s:Application xmlns:fx="http://ns.adobe.com/mxml/2009" xmlns:s="library://ns.adobe.com/flex/spark" xmlns:mx="library://ns.adobe.com/flex/mx" minWidth="955" minHeight="600" xmlns:services="services.*"> <s:layout> <s:VerticalLayout/> </s:layout> <fx:Script> <![CDATA[ import mx.collections.ArrayCollection; import mx.controls.Alert; import mx.controls.Image; import mx.rpc.events.ResultEvent; import mx.utils.ArrayUtil; ]]> </fx:Script> <fx:Declarations> <fx:XMLList id="employees"> <employee> <name>Christina Coenraets</name> <phone>555-219-2270</phone> <email>[email protected]</email> <active>true</active> <image>assets/001.png</image> </employee> <employee> <name>Joanne Wall</name> <phone>555-219-2012</phone> <email>[email protected]</email> <active>true</active> <image>assets/002.png</image> </employee> <employee> <name>Maurice Smith</name> <phone>555-219-2012</phone> <email>[email protected]</email> <active>false</active> <image>assets/003.png</image> </employee> <employee> <name>Mary Jones</name> <phone>555-219-2000</phone> <email>[email protected]</email> <active>true</active> <image>assets/004.png</image> </employee> </fx:XMLList> </fx:Declarations> <s:HGroup> <mx:DataGrid dataProvider="{employees}" width="100%" dropEnabled="true"> <mx:columns> <mx:DataGridColumn headerText="Employee Name" dataField="name"/> <mx:DataGridColumn headerText="Email" dataField="email"/> <mx:DataGridColumn headerText="Image" dataField="image" itemRenderer="renderers.render1"/> </mx:columns> </mx:DataGrid> <s:List dragEnabled="true" dragMoveEnabled="false"> <s:dataProvider> <s:ArrayCollection> <fx:String>aaa</fx:String> <fx:String>bbb</fx:String> <fx:String>ccc</fx:String> <fx:String>ddd</fx:String> </s:ArrayCollection> </s:dataProvider> </s:List> </s:HGroup> </s:Application> Now what I want to do is let the user drag an one or more item from the left List component and drop at the third column of the DataGrid, then using the dragged data to create another <components:Person /> object. So in the final result, maybe the first line contains just one <components:Person /> object at the third column, the second line contains two <components:Person /> object at the third column and so on. Can this be implemented in Flex? How? Great thanks.

    Read the article

  • Optimizing sorting container of objects with heap-allocated buffers - how to avoid hard-copying buff

    - by Kache4
    I was making sure I knew how to do the op= and copy constructor correctly in order to sort() properly, so I wrote up a test case. After getting it to work, I realized that the op= was hard-copying all the data_. I figure if I wanted to sort a container with this structure (its elements have heap allocated char buffer arrays), it'd be faster to just swap the pointers around. Is there a way to do that? Would I have to write my own sort/swap function? #include <deque> //#include <string> //#include <utility> //#include <cstdlib> #include <cstring> #include <iostream> //#include <algorithm> // I use sort(), so why does this still compile when commented out? #include <boost/filesystem.hpp> #include <boost/foreach.hpp> using namespace std; namespace fs = boost::filesystem; class Page { public: // constructor Page(const char* path, const char* data, int size) : path_(fs::path(path)), size_(size), data_(new char[size]) { // cout << "Creating Page..." << endl; strncpy(data_, data, size); // cout << "done creating Page..." << endl; } // copy constructor Page(const Page& other) : path_(fs::path(other.path())), size_(other.size()), data_(new char[other.size()]) { // cout << "Copying Page..." << endl; strncpy(data_, other.data(), size_); // cout << "done copying Page..." << endl; } // destructor ~Page() { delete[] data_; } // accessors const fs::path& path() const { return path_; } const char* data() const { return data_; } int size() const { return size_; } // operators Page& operator = (const Page& other) { if (this == &other) return *this; char* newImage = new char[other.size()]; strncpy(newImage, other.data(), other.size()); delete[] data_; data_ = newImage; path_ = fs::path(other.path()); size_ = other.size(); return *this; } bool operator < (const Page& other) const { return path_ < other.path(); } private: fs::path path_; int size_; char* data_; }; class Book { public: Book(const char* path) : path_(fs::path(path)) { cout << "Creating Book..." << endl; cout << "pushing back #1" << endl; pages_.push_back(Page("image1.jpg", "firstImageData", 14)); cout << "pushing back #3" << endl; pages_.push_back(Page("image3.jpg", "thirdImageData", 14)); cout << "pushing back #2" << endl; pages_.push_back(Page("image2.jpg", "secondImageData", 15)); cout << "testing operator <" << endl; cout << pages_[0].path().string() << (pages_[0] < pages_[1]? " < " : " > ") << pages_[1].path().string() << endl; cout << pages_[1].path().string() << (pages_[1] < pages_[2]? " < " : " > ") << pages_[2].path().string() << endl; cout << pages_[0].path().string() << (pages_[0] < pages_[2]? " < " : " > ") << pages_[2].path().string() << endl; cout << "sorting" << endl; BOOST_FOREACH (Page p, pages_) cout << p.path().string() << endl; sort(pages_.begin(), pages_.end()); cout << "done sorting\n"; BOOST_FOREACH (Page p, pages_) cout << p.path().string() << endl; cout << "checking datas" << endl; BOOST_FOREACH (Page p, pages_) { char data[p.size() + 1]; strncpy((char*)&data, p.data(), p.size()); data[p.size()] = '\0'; cout << p.path().string() << " " << data << endl; } cout << "done Creating Book" << endl; } private: deque<Page> pages_; fs::path path_; }; int main() { Book* book = new Book("/some/path/"); }

    Read the article

  • Need help with copy constructor for very basic implementation of singly linked lists

    - by Jesus
    Last week, we created a program that manages sets of strings, using classes and vectors. I was able to complete this 100%. This week, we have to replace the vector we used to store strings in our class with simple singly linked lists. The function basically allows users to declare sets of strings that are empty, and sets with only one element. In the main file, there is a vector whose elements are a struct that contain setName and strSet (class). HERE IS MY PROBLEM: It deals with the copy constructor of the class. When I remove/comment out the copy constructor, I can declare as many empty or single sets as I want, and output their values without a problem. But I know I will obviously need the copy constructor for when I implement the rest of the program. When I leave the copy constructor in, I can declare one set, either single or empty, and output its value. But if I declare a 2nd set, and i try to output either of the first two sets, i get a Segmentation Fault. Moreover, if i try to declare more then 2 sets, I get a Segmentation Fault. Any help would be appreciated!! Here is my code for a very basic implementation of everything: Here is the setcalc.cpp: (main file) #include <iostream> #include <cctype> #include <cstring> #include <string> #include "help.h" #include "strset2.h" using namespace std; // Declares of structure to hold all the sets defined struct setsOfStr { string nameOfSet; strSet stringSet; }; // Checks if the set name inputted is unique bool isSetNameUnique( vector<setsOfStr> strSetArr, string setName) { for(unsigned int i = 0; i < strSetArr.size(); i++) { if( strSetArr[i].nameOfSet == setName ) { return false; } } return true; } int main(int argc, char *argv[]) { char commandChoice; // Declares a vector with our declared structure as the type vector<setsOfStr> strSetVec; string setName; string singleEle; // Sets a loop that will constantly ask for a command until 'q' is typed while (1) { // declaring a set to be empty if(commandChoice == 'd') { cin >> setName; // Check that the set name inputted is unique if (isSetNameUnique(strSetVec, setName) == true) { strSet emptyStrSet; setsOfStr set1; set1.nameOfSet = setName; set1.stringSet = emptyStrSet; strSetVec.push_back(set1); } else { cerr << "ERROR: Re-declaration of set '" << setName << "'\n"; } } // declaring a set to be a singleton else if(commandChoice == 's') { cin >> setName; cin >> singleEle; // Check that the set name inputted is unique if (isSetNameUnique(strSetVec, setName) == true) { strSet singleStrSet(singleEle); setsOfStr set2; set2.nameOfSet = setName; set2.stringSet = singleStrSet; strSetVec.push_back(set2); } else { cerr << "ERROR: Re-declaration of set '" << setName << "'\n"; } } // using the output function else if(commandChoice == 'o') { cin >> setName; if(isSetNameUnique(strSetVec, setName) == false) { // loop through until the set name is matched and call output on its strSet for(unsigned int k = 0; k < strSetVec.size(); k++) { if( strSetVec[k].nameOfSet == setName ) { (strSetVec[k].stringSet).output(); } } } else { cerr << "ERROR: No such set '" << setName << "'\n"; } } // quitting else if(commandChoice == 'q') { break; } else { cerr << "ERROR: Ignoring bad command: '" << commandChoice << "'\n"; } } return 0; } Here is the strSet2.h: #ifndef _STRSET_ #define _STRSET_ #include <iostream> #include <vector> #include <string> struct node { std::string s1; node * next; }; class strSet { private: node * first; public: strSet (); // Create empty set strSet (std::string s); // Create singleton set strSet (const strSet &copy); // Copy constructor // will implement destructor later void output() const; strSet& operator = (const strSet& rtSide); // Assignment }; // End of strSet class #endif // _STRSET_ And here is the strSet2.cpp (implementation of class) #include <iostream> #include <vector> #include <string> #include "strset2.h" using namespace std; strSet::strSet() { first = NULL; } strSet::strSet(string s) { node *temp; temp = new node; temp->s1 = s; temp->next = NULL; first = temp; } strSet::strSet(const strSet& copy) { cout << "copy-cst\n"; node *n = copy.first; node *prev = NULL; while (n) { node *newNode = new node; newNode->s1 = n->s1; newNode->next = NULL; if (prev) { prev->next = newNode; } else { first = newNode; } prev = newNode; n = n->next; } } void strSet::output() const { if(first == NULL) { cout << "Empty set\n"; } else { node *temp; temp = first; while(1) { cout << temp->s1 << endl; if(temp->next == NULL) break; temp = temp->next; } } } strSet& strSet::operator = (const strSet& rtSide) { first = rtSide.first; return *this; }

    Read the article

  • Httpsession with Spring 3 MVC

    - by vipul12389
    I want to use httpsession in Spring 3 MVC..i have searched all the web and got this solution..at http://forum.springsource.org/showthread.php?98850-Adding-to-stuff-to-the-session-while-using-ResponseBody Basically, My application auto authenticates user by getting winId and authorizes through LDAP..(Its a intranet site) Here is the flow of the application, 1. User enters Aplication url (http://localhost:8082/eIA_Mock_5) it has a welcome page (index.jsp) Index.jsp gets winId through jQuery and hits login.html (through Ajax) and passes windowsId login.html (Controller) authenticates through LDAP and gives back 'Valid' String as a response javascript, upon getting the correct response, redirects/loads welcome page i.e. goes to localhost:8082/eIA_Mock_5/welcome.html Now, i have filter associated with it..which checks for is session valid for each incoming request..Now the problem is even though i set data on to httpsession, yet the filter or any other controller fails to get the data through session as a result it doesnt proceeds further.. here is the code..and could you suggest what is wrong actually ?? Home_Controller.java @Controller public class Home_Controller { public static Log logger = LogFactory.getLog(Home_Controller.class); @RequestMapping(value={"/welcome"}) public ModelAndView loadWelcomePage(HttpServletRequest request,HttpServletResponse response) { ModelAndView mdv = new ModelAndView(); try{ /*HttpSession session = request.getSession(); UserMasterBean userBean = (UserMasterBean)session.getAttribute("userBean"); String userName=userBean.getWindowsId(); if(userName==null || userName.equalsIgnoreCase("")) { mdv.setViewName("homePage"); System.out.println("Unable to authenticate user "); logger.debug("Unable to authenticate user "); } else { System.out.println("Welcome User "+userName); logger.debug("Welcome User "+userName); */ mdv.setViewName("homePage"); /*}*/ } catch(Exception e){ logger.debug("inside authenticateUser ",e); e.printStackTrace(); } return mdv; } @RequestMapping(value = "/login", method = RequestMethod.GET) public @ResponseBody String authenticateUser(@RequestParam String userName,HttpSession session) { logger.debug("inside authenticateUser"); String returnResponse=new String(); try{ logger.debug("userName for Authentication "+userName); System.out.println("userName for Authentication "+userName); //HttpSession session = request.getSession(); if(userName==null || userName.trim().equalsIgnoreCase("")) returnResponse="Invalid"; else { System.out.println("uname "+userName); String ldapResponse = LDAPConnectUtil.isValidActiveDirectoryUser(userName, ""); if(ldapResponse.equalsIgnoreCase("true")) { returnResponse="Valid"; System.out.println(userName+" Authenticated"); logger.debug(userName+" Authenticated"); UserMasterBean userBean = new UserMasterBean(); userBean.setWindowsId(userName); //if(session.getAttribute("userBean")==null) session.setAttribute("userBean", userBean); } else { returnResponse="Invalid"; //session.setAttribute("userBean", null); System.out.println("Unable to Authenticate the user through Ldap"); logger.debug("Unable to Authenticate the user through Ldap"); } System.out.println("ldapResponse "+ldapResponse); logger.debug("ldapResponse "+ldapResponse); System.out.println("returnResponse "+returnResponse); } UserMasterBean u = (UserMasterBean)session.getAttribute("userBean"); System.out.println("winId "+u.getWindowsId()); } catch(Exception e){ e.printStackTrace(); logger.debug("Exception in authenticateUser ",e); } return returnResponse; } Filter public void doFilter(ServletRequest request, ServletResponse response, FilterChain chain) { System.out.println("in PageFilter"); boolean flag = false; HttpServletRequest objHttpServletRequest = (HttpServletRequest)request; HttpServletResponse objHttpServletResponse = (HttpServletResponse)response; HttpSession session = objHttpServletRequest.getSession(); String contextPath = objHttpServletRequest.getContextPath(); String servletPath = objHttpServletRequest.getSession().getServletContext().getRealPath(objHttpServletRequest.getServletPath()); logger.debug("contextPath :" + contextPath); logger.debug("servletPath :" + servletPath); System.out.println("in PageFilter, contextPath :" + contextPath); System.out.println("in PageFilter, servletPath :" + servletPath); if (servletPath.endsWith("\\") || servletPath.endsWith("/") || servletPath.indexOf("css") > 0 || servletPath.indexOf("jsp") > 0 || servletPath.indexOf("images") > 0 || servletPath.indexOf("js") > 0 || servletPath.endsWith("index.jsp") || servletPath.indexOf("xls") > 0 || servletPath.indexOf("ini") > 0 || servletPath.indexOf("login.html") > 0 || /*servletPath.endsWith("welcome.html") ||*/ servletPath.endsWith("logout.do") ) { System.out.println("User is trying to access allowed pages like Login.jsp, errorPage.jsp, js, images, css"); logger.debug("User is trying to access allowed pages like Login.jsp, errorPage.jsp, js, images, css"); flag = true; } if (flag== false) { System.out.println("flag = false"); if(session.getAttribute("userBean") == null) System.out.println("yes session.userbean is null"); if ((session != null) && (session.getAttribute("userBean") != null)) { System.out.println("session!=null && session.getAttribute(userId)!=null"); logger.debug("IF Part"); UserMasterBean userBean = (UserMasterBean)session.getAttribute("userBean"); String windowsId = userBean.getWindowsId(); logger.debug("User Id " + windowsId + " allowed access"); System.out.println("User Id " + windowsId + " allowed access"); flag = true; } else { System.out.println("else .....session!=null && session.getAttribute(userId)!=null"); logger.debug("Else Part"); flag = false; } } if (flag == true) { try { System.out.println("before chain.doFilter(request, response)"); chain.doFilter(request, response); } catch (Exception e) { e.printStackTrace(); try { objHttpServletResponse.sendRedirect(contextPath + "/logout.do"); } catch (Exception ex) { ex.printStackTrace(); } } } else { try { System.out.println("before sendRedirect"); objHttpServletResponse.sendRedirect(contextPath + "/jsp/errorPage.jsp"); } catch (Exception ex) { ex.printStackTrace(); } } System.out.println("end of PageFilter"); } Index.jsp <script type="text/javascript"> //alert("inside s13"); var WinNetwork = new ActiveXObject("WScript.Network"); var userName=WinNetwork.UserName; alert(userName); $.ajax({ url : "login.html", data : "userName="+userName, success : function(result) { alert("result == "+result); if(result=="Valid") window.location = "http://10.160.118.200:8082/eIA_Mock_5/welcome.html"; } }); </script> web.xml has a filter entry with URL pattern as * I am using spring 3 mvc

    Read the article

  • Trouble calling a method from an external class

    - by Bradley Hobbs
    Here is my employee database program: import java.util.*; import java.io.*; import java.io.File; import java.io.FileReader; import java.util.ArrayList; public class P { //Instance Variables private static String empName; private static String wage; private static double wages; private static double salary; private static double numHours; private static double increase; // static ArrayList<String> ARempName = new ArrayList<String>(); // static ArrayList<Double> ARwages = new ArrayList<Double>(); // static ArrayList<Double> ARsalary = new ArrayList<Double>(); static ArrayList<Employee> emp = new ArrayList<Employee>(); public static void main(String[] args) throws Exception { clearScreen(); printMenu(); question(); exit(); } public static void printArrayList(ArrayList<Employee> emp) { for (int i = 0; i < emp.size(); i++){ System.out.println(emp.get(i)); } } public static void clearScreen() { System.out.println("\u001b[H\u001b[2J"); } private static void exit() { System.exit(0); } private static void printMenu() { System.out.println("\t------------------------------------"); System.out.println("\t|Commands: n - New employee |"); System.out.println("\t| c - Compute paychecks |"); System.out.println("\t| r - Raise wages |"); System.out.println("\t| p - Print records |"); System.out.println("\t| d - Download data |"); System.out.println("\t| u - Upload data |"); System.out.println("\t| q - Quit |"); System.out.println("\t------------------------------------"); System.out.println(""); } public static void question() { System.out.print("Enter command: "); Scanner q = new Scanner(System.in); String input = q.nextLine(); input.replaceAll("\\s","").toLowerCase(); boolean valid = (input.equals("n") || input.equals("c") || input.equals("r") || input.equals("p") || input.equals("d") || input.equals("u") || input.equals("q")); if (!valid){ System.out.println("Command was not recognized; please try again."); printMenu(); question(); } else if (input.equals("n")){ System.out.print("Enter the name of new employee: "); Scanner stdin = new Scanner(System.in); empName = stdin.nextLine(); System.out.print("Hourly (h) or salaried (s): "); Scanner stdin2 = new Scanner(System.in); wage = stdin2.nextLine(); wage.replaceAll("\\s","").toLowerCase(); if (!(wage.equals("h") || wage.equals("s"))){ System.out.println("Input was not h or s; please try again"); } else if (wage.equals("h")){ System.out.print("Enter hourly wage: "); Scanner stdin4 = new Scanner(System.in); wages = stdin4.nextDouble(); Employee emp1 = new HourlyEmployee(empName, wages); emp.add(emp1); printMenu(); question();} else if (wage.equals("s")){ System.out.print("Enter annual salary: "); Scanner stdin5 = new Scanner(System.in); salary = stdin5.nextDouble(); Employee emp1 = new SalariedEmployee(empName, salary); printMenu(); question();}} else if (input.equals("c")){ for (int i = 0; i < emp.size(); i++){ System.out.println("Enter number of hours worked by " + emp.get(i) + ":"); } Scanner stdin = new Scanner(System.in); numHours = stdin.nextInt(); System.out.println("Pay: " + emp1.computePay(numHours)); System.out.print("Enter number of hours worked by " + empName); Scanner stdin2 = new Scanner(System.in); numHours = stdin2.nextInt(); System.out.println("Pay: " + emp1.computePay(numHours)); printMenu(); question();} else if (input.equals("r")){ System.out.print("Enter percentage increase: "); Scanner stdin = new Scanner(System.in); increase = stdin.nextDouble(); System.out.println("\nNew Wages"); System.out.println("---------"); // System.out.println(Employee.toString()); printMenu(); question(); } else if (input.equals("p")){ printArrayList(emp); printMenu(); question(); } else if (input.equals("q")){ exit(); } } } Here is one of the class files: public abstract class Employee { private String name; private double wage; protected Employee(String name, double wage){ this.name = name; this.wage = wage; } public String getName() { return name; } public double getWage() { return wage; } public void setName(String name) { this.name = name; } public void setWage(double wage) { this.wage = wage; } public void percent(double wage, double percent) { wage *= percent; } } And here are the errors: P.java:108: cannot find symbol symbol : variable emp1 location: class P System.out.println("Pay: " + emp1.computePay(numHours)); ^ P.java:112: cannot find symbol symbol : variable emp1 location: class P System.out.println("Pay: " + emp1.computePay(numHours)); ^ 2 errors I'm trying to the get paycheck to print out but i'm having trouble with how to call the method. It should take the user inputed numHours and calculate it then print on the paycheck for each employee. Thanks!

    Read the article

  • Mulit-tenant ASP.NET MVC – Controllers

    - by zowens
    Part I – Introduction Part II – Foundation   The time has come to talk about controllers in a multi-tenant ASP.NET MVC architecture. This is actually the most critical design decision you will make when dealing with multi-tenancy with MVC. In my design, I took into account the design goals I mentioned in the introduction about inversion of control and what a tenant is to my design. Be aware that this is only one way to achieve multi-tenant controllers.   The Premise MvcEx (which is a sample written by Rob Ashton) utilizes dynamic controllers. Essentially a controller is “dynamic” in that multiple action results can be placed in different “controllers” with the same name. This approach is a bit too complicated for my design. I wanted to stick with plain old inheritance when dealing with controllers. The basic premise of my controller design is that my main host defines a set of universal controllers. It is the responsibility of the tenant to decide if the tenant would like to utilize these core controllers. This can be done either by straight usage of the controller or inheritance for extension of the functionality defined by the controller. The controller is resolved by a StructureMap container that is attached to the tenant, as discussed in Part II.   Controller Resolution I have been thinking about two different ways to resolve controllers with StructureMap. One way is to use named instances. This is a really easy way to simply pull the controller right out of the container without a lot of fuss. I ultimately chose not to use this approach. The reason for this decision is to ensure that the controllers are named properly. If a controller has a different named instance that the controller type, then the resolution has a significant disconnect and there are no guarantees. The final approach, the one utilized by the sample, is to simply pull all controller types and correlate the type with a controller name. This has a bit of a application start performance disadvantage, but is significantly more approachable for maintainability. For example, if I wanted to go back and add a “ControllerName” attribute, I would just have to change the ControllerFactory to suit my needs.   The Code The container factory that I have built is actually pretty simple. That’s really all we need. The most significant method is the GetControllersFor method. This method makes the model from the Container and determines all the concrete types for IController.  The thing you might notice is that this doesn’t depend on tenants, but rather containers. You could easily use this controller factory for an application that doesn’t utilize multi-tenancy. public class ContainerControllerFactory : IControllerFactory { private readonly ThreadSafeDictionary<IContainer, IDictionary<string, Type>> typeCache; public ContainerControllerFactory(IContainerResolver resolver) { Ensure.Argument.NotNull(resolver, "resolver"); this.ContainerResolver = resolver; this.typeCache = new ThreadSafeDictionary<IContainer, IDictionary<string, Type>>(); } public IContainerResolver ContainerResolver { get; private set; } public virtual IController CreateController(RequestContext requestContext, string controllerName) { var controllerType = this.GetControllerType(requestContext, controllerName); if (controllerType == null) return null; var controller = this.ContainerResolver.Resolve(requestContext).GetInstance(controllerType) as IController; // ensure the action invoker is a ContainerControllerActionInvoker if (controller != null && controller is Controller && !((controller as Controller).ActionInvoker is ContainerControllerActionInvoker)) (controller as Controller).ActionInvoker = new ContainerControllerActionInvoker(this.ContainerResolver); return controller; } public void ReleaseController(IController controller) { if (controller != null && controller is IDisposable) ((IDisposable)controller).Dispose(); } internal static IEnumerable<Type> GetControllersFor(IContainer container) { Ensure.Argument.NotNull(container); return container.Model.InstancesOf<IController>().Select(x => x.ConcreteType).Distinct(); } protected virtual Type GetControllerType(RequestContext requestContext, string controllerName) { Ensure.Argument.NotNull(requestContext, "requestContext"); Ensure.Argument.NotNullOrEmpty(controllerName, "controllerName"); var container = this.ContainerResolver.Resolve(requestContext); var typeDictionary = this.typeCache.GetOrAdd(container, () => GetControllersFor(container).ToDictionary(x => ControllerFriendlyName(x.Name))); Type found = null; if (typeDictionary.TryGetValue(ControllerFriendlyName(controllerName), out found)) return found; return null; } private static string ControllerFriendlyName(string value) { return (value ?? string.Empty).ToLowerInvariant().Without("controller"); } } One thing to note about my implementation is that we do not use namespaces that can be utilized in the default ASP.NET MVC controller factory. This is something that I don’t use and have no desire to implement and test. The reason I am not using namespaces in this situation is because each tenant has its own namespaces and the routing would not make sense in this case.   Because we are using IoC, dependencies are automatically injected into the constructor. For example, a tenant container could implement it’s own IRepository and a controller could be defined in the “main” project. The IRepository from the tenant would be injected into the main project’s controller. This is quite a useful feature.   Again, the source code is on GitHub here.   Up Next Up next is the view resolution. This is a complicated issue, so be prepared. I hope that you have found this series useful. If you have any questions about my implementation so far, send me an email or DM me on Twitter. I have had a lot of great conversations about multi-tenancy so far and I greatly appreciate the feedback!

    Read the article

  • AutoMapper MappingFunction from Source Type of NameValueCollection

    - by REA_ANDREW
    I have had a situation arise today where I need to construct a complex type from a source of a NameValueCollection.  A little while back I submitted a patch for the Agatha Project to include REST (JSON and XML) support for the service contract.  I realized today that as useful as it is, it did not actually support true REST conformance, as REST should support GET so that you can use JSONP from JavaScript directly meaning you can query cross domain services.  My original implementation for POX and JSON used the POST method and this immediately rules out JSONP as from reading, JSONP only works with GET Requests. This then raised another issue.  The current operation contract of Agatha and one of its main benefits is that you can supply an array of Request objects in a single request, limiting the about of server requests you need to make.  Now, at the present time I am thinking that this will not be the case for the REST imlementation but will yield the benefits of the fact that : The same Request objects can be used for SOAP and RST (POX, JSON) The construct of the JavaScript functions will be simpler and more readable It will enable the use of JSONP for cross domain REST Services The current contract for the Agatha WcfRequestProcessor is at time of writing the following: [ServiceContract] public interface IWcfRequestProcessor { [OperationContract(Name = "ProcessRequests")] [ServiceKnownType("GetKnownTypes", typeof(KnownTypeProvider))] [TransactionFlow(TransactionFlowOption.Allowed)] Response[] Process(params Request[] requests); [OperationContract(Name = "ProcessOneWayRequests", IsOneWay = true)] [ServiceKnownType("GetKnownTypes", typeof(KnownTypeProvider))] void ProcessOneWayRequests(params OneWayRequest[] requests); }   My current proposed solution, and at the very early stages of my concept is as follows: [ServiceContract] public interface IWcfRestJsonRequestProcessor { [OperationContract(Name="process")] [ServiceKnownType("GetKnownTypes", typeof(KnownTypeProvider))] [TransactionFlow(TransactionFlowOption.Allowed)] [WebGet(UriTemplate = "process/{name}/{*parameters}", BodyStyle = WebMessageBodyStyle.WrappedResponse, ResponseFormat = WebMessageFormat.Json)] Response[] Process(string name, NameValueCollection parameters); [OperationContract(Name="processoneway",IsOneWay = true)] [ServiceKnownType("GetKnownTypes", typeof(KnownTypeProvider))] [WebGet(UriTemplate = "process-one-way/{name}/{*parameters}", BodyStyle = WebMessageBodyStyle.WrappedResponse, ResponseFormat = WebMessageFormat.Json)] void ProcessOneWayRequests(string name, NameValueCollection parameters); }   Now this part I have not yet implemented, it is the preliminart step which I have developed which will allow me to take the name of the Request Type and the NameValueCollection and construct the complex type which is that of the Request which I can then supply to a nested instance of the original IWcfRequestProcessor  and work as it should normally.  To give an example of some of the urls which you I envisage with this method are: http://www.url.com/service.svc/json/process/getweather/?location=london http://www.url.com/service.svc/json/process/getproductsbycategory/?categoryid=1 http://www.url.om/service.svc/json/process/sayhello/?name=andy Another reason why my direction has gone to a single request for the REST implementation is because of restrictions which are imposed by browsers on the length of the url.  From what I have read this is on average 2000 characters.  I think that this is a very acceptable usage limit in the context of using 1 request, but I do not think this is acceptable for accommodating multiple requests chained together.  I would love to be corrected on that one, I really would but unfortunately from what I have read I have come to the conclusion that this is not the case. The mapping function So, as I say this is just the first pass I have made at this, and I am not overly happy with the try catch for detecting types without default constructors.  I know there is a better way but for the minute, it escapes me.  I would also like to know the correct way for adding mapping functions and not using the anonymous way that I have used.  To achieve this I have used recursion which I am sure is what other mapping function use. As you do have to go as deep as the complex type is. public static object RecurseType(NameValueCollection collection, Type type, string prefix) { try { var returnObject = Activator.CreateInstance(type); foreach (var property in type.GetProperties()) { foreach (var key in collection.AllKeys) { if (String.IsNullOrEmpty(prefix) || key.Length > prefix.Length) { var propertyNameToMatch = String.IsNullOrEmpty(prefix) ? key : key.Substring(property.Name.IndexOf(prefix) + prefix.Length + 1); if (property.Name == propertyNameToMatch) { property.SetValue(returnObject, Convert.ChangeType(collection.Get(key), property.PropertyType), null); } else if(property.GetValue(returnObject,null) == null) { property.SetValue(returnObject, RecurseType(collection, property.PropertyType, String.Concat(prefix, property.PropertyType.Name)), null); } } } } return returnObject; } catch (MissingMethodException) { //Quite a blunt way of dealing with Types without default constructor return null; } }   Another thing is performance, I have not measured this in anyway, it is as I say the first pass, so I hope this can be the start of a more perfected implementation.  I tested this out with a complex type of three levels, there is no intended logical meaning to the properties, they are simply for the purposes of example.  You could call this a spiking session, as from here on in, now I know what I am building I would take a more TDD approach.  OK, purists, why did I not do this from the start, well I didn’t, this was a brain dump and now I know what I am building I can. The console test and how I used with AutoMapper is as follows: static void Main(string[] args) { var collection = new NameValueCollection(); collection.Add("Name", "Andrew Rea"); collection.Add("Number", "1"); collection.Add("AddressLine1", "123 Street"); collection.Add("AddressNumber", "2"); collection.Add("AddressPostCodeCountry", "United Kingdom"); collection.Add("AddressPostCodeNumber", "3"); AutoMapper.Mapper.CreateMap<NameValueCollection, Person>() .ConvertUsing(x => { return(Person) RecurseType(x, typeof(Person), null); }); var person = AutoMapper.Mapper.Map<NameValueCollection, Person>(collection); Console.WriteLine(person.Name); Console.WriteLine(person.Number); Console.WriteLine(person.Address.Line1); Console.WriteLine(person.Address.Number); Console.WriteLine(person.Address.PostCode.Country); Console.WriteLine(person.Address.PostCode.Number); Console.ReadLine(); }   Notice the convention that I am using and that this method requires you do use.  Each property is prefixed with the constructed name of its parents combined.  This is the convention used by AutoMapper and it makes sense. I can also think of other uses for this including using with ASP.NET MVC ModelBinders for creating a complex type from the QueryString which is itself is a NameValueCollection. Hope this is of some help to people and I would welcome any code reviews you could give me. References: Agatha : http://code.google.com/p/agatha-rrsl/ AutoMapper : http://automapper.codeplex.com/   Cheers for now, Andrew   P.S. I will have the proposed solution for a more complete REST implementation for AGATHA very soon. 

    Read the article

  • Building services with the .NET framework Cont’d

    - by Allan Rwakatungu
    In my previous blog I wrote an introductory post on services and how you can build services using the .NET frameworks Windows Communication Foundation (WCF) In this post I will show how to develop a real world application using WCF The problem During the last meeting we realized developers in Uganda are not so cool – they don’t use twitter so may not get the latest news and updates from the technology world. We also noticed they mostly use kabiriti phones (jokes). With their kabiriti phones they are unable to access the twitter web client or alternative twitter mobile clients like tweetdeck , twirl or tweetie. However, the kabiriti phones support SMS (Yeeeeeeei). So what we going to do to make these developers cool and keep them updated is by enabling them to receive tweets via SMS. We shall also enable them to develop their own applications that can extend this functionality Analysis Thanks to services and open API’s solving our problem is going to be easy.  1. To get tweets we can use the twitter service for FREE 2. To send SMS we shall use www.clickatell.com/ as they can send SMS to any country in the world. Besides we could not find any local service that offers API's for sending SMS :(. 3. To enable developers to integrate with our application so that they can extend it and build even cooler applications we use WCF. In addittion , because connectivity might be an issue we decided to use WCF because if has a inbuilt queing features. We also choose WCF because this is a post about .NET and WCF :). The Code Accessing the tweets To consume twitters REST API we shall use the WCF REST starter kit. Like it name indicates , the REST starter kit is a set of .NET framework classes that enable developers to create and access REST style services ( like the twitter service). Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} using System; using System.Collections.Generic; using System.Linq; using System.Text; using Microsoft.Http; using System.Net; using System.Xml.Linq;   namespace UG.Demo {     public class TwitterService     {         public IList<TwitterStatus> SomeMethodName()         {             //Connect to the twitter service (HttpClient is part of the REST startkit classes)             HttpClient cl = new HttpClient("http://api.twitter.com/1/statuses/friends_timeline.xml");             //Supply your basic authentication credentials             cl.TransportSettings.Credentials = new NetworkCredential("ourusername", "ourpassword");             //issue an http             HttpResponseMessage resp = cl.Get();             //ensure we got reponse 200             resp.EnsureStatusIsSuccessful();             //use XLinq to parse the REST XML             var statuses = from r in resp.Content.ReadAsXElement().Descendants("status")                            select new TwitterStatus                            {                                User = r.Element("user").Element("screen_name").Value,                                Status = r.Element("text").Value                            };             return statuses.ToList();         }     }     public class TwitterStatus     {         public string User { get; set; }         public string Status { get; set; }     } }  Sending SMS Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} public class SMSService     {         public void Send(string phone, string message)         {                         HttpClient cl1 = new HttpClient();              //the clickatell XML format for sending SMS             string xml = String.Format("<clickAPI><sendMsg><api_id>3239621</api_id><user>ourusername</user><password>ourpassword</password><to>{0}</to><text>{1}</text></sendMsg></clickAPI>",phone,message);             //Post form data             HttpUrlEncodedForm form = new HttpUrlEncodedForm();             form.Add("data", xml);             System.Net.ServicePointManager.Expect100Continue = false;             string uri = @"http://api.clickatell.com/xml/xml";             HttpResponseMessage resp = cl1.Post(uri, form.CreateHttpContent());             resp.EnsureStatusIsSuccessful();         }     }

    Read the article

  • ASP.NET Controls – CommunityServer Captcha ControlAdapter, a practical case

    - by nmgomes
    The ControlAdapter is available since .NET framework version 2.0 and his main goal is to adapt and customize a control render in order to achieve a specific behavior or layout. This customization is done without changing the base control. A ControlAdapter is commonly used to custom render for specific platforms like Mobile. In this particular case the ControlAdapter was used to add a specific behavior to a Control. In this  post I will use one adapter to add a Captcha to all WeblogPostCommentForm controls within pontonetpt.com CommunityServer instance. The Challenge The ControlAdapter complexity is usually associated with the complexity/structure of is base control. This case is precisely one of those since base control dynamically load his content (controls) thru several ITemplate. Those of you who already played with ITemplate knows that while it is an excellent option for control composition it also brings to the table a big issue: “Controls defined within a template are not available for manipulation until they are instantiated inside another control.” While analyzing the WeblogPostCommentForm control I found that he uses the ITemplate technique to compose it’s layout and unfortunately I also found that the template content vary from theme to theme. This could have been a problem but luckily WeblogPostCommentForm control template content always contains a submit button with a well known ID (at least I can assume that there are a well known set of IDs). Using this submit button as anchor it’s possible to add the Captcha controls in the correct place. Another important finding was that WeblogPostCommentForm control inherits from the WrappedFormBase control which is the base control for all CommunityServer input forms. Knowing this inheritance link the main goal has changed to became the creation of a base ControlAdapter that  could be extended and customized to allow adding Captcha to: post comments form contact form user creation form. And, with this mind set, I decided to used the following ControlAdapter base class signature :public abstract class WrappedFormBaseCaptchaAdapter<T> : ControlAdapter where T : WrappedFormBase { }Great, but there are still many to do … Captcha The Captcha will be assembled with: A dynamically generated image with a set of random numbers A TextBox control where the image number will be inserted A Validator control to validate whether TextBox numbers match the image numbers This is a common Captcha implementation, is not rocket science and don’t bring any additional problem. The main problem, as told before, is to find the correct anchor control to ensure a correct Captcha control injection. The anchor control can vary by: target control  theme Implementation To support this dynamic scenario I choose to use the following implementation:private List<string> _validAnchorIds = null; protected virtual List<string> ValidAnchorIds { get { if (this._validAnchorIds == null) { this._validAnchorIds = new List<string>(); this._validAnchorIds.Add("btnSubmit"); } return this._validAnchorIds; } } private Control GetAnchorControl(T wrapper) { if (this.ValidAnchorIds == null || this.ValidAnchorIds.Count == 0) { throw new ArgumentException("Cannot be null or empty", "validAnchorNames"); } var q = from anchorId in this.ValidAnchorIds let anchorControl = CSControlUtility.Instance().FindControl(wrapper, anchorId) where anchorControl != null select anchorControl; return q.FirstOrDefault(); } I can now, using the ValidAnchorIds property, configure a set of valid anchor control  Ids. The GetAnchorControl method searches for a valid anchor control within the set of valid control Ids. Here, some of you may question why to use a LINQ To Objects expression, but the important here is to notice the usage of CSControlUtility.Instance().FindControl CommunityServer method. I want to build on top of CommunityServer not to reinvent the wheel. Assuming that an anchor control was found, it’s now possible to inject the Captcha at the correct place. This not something new, we do this all the time when creating server controls or adding dynamic controls:protected sealed override void CreateChildControls() { base.CreateChildControls(); if (this.IsCaptchaRequired) { T wrapper = base.Control as T; if (wrapper != null) { Control anchorControl = GetAnchorControl(wrapper); if (anchorControl != null) { Panel phCaptcha = new Panel {CssClass = "CommonFormField", ID = "Captcha"}; int index = anchorControl.Parent.Controls.IndexOf(anchorControl); anchorControl.Parent.Controls.AddAt(index, phCaptcha); CaptchaConfiguration.DefaultProvider.AddCaptchaControls( phCaptcha, GetValidationGroup(wrapper, anchorControl)); } } } } Here you can see a new entity in action: a provider. This is a CaptchaProvider class instance and is only goal is to create the Captcha itself and do everything else is needed to ensure is correct operation.public abstract class CaptchaProvider : ProviderBase { public abstract void AddCaptchaControls(Panel captchaPanel, string validationGroup); } You can create your own specific CaptchaProvider class to use different Captcha strategies including the use of existing Captcha services  like ReCaptcha. Once the generic ControlAdapter was created became extremely easy to created a specific one. Here is the specific ControlAdapter for the WeblogPostCommentForm control:public class WeblogPostCommentFormCaptchaAdapter : WrappedFormBaseCaptchaAdapter<WrappedFormBase> { #region Overriden Methods protected override List<string> ValidAnchorIds { get { List<string> validAnchorNames = base.ValidAnchorIds; validAnchorNames.Add("CommentSubmit"); return validAnchorNames; } } protected override string DefaultValidationGroup { get { return "CreateCommentForm"; } } #endregion Overriden Methods } Configuration This is the magic step. Without changing the original pages and keeping the application original assemblies untouched we are going to add a new behavior to the CommunityServer application. To glue everything together you must follow this steps: Add the following configuration to default.browser file:<?xml version='1.0' encoding='utf-8'?> <browsers> <browser refID="Default"> <controlAdapters> <!-- Adapter for the WeblogPostCommentForm control in order to add the Captcha and prevent SPAM comments --> <adapter controlType="CommunityServer.Blogs.Controls.WeblogPostCommentForm" adapterType="NunoGomes.CommunityServer.Components.WeblogPostCommentFormCaptchaAdapter, NunoGomes.CommunityServer" /> </controlAdapters> </browser> </browsers> Add the following configuration to web.config file:<configuration> <configSections> <!-- New section for Captcha providers configuration --> <section name="communityServer.Captcha" type="NunoGomes.CommunityServer.Captcha.Configuration.CaptchaSection" /> </configSections> <!-- Configuring a simple Captcha provider --> <communityServer.Captcha defaultProvider="simpleCaptcha"> <providers> <add name="simpleCaptcha" type="NunoGomes.CommunityServer.Captcha.Providers.SimpleCaptchaProvider, NunoGomes.CommunityServer" imageUrl="~/captcha.ashx" enabled="true" passPhrase="_YourPassPhrase_" saltValue="_YourSaltValue_" hashAlgorithm="SHA1" passwordIterations="3" keySize="256" initVector="_YourInitVectorWithExactly_16_Bytes_" /> </providers> </communityServer.Captcha> <system.web> <httpHandlers> <!-- The Captcha Image handler used by the simple Captcha provider --> <add verb="GET" path="captcha.ashx" type="NunoGomes.CommunityServer.Captcha.Providers.SimpleCaptchaProviderImageHandler, NunoGomes.CommunityServer" /> </httpHandlers> </system.web> <system.webServer> <handlers accessPolicy="Read, Write, Script, Execute"> <!-- The Captcha Image handler used by the simple Captcha provider --> <add verb="GET" name="captcha" path="captcha.ashx" type="NunoGomes.CommunityServer.Captcha.Providers.SimpleCaptchaProviderImageHandler, NunoGomes.CommunityServer" /> </handlers> </system.webServer> </configuration> Conclusion Building a ControlAdapter can be complex but the reward is his ability to allows us, thru configuration changes, to modify an application render and/or behavior. You can see this ControlAdapter in action here and here (anonymous required). A complete solution is available in “CommunityServer Extensions” Codeplex project.

    Read the article

  • Adding Volcanos and Options - Earthquake Locator, part 2

    - by Bobby Diaz
    Since volcanos are often associated with earthquakes, and vice versa, I decided to show recent volcanic activity on the Earthquake Locator map.  I am pulling the data from a website created for a joint project between the Smithsonian's Global Volcanism Program and the US Geological Survey's Volcano Hazards Program, found here.  They provide a Weekly Volcanic Activity Report as an RSS feed.   I started implementing this new functionality by creating a new Volcano entity in the domain model and adding the following to the EarthquakeService class (I also factored out the common reading/parsing helper methods to a separate FeedReader class that can be used by multiple domain service classes):           private static readonly string VolcanoFeedUrl =             ConfigurationManager.AppSettings["VolcanoFeedUrl"];           /// <summary>         /// Gets the volcano data for the previous week.         /// </summary>         /// <returns>A queryable collection of <see cref="Volcano"/> objects.</returns>         public IQueryable<Volcano> GetVolcanos()         {             var feed = FeedReader.Load(VolcanoFeedUrl);             var list = new List<Volcano>();               if ( feed != null )             {                 foreach ( var item in feed.Items )                 {                     var quake = CreateVolcano(item);                     if ( quake != null )                     {                         list.Add(quake);                     }                 }             }               return list.AsQueryable();         }           /// <summary>         /// Creates a <see cref="Volcano"/> object for each item in the RSS feed.         /// </summary>         /// <param name="item">The RSS item.</param>         /// <returns></returns>         private Volcano CreateVolcano(SyndicationItem item)         {             Volcano volcano = null;             string title = item.Title.Text;             string desc = item.Summary.Text;             double? latitude = null;             double? longitude = null;               FeedReader.GetGeoRssPoint(item, out latitude, out longitude);               if ( !String.IsNullOrEmpty(title) )             {                 title = title.Substring(0, title.IndexOf('-'));             }             if ( !String.IsNullOrEmpty(desc) )             {                 desc = String.Join("\n\n", desc                         .Replace("<p>", "")                         .Split(                             new string[] { "</p>" },                             StringSplitOptions.RemoveEmptyEntries)                         .Select(s => s.Trim())                         .ToArray())                         .Trim();             }               if ( latitude != null && longitude != null )             {                 volcano = new Volcano()                 {                     Id = item.Id,                     Title = title,                     Description = desc,                     Url = item.Links.Select(l => l.Uri.OriginalString).FirstOrDefault(),                     Latitude = latitude.GetValueOrDefault(),                     Longitude = longitude.GetValueOrDefault()                 };             }               return volcano;         } I then added the corresponding LoadVolcanos() method and Volcanos collection to the EarthquakeViewModel class in much the same way I did with the Earthquakes in my previous article in this series. Now that I am starting to add more information to the map, I wanted to give the user some options as to what is displayed and allowing them to choose what gets turned off.  I have updated the MainPage.xaml to look like this:   <UserControl x:Class="EarthquakeLocator.MainPage"     xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation"     xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml"     xmlns:d="http://schemas.microsoft.com/expression/blend/2008"     xmlns:mc="http://schemas.openxmlformats.org/markup-compatibility/2006"     xmlns:basic="clr-namespace:System.Windows.Controls;assembly=System.Windows.Controls"     xmlns:bing="clr-namespace:Microsoft.Maps.MapControl;assembly=Microsoft.Maps.MapControl"     xmlns:vm="clr-namespace:EarthquakeLocator.ViewModel"     mc:Ignorable="d" d:DesignWidth="640" d:DesignHeight="480" >     <UserControl.Resources>         <DataTemplate x:Key="EarthquakeTemplate">             <Ellipse Fill="Red" Stroke="Black" StrokeThickness="1"                      Width="{Binding Size}" Height="{Binding Size}"                      bing:MapLayer.Position="{Binding Location}"                      bing:MapLayer.PositionOrigin="Center">                 <ToolTipService.ToolTip>                     <StackPanel>                         <TextBlock Text="{Binding Title}" FontSize="14" FontWeight="Bold" />                         <TextBlock Text="{Binding UtcTime}" />                         <TextBlock Text="{Binding LocalTime}" />                         <TextBlock Text="{Binding DepthDesc}" />                     </StackPanel>                 </ToolTipService.ToolTip>             </Ellipse>         </DataTemplate>           <DataTemplate x:Key="VolcanoTemplate">             <Polygon Fill="Gold" Stroke="Black" StrokeThickness="1" Points="0,10 5,0 10,10"                      bing:MapLayer.Position="{Binding Location}"                      bing:MapLayer.PositionOrigin="Center"                      MouseLeftButtonUp="Volcano_MouseLeftButtonUp">                 <ToolTipService.ToolTip>                     <StackPanel>                         <TextBlock Text="{Binding Title}" FontSize="14" FontWeight="Bold" />                         <TextBlock Text="Click icon for more information..." />                     </StackPanel>                 </ToolTipService.ToolTip>             </Polygon>         </DataTemplate>     </UserControl.Resources>       <UserControl.DataContext>         <vm:EarthquakeViewModel AutoLoadData="True" />     </UserControl.DataContext>       <Grid x:Name="LayoutRoot">           <bing:Map x:Name="map" CredentialsProvider="--Your-Bing-Maps-Key--"                   Center="{Binding MapCenter, Mode=TwoWay}"                   ZoomLevel="{Binding ZoomLevel, Mode=TwoWay}">               <bing:MapItemsControl ItemsSource="{Binding Earthquakes}"                                   ItemTemplate="{StaticResource EarthquakeTemplate}" />               <bing:MapItemsControl ItemsSource="{Binding Volcanos}"                                   ItemTemplate="{StaticResource VolcanoTemplate}" />         </bing:Map>           <basic:TabControl x:Name="tabs" VerticalAlignment="Bottom" MaxHeight="25" Opacity="0.7">             <basic:TabItem Margin="90,0,-90,0" MouseLeftButtonUp="TabItem_MouseLeftButtonUp">                 <basic:TabItem.Header>                     <TextBlock x:Name="txtHeader" Text="Options"                                FontSize="13" FontWeight="Bold" />                 </basic:TabItem.Header>                   <StackPanel Orientation="Horizontal">                     <TextBlock Text="Earthquakes:" FontWeight="Bold" Margin="3" />                     <StackPanel Margin="3">                         <CheckBox Content=" &lt; 4.0"                                   IsChecked="{Binding ShowLt4, Mode=TwoWay}" />                         <CheckBox Content="4.0 - 4.9"                                   IsChecked="{Binding Show4s, Mode=TwoWay}" />                         <CheckBox Content="5.0 - 5.9"                                   IsChecked="{Binding Show5s, Mode=TwoWay}" />                     </StackPanel>                       <StackPanel Margin="10,3,3,3">                         <CheckBox Content="6.0 - 6.9"                                   IsChecked="{Binding Show6s, Mode=TwoWay}" />                         <CheckBox Content="7.0 - 7.9"                                   IsChecked="{Binding Show7s, Mode=TwoWay}" />                         <CheckBox Content="8.0 +"                                   IsChecked="{Binding ShowGe8, Mode=TwoWay}" />                     </StackPanel>                       <TextBlock Text="Other:" FontWeight="Bold" Margin="50,3,3,3" />                     <StackPanel Margin="3">                         <CheckBox Content="Volcanos"                                   IsChecked="{Binding ShowVolcanos, Mode=TwoWay}" />                     </StackPanel>                 </StackPanel>               </basic:TabItem>         </basic:TabControl>       </Grid> </UserControl> Notice that I added a VolcanoTemplate that uses a triangle-shaped Polygon to represent the Volcano locations, and I also added a second <bing:MapItemsControl /> tag to the map to bind to the Volcanos collection.  The TabControl found below the map houses the options panel that will present the user with several checkboxes so they can filter the different points based on type and other properties (i.e. Magnitude).  Initially, the TabItem is collapsed to reduce it's footprint, but the screen shot below shows the options panel expanded to reveal the available settings:     I have updated the Source Code and Live Demo to include these new features.   Happy Mapping!

    Read the article

  • Using delegates in C# (Part 2)

    - by rajbk
    Part 1 of this post can be read here. We are now about to see the different syntaxes for invoking a delegate and some c# syntactic sugar which allows you to code faster. We have the following console application. 1: public delegate double Operation(double x, double y); 2:  3: public class Program 4: { 5: [STAThread] 6: static void Main(string[] args) 7: { 8: Operation op1 = new Operation(Division); 9: double result = op1.Invoke(10, 5); 10: 11: Console.WriteLine(result); 12: Console.ReadLine(); 13: } 14: 15: static double Division(double x, double y) { 16: return x / y; 17: } 18: } Line 1 defines a delegate type called Operation with input parameters (double x, double y) and a return type of double. On Line 8, we create an instance of this delegate and set the target to be a static method called Division (Line 15) On Line 9, we invoke the delegate (one entry in the invocation list). The program outputs 5 when run. The language provides shortcuts for creating a delegate and invoking it (see line 9 and 11). Line 9 is a syntactical shortcut for creating an instance of the Delegate. The C# compiler will infer on its own what the delegate type is and produces intermediate language that creates a new instance of that delegate. Line 11 uses a a syntactical shortcut for invoking the delegate by removing the Invoke method. The compiler sees the line and generates intermediate language which invokes the delegate. When this code is compiled, the generated IL will look exactly like the IL of the compiled code above. 1: public delegate double Operation(double x, double y); 2:  3: public class Program 4: { 5: [STAThread] 6: static void Main(string[] args) 7: { 8: //shortcut constructor syntax 9: Operation op1 = Division; 10: //shortcut invoke syntax 11: double result = op1(10, 2); 12: 13: Console.WriteLine(result); 14: Console.ReadLine(); 15: } 16: 17: static double Division(double x, double y) { 18: return x / y; 19: } 20: } C# 2.0 introduced Anonymous Methods. Anonymous methods avoid the need to create a separate method that contains the same signature as the delegate type. Instead you write the method body in-line. There is an interesting fact about Anonymous methods and closures which won’t be covered here. Use your favorite search engine ;-)We rewrite our code to use anonymous methods (see line 9): 1: public delegate double Operation(double x, double y); 2:  3: public class Program 4: { 5: [STAThread] 6: static void Main(string[] args) 7: { 8: //Anonymous method 9: Operation op1 = delegate(double x, double y) { 10: return x / y; 11: }; 12: double result = op1(10, 2); 13: 14: Console.WriteLine(result); 15: Console.ReadLine(); 16: } 17: 18: static double Division(double x, double y) { 19: return x / y; 20: } 21: } We could rewrite our delegate to be of a generic type like so (see line 2 and line 9). You will see why soon. 1: //Generic delegate 2: public delegate T Operation<T>(T x, T y); 3:  4: public class Program 5: { 6: [STAThread] 7: static void Main(string[] args) 8: { 9: Operation<double> op1 = delegate(double x, double y) { 10: return x / y; 11: }; 12: double result = op1(10, 2); 13: 14: Console.WriteLine(result); 15: Console.ReadLine(); 16: } 17: 18: static double Division(double x, double y) { 19: return x / y; 20: } 21: } The .NET 3.5 framework introduced a whole set of predefined delegates for us including public delegate TResult Func<T1, T2, TResult>(T1 arg1, T2 arg2); Our code can be modified to use this delegate instead of the one we declared. Our delegate declaration has been removed and line 7 has been changed to use the Func delegate type. 1: public class Program 2: { 3: [STAThread] 4: static void Main(string[] args) 5: { 6: //Func is a delegate defined in the .NET 3.5 framework 7: Func<double, double, double> op1 = delegate (double x, double y) { 8: return x / y; 9: }; 10: double result = op1(10, 2); 11: 12: Console.WriteLine(result); 13: Console.ReadLine(); 14: } 15: 16: static double Division(double x, double y) { 17: return x / y; 18: } 19: } .NET 3.5 also introduced lambda expressions. A lambda expression is an anonymous function that can contain expressions and statements, and can be used to create delegates or expression tree types. We change our code to use lambda expressions. 1: public class Program 2: { 3: [STAThread] 4: static void Main(string[] args) 5: { 6: //lambda expression 7: Func<double, double, double> op1 = (x, y) => x / y; 8: double result = op1(10, 2); 9: 10: Console.WriteLine(result); 11: Console.ReadLine(); 12: } 13: 14: static double Division(double x, double y) { 15: return x / y; 16: } 17: } C# 3.0 introduced the keyword var (implicitly typed local variable) where the type of the variable is inferred based on the type of the associated initializer expression. We can rewrite our code to use var as shown below (line 7).  The implicitly typed local variable op1 is inferred to be a delegate of type Func<double, double, double> at compile time. 1: public class Program 2: { 3: [STAThread] 4: static void Main(string[] args) 5: { 6: //implicitly typed local variable 7: var op1 = (x, y) => x / y; 8: double result = op1(10, 2); 9: 10: Console.WriteLine(result); 11: Console.ReadLine(); 12: } 13: 14: static double Division(double x, double y) { 15: return x / y; 16: } 17: } You have seen how we can write code in fewer lines by using a combination of the Func delegate type, implicitly typed local variables and lambda expressions.

    Read the article

  • Android Client : Web service - what's the correct SOAP_ACTION, METHOD_NAME, NAMESPACE, URL I should

    - by Hubert
    if I want to use the following Web service (help.be is just an example, let's say it does exist): http://www.help.be/webservice/webservice_help.php (it's written in PHP=client's choice, not .NET) with the following WSDL : <?xml version="1.0" encoding="UTF-8"?> <definitions xmlns="http://schemas.xmlsoap.org/wsdl/" name="webservice_help" targetNamespace="http://www.help.be/webservice/webservice_help.php" xmlns:tns="http://www.help.be/webservice/webservice_help.php" xmlns:impl="http://www.help.be/webservice/webservice_help.php" xmlns:xsd1="http://www.help.be/webservice/webservice_help.php" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:wsdl="http://schemas.xmlsoap.org/wsdl/" xmlns:soap="http://schemas.xmlsoap.org/wsdl/soap/" xmlns:soapenc="http://schemas.xmlsoap.org/soap/encoding/"> <portType name="webservice_helpPortType"> <operation name="webservice_help"> <input message="tns:Webservice_helpRequest"/> </operation> <operation name="getLocation" parameterOrder="input"> <input message="tns:GetLocationRequest"/> <output message="tns:GetLocationResponse"/> </operation> <operation name="getStationDetail" parameterOrder="input"> <input message="tns:GetStationDetailRequest"/> <output message="tns:GetStationDetailResponse"/> </operation> <operation name="getStationList" parameterOrder="input"> <input message="tns:GetStationListRequest"/> <output message="tns:GetStationListResponse"/> </operation> </portType> <binding name="webservice_helpBinding" type="tns:webservice_helpPortType"> <soap:binding style="rpc" transport="http://schemas.xmlsoap.org/soap/http"/> <operation name="webservice_help"> <soap:operation soapAction="urn:webservice_help#webservice_helpServer#webservice_help"/> <input> <soap:body use="encoded" namespace="http://www.help.be/webservice/webservice_help.php" encodingStyle="http://schemas.xmlsoap.org/soap/encoding/"/> </input> </operation> <operation name="getLocation"> <soap:operation soapAction="urn:webservice_help#webservice_helpServer#getLocation"/> <input> <soap:body parts="input" use="encoded" namespace="http://www.help.be/webservice/webservice_help.php" encodingStyle="http://schemas.xmlsoap.org/soap/encoding/"/> </input> <output> <soap:body parts="return" use="encoded" namespace="http://www.help.be/webservice/webservice_help.php" encodingStyle="http://schemas.xmlsoap.org/soap/encoding/"/> </output> </operation> <operation name="getStationDetail"> <soap:operation soapAction="urn:webservice_help#webservice_helpServer#getStationDetail"/> <input> <soap:body parts="input" use="encoded" namespace="http://www.help.be/webservice/webservice_help.php" encodingStyle="http://schemas.xmlsoap.org/soap/encoding/"/> </input> <output> <soap:body parts="return" use="encoded" namespace="http://www.help.be/webservice/webservice_help.php" encodingStyle="http://schemas.xmlsoap.org/soap/encoding/"/> </output> </operation> <operation name="getStationList"> <soap:operation soapAction="urn:webservice_help#webservice_helpServer#getStationList"/> <input> <soap:body parts="input" use="encoded" namespace="http://www.help.be/webservice/webservice_help.php" encodingStyle="http://schemas.xmlsoap.org/soap/encoding/"/> </input> <output> <soap:body parts="return" use="encoded" namespace="http://www.help.be/webservice/webservice_help.php" encodingStyle="http://schemas.xmlsoap.org/soap/encoding/"/> </output> </operation> </binding> <message name="Webservice_helpRequest"/> <message name="GetLocationRequest"> <part name="input" type="xsd:array"/> </message> <message name="GetLocationResponse"> <part name="return" type="xsd:array"/> </message> <message name="GetStationDetailRequest"> <part name="input" type="xsd:array"/> </message> <message name="GetStationDetailResponse"> <part name="return" type="xsd:string"/> </message> <message name="GetStationListRequest"> <part name="input" type="xsd:array"/> </message> <message name="GetStationListResponse"> <part name="return" type="xsd:string"/> </message> <service name="webservice_helpService"> <port name="webservice_helpPort" binding="tns:webservice_helpBinding"> <soap:address location="http://www.help.be/webservice/webservice_help.php"/> </port> </service> </definitions> What is the correct SOAP_ACTION, METHOD_NAME, NAMESPACE, URL I should use below ? I've tried with this : public class Main extends Activity { /** Called when the activity is first created. */ private static final String SOAP_ACTION_GETLOCATION = "getLocation"; private static final String METHOD_NAME_GETLOCATION = "getLocation"; private static final String NAMESPACE = "http://www.help.be/webservice/"; private static final String URL = "http://www.help.be/webservice/webservice_help.php"; TextView tv; @SuppressWarnings("unchecked") @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); tv = (TextView)findViewById(R.id.TextView01); // -------------------------------------------------------------------------------------- SoapObject request_location = new SoapObject(NAMESPACE, METHOD_NAME_GETLOCATION); request_location.addProperty("login", "login"); // -> string required request_location.addProperty("password", "password"); // -> string required request_location.addProperty("serial", "serial"); // -> string required request_location.addProperty("language", "fr"); // -> string required (available « fr,nl,uk,de ») request_location.addProperty("keyword", "Braine"); // -> string required // -------------------------------------------------------------------------------------- SoapSerializationEnvelope soapEnvelope = new SoapSerializationEnvelope(SoapEnvelope.VER11); //soapEnvelope.dotNet = true; // don't forget it for .NET WebServices ! soapEnvelope.setOutputSoapObject(request_location); AndroidHttpTransport aht = new AndroidHttpTransport(URL); try { aht.call(SOAP_ACTION_GETLOCATION, soapEnvelope); // Get the SAOP Envelope back and then extract the body SoapObject resultsRequestSOAP = (SoapObject) soapEnvelope.bodyIn; Vector XXXX = (Vector) resultsRequestSOAP.getProperty("GetLocationResponse"); int vector_size = XXXX.size(); Log.i("Hub", "testat="+vector_size); tv.setText("OK"); } catch(Exception E) { tv.setText("ERROR:" + E.getClass().getName() + ": " + E.getMessage()); Log.i("Hub", "Exception E"); Log.i("Hub", "E.getClass().getName()="+E.getClass().getName()); Log.i("Hub", "E.getMessage()="+E.getMessage()); } // -------------------------------------------------------------------------------------- } } I'm not sure of the SOAP_ACTION, METHOD_NAME, NAMESPACE, URL I have to use? because soapAction is pointing to a URN instead of a traditional URL and it's PHP and not .NET ... also, I'm not sure if I have to use request_location.addProperty("login", "login"); of request_location.addAttribute("login", "login"); ? = <message name="GetLocationRequest"> <part name="input" type="xsd:array"/> What would you say ? Txs for your help. H. EDIT : Here is some code working in PHP - I simply want to have the same but in Android/JAVA : <?php ini_set("soap.wsdl_cache_enabled", "0"); // disabling WSDL cache $request['login'] = 'login'; $request['password'] = 'password'; $request['serial'] = 'serial'; $request['language'] = 'fr'; $client= new SoapClient("http://www.test.be/webservice/webservice_test.wsdl"); print_r( $client->__getFunctions()); ?><hr><h1>getLocation</h1> <h2>Input:</h2> <? $request['keyword'] = 'Bruxelles'; print_r($request); ?><h2>Result</h2><? $result = $client->getLocation($request); print_r($result); ?>

    Read the article

  • Using Unity – Part 6

    - by nmarun
    This is the last of the ‘Unity’ series and I’ll be talking about generics here. If you’ve been following the previous articles, you must have noticed that I’m just adding more and more ‘Product’ classes to the project. I’ll change that trend in this blog where I’ll be adding an ICaller interface and a Caller class. 1: public interface ICaller<T> where T : IProduct 2: { 3: string CallMethod<T>(string typeName); 4: } 5:  6: public class Caller<T> : ICaller<T> where T:IProduct 7: { 8: public string CallMethod<T>(string typeName) 9: { 10: //... 11: } 12: } We’ll fill-in the implementation of the CallMethod in a few, but first, here’s what we’re going to do: create an instance of the Caller class pass it the IProduct as a generic parameter in the CallMethod method, we’ll use Unity to dynamically create an instance of IProduct implemented object I need to add the config information for ICaller and Caller types. 1: <typeAlias alias="ICaller`1" type="ProductModel.ICaller`1, ProductModel" /> 2: <typeAlias alias="Caller`1" type="ProductModel.Caller`1, ProductModel" /> The .NET Framework’s convention to express generic types is ICaller`1, where the digit following the "`" matches the number of types contained in the generic type. So a generic type that contains 4 types contained in the generic type would be declared as: 1: <typeAlias alias="Caller`4" type="ProductModel.Caller`4, ProductModel" /> On my .aspx page, I have the following UI design: 1: <asp:RadioButton ID="LegacyProduct" Text="Product" runat="server" GroupName="ProductWeb" 2: AutoPostBack="true" OnCheckedChanged="RadioButton_CheckedChanged" /> 3: <br /> 4: <asp:RadioButton ID="NewProduct" Text="Product 2" runat="server" GroupName="ProductWeb" 5: AutoPostBack="true" OnCheckedChanged="RadioButton_CheckedChanged" /> 6: <br /> 7: <asp:RadioButton ID="ComplexProduct" Text="Product 3" runat="server" GroupName="ProductWeb" 8: AutoPostBack="true" OnCheckedChanged="RadioButton_CheckedChanged" /> 9: <br /> 10: <asp:RadioButton ID="ArrayConstructor" Text="Product 4" runat="server" GroupName="ProductWeb" 11: AutoPostBack="true" OnCheckedChanged="RadioButton_CheckedChanged" /> Things to note here are that all these radio buttons belong to the same GroupName => only one of these four can be clicked. Next, all four controls postback to the same ‘OnCheckedChanged’ event and lastly the ID’s point to named types of IProduct (already added to the web.config file). 1: <type type="IProduct" mapTo="Product" name="LegacyProduct" /> 2:  3: <type type="IProduct" mapTo="Product2" name="NewProduct" /> 4:  5: <type type="IProduct" mapTo="Product3" name="ComplexProduct"> 6: ... 7: </type> 8:  9: <type type="IProduct" mapTo="Product4" name="ArrayConstructor"> 10: ... 11: </type> In my calling code, I see which radio button was clicked, pass that as an argument to the CallMethod method. 1: protected void RadioButton_CheckedChanged(object sender, EventArgs e) 2: { 3: string typeName = ((RadioButton)sender).ID; 4: ICaller<IProduct> caller = unityContainer.Resolve<ICaller<IProduct>>(); 5: productDetailsLabel.Text = caller.CallMethod<IProduct>(typeName); 6: } What’s basically happening here is that the ID of the control gets passed on to the typeName which will be one of “LegacyProduct”, “NewProduct”, “ComplexProduct” or “ArrayConstructor”. I then create an instance of an ICaller and pass the typeName to it. Now, we’ll fill in the blank for the CallMethod method (sorry for the naming guys). 1: public string CallMethod<T>(string typeName) 2: { 3: IUnityContainer unityContainer = HttpContext.Current.Application["UnityContainer"] as IUnityContainer; 4: T productInstance = unityContainer.Resolve<T>(typeName); 5: return ((IProduct)productInstance).WriteProductDetails(); 6: } This is where I’ll resolve the IProduct by passing the type name and calling the WriteProductDetails() method. With all things in place, when I run the application and choose different radio buttons, the output should look something like below:          Basically this is how generics come to play in Unity. Please see the code I’ve used for this here. This marks the end of the ‘Unity’ series. I’ll definitely post any updates that I find, but for now I don’t have anything planned.

    Read the article

  • Mocking the Unmockable: Using Microsoft Moles with Gallio

    - by Thomas Weller
    Usual opensource mocking frameworks (like e.g. Moq or Rhino.Mocks) can mock only interfaces and virtual methods. In contrary to that, Microsoft’s Moles framework can ‘mock’ virtually anything, in that it uses runtime instrumentation to inject callbacks in the method MSIL bodies of the moled methods. Therefore, it is possible to detour any .NET method, including non-virtual/static methods in sealed types. This can be extremely helpful when dealing e.g. with code that calls into the .NET framework, some third-party or legacy stuff etc… Some useful collected resources (links to website, documentation material and some videos) can be found in my toolbox on Delicious under this link: http://delicious.com/thomasweller/toolbox+moles A Gallio extension for Moles Originally, Moles is a part of Microsoft’s Pex framework and thus integrates best with Visual Studio Unit Tests (MSTest). However, the Moles sample download contains some additional assemblies to also support other unit test frameworks. They provide a Moled attribute to ease the usage of mole types with the respective framework (there are extensions for NUnit, xUnit.net and MbUnit v2 included with the samples). As there is no such extension for the Gallio platform, I did the few required lines myself – the resulting Gallio.Moles.dll is included with the sample download. With this little assembly in place, it is possible to use Moles with Gallio like that: [Test, Moled] public void SomeTest() {     ... What you can do with it Moles can be very helpful, if you need to ‘mock’ something other than a virtual or interface-implementing method. This might be the case when dealing with some third-party component, legacy code, or if you want to ‘mock’ the .NET framework itself. Generally, you need to announce each moled type that you want to use in a test with the MoledType attribute on assembly level. For example: [assembly: MoledType(typeof(System.IO.File))] Below are some typical use cases for Moles. For a more detailed overview (incl. naming conventions and an instruction on how to create the required moles assemblies), please refer to the reference material above.  Detouring the .NET framework Imagine that you want to test a method similar to the one below, which internally calls some framework method:   public void ReadFileContent(string fileName) {     this.FileContent = System.IO.File.ReadAllText(fileName); } Using a mole, you would replace the call to the File.ReadAllText(string) method with a runtime delegate like so: [Test, Moled] [Description("This 'mocks' the System.IO.File class with a custom delegate.")] public void ReadFileContentWithMoles() {     // arrange ('mock' the FileSystem with a delegate)     System.IO.Moles.MFile.ReadAllTextString = (fname => fname == FileName ? FileContent : "WrongFileName");       // act     var testTarget = new TestTarget.TestTarget();     testTarget.ReadFileContent(FileName);       // assert     Assert.AreEqual(FileContent, testTarget.FileContent); } Detouring static methods and/or classes A static method like the below… public static string StaticMethod(int x, int y) {     return string.Format("{0}{1}", x, y); } … can be ‘mocked’ with the following: [Test, Moled] public void StaticMethodWithMoles() {     MStaticClass.StaticMethodInt32Int32 = ((x, y) => "uups");       var result = StaticClass.StaticMethod(1, 2);       Assert.AreEqual("uups", result); } Detouring constructors You can do this delegate thing even with a class’ constructor. The syntax for this is not all  too intuitive, because you have to setup the internal state of the mole, but generally it works like a charm. For example, to replace this c’tor… public class ClassWithCtor {     public int Value { get; private set; }       public ClassWithCtor(int someValue)     {         this.Value = someValue;     } } … you would do the following: [Test, Moled] public void ConstructorTestWithMoles() {     MClassWithCtor.ConstructorInt32 =            ((@class, @value) => new MClassWithCtor(@class) {ValueGet = () => 99});       var classWithCtor = new ClassWithCtor(3);       Assert.AreEqual(99, classWithCtor.Value); } Detouring abstract base classes You can also use this approach to ‘mock’ abstract base classes of a class that you call in your test. Assumed that you have something like that: public abstract class AbstractBaseClass {     public virtual string SaySomething()     {         return "Hello from base.";     } }      public class ChildClass : AbstractBaseClass {     public override string SaySomething()     {         return string.Format(             "Hello from child. Base says: '{0}'",             base.SaySomething());     } } Then you would set up the child’s underlying base class like this: [Test, Moled] public void AbstractBaseClassTestWithMoles() {     ChildClass child = new ChildClass();     new MAbstractBaseClass(child)         {                 SaySomething = () => "Leave me alone!"         }         .InstanceBehavior = MoleBehaviors.Fallthrough;       var hello = child.SaySomething();       Assert.AreEqual("Hello from child. Base says: 'Leave me alone!'", hello); } Setting the moles behavior to a value of  MoleBehaviors.Fallthrough causes the ‘original’ method to be called if a respective delegate is not provided explicitly – here it causes the ChildClass’ override of the SaySomething() method to be called. There are some more possible scenarios, where the Moles framework could be of much help (e.g. it’s also possible to detour interface implementations like IEnumerable<T> and such…). One other possibility that comes to my mind (because I’m currently dealing with that), is to replace calls from repository classes to the ADO.NET Entity Framework O/R mapper with delegates to isolate the repository classes from the underlying database, which otherwise would not be possible… Usage Since Moles relies on runtime instrumentation, mole types must be run under the Pex profiler. This only works from inside Visual Studio if you write your tests with MSTest (Visual Studio Unit Test). While other unit test frameworks generally can be used with Moles, they require the respective tests to be run via command line, executed through the moles.runner.exe tool. A typical test execution would be similar to this: moles.runner.exe <mytests.dll> /runner:<myframework.console.exe> /args:/<myargs> So, the moled test can be run through tools like NCover or a scripting tool like MSBuild (which makes them easy to run in a Continuous Integration environment), but they are somewhat unhandy to run in the usual TDD workflow (which I described in some detail here). To make this a bit more fluent, I wrote a ReSharper live template to generate the respective command line for the test (it is also included in the sample download – moled_cmd.xml). - This is just a quick-and-dirty ‘solution’. Maybe it makes sense to write an extra Gallio adapter plugin (similar to the many others that are already provided) and include it with the Gallio download package, if  there’s sufficient demand for it. As of now, the only way to run tests with the Moles framework from within Visual Studio is by using them with MSTest. From the command line, anything with a managed console runner can be used (provided that the appropriate extension is in place)… A typical Gallio/Moles command line (as generated by the mentioned R#-template) looks like that: "%ProgramFiles%\Microsoft Moles\bin\moles.runner.exe" /runner:"%ProgramFiles%\Gallio\bin\Gallio.Echo.exe" "Gallio.Moles.Demo.dll" /args:/r:IsolatedAppDomain /args:/filter:"ExactType:TestFixture and Member:ReadFileContentWithMoles" -- Note: When using the command line with Echo (Gallio’s console runner), be sure to always include the IsolatedAppDomain option, otherwise the tests won’t use the instrumentation callbacks! -- License issues As I already said, the free mocking frameworks can mock only interfaces and virtual methods. if you want to mock other things, you need the Typemock Isolator tool for that, which comes with license costs (Although these ‘costs’ are ridiculously low compared to the value that such a tool can bring to a software project, spending money often is a considerable gateway hurdle in real life...).  The Moles framework also is not totally free, but comes with the same license conditions as the (closely related) Pex framework: It is free for academic/non-commercial use only, to use it in a ‘real’ software project requires an MSDN Subscription (from VS2010pro on). The demo solution The sample solution (VS 2008) can be downloaded from here. It contains the Gallio.Moles.dll which provides the here described Moled attribute, the above mentioned R#-template (moled_cmd.xml) and a test fixture containing the above described use case scenarios. To run it, you need the Gallio framework (download) and Microsoft Moles (download) being installed in the default locations. Happy testing…

    Read the article

  • Easier ASP.NET MVC Routing

    - by Steve Wilkes
    I've recently refactored the way Routes are declared in an ASP.NET MVC application I'm working on, and I wanted to share part of the system I came up with; a really easy way to declare and keep track of ASP.NET MVC Routes, which then allows you to find the name of the Route which has been selected for the current request. Traditional MVC Route Declaration Traditionally, ASP.NET MVC Routes are added to the application's RouteCollection using overloads of the RouteCollection.MapRoute() method; for example, this is the standard way the default Route which matches /controller/action URLs is created: routes.MapRoute(     "Default",     "{controller}/{action}/{id}",     new { controller = "Home", action = "Index", id = UrlParameter.Optional }); The first argument declares that this Route is to be named 'Default', the second specifies the Route's URL pattern, and the third contains the URL pattern segments' default values. To then write a link to a URL which matches the default Route in a View, you can use the HtmlHelper.RouteLink() method, like this: @ this.Html.RouteLink("Default", new { controller = "Orders", action = "Index" }) ...that substitutes 'Orders' into the {controller} segment of the default Route's URL pattern, and 'Index' into the {action} segment. The {Id} segment was declared optional and isn't specified here. That's about the most basic thing you can do with MVC routing, and I already have reservations: I've duplicated the magic string "Default" between the Route declaration and the use of RouteLink(). This isn't likely to cause a problem for the default Route, but once you get to dozens of Routes the duplication is a pain. There's no easy way to get from the RouteLink() method call to the declaration of the Route itself, so getting the names of the Route's URL parameters correct requires some effort. The call to MapRoute() is quite verbose; with dozens of Routes this gets pretty ugly. If at some point during a request I want to find out the name of the Route has been matched.... and I can't. To get around these issues, I wanted to achieve the following: Make declaring a Route very easy, using as little code as possible. Introduce a direct link between where a Route is declared, where the Route is defined and where the Route's name is used, so I can use Visual Studio's Go To Definition to get from a call to RouteLink() to the declaration of the Route I'm using, making it easier to make sure I use the correct URL parameters. Create a way to access the currently-selected Route's name during the execution of a request. My first step was to come up with a quick and easy syntax for declaring Routes. 1 . An Easy Route Declaration Syntax I figured the easiest way of declaring a route was to put all the information in a single string with a special syntax. For example, the default MVC route would be declared like this: "{controller:Home}/{action:Index}/{Id}*" This contains the same information as the regular way of defining a Route, but is far more compact: The default values for each URL segment are specified in a colon-separated section after the segment name The {Id} segment is declared as optional simply by placing a * after it That's the default route - a pretty simple example - so how about this? routes.MapRoute(     "CustomerOrderList",     "Orders/{customerRef}/{pageNo}",     new { controller = "Orders", action = "List", pageNo = UrlParameter.Optional },     new { customerRef = "^[a-zA-Z0-9]+$", pageNo = "^[0-9]+$" }); This maps to the List action on the Orders controller URLs which: Start with the string Orders/ Then have a {customerRef} set of characters and numbers Then optionally a numeric {pageNo}. And again, it’s quite verbose. Here's my alternative: "Orders/{customerRef:^[a-zA-Z0-9]+$}/{pageNo:^[0-9]+$}*->Orders/List" Quite a bit more brief, and again, containing the same information as the regular way of declaring Routes: Regular expression constraints are declared after the colon separator, the same as default values The target controller and action are specified after the -> The {pageNo} is defined as optional by placing a * after it With an appropriate parser that gave me a nice, compact and clear way to declare routes. Next I wanted to have a single place where Routes were declared and accessed. 2. A Central Place to Declare and Access Routes I wanted all my Routes declared in one, dedicated place, which I would also use for Route names when calling RouteLink(). With this in mind I made a single class named Routes with a series of public, constant fields, each one relating to a particular Route. With this done, I figured a good place to actually declare each Route was in an attribute on the field defining the Route’s name; the attribute would parse the Route definition string and make the resulting Route object available as a property. I then made the Routes class examine its own fields during its static setup, and cache all the attribute-created Route objects in an internal Dictionary. Finally I made Routes use that cache to register the Routes when requested, and to access them later when required. So the Routes class declares its named Routes like this: public static class Routes{     [RouteDefinition("Orders/{customerName}->Orders/Index")]     public const string OrdersCustomerIndex = "OrdersCustomerIndex";     [RouteDefinition("Orders/{customerName}/{orderId:^([0-9]+)$}->Orders/Details")]     public const string OrdersDetails = "OrdersDetails";     [RouteDefinition("{controller:Home}*/{action:Index}*")]     public const string Default = "Default"; } ...which are then used like this: @ this.Html.RouteLink(Routes.Default, new { controller = "Orders", action = "Index" }) Now that using Go To Definition on the Routes.Default constant takes me to where the Route is actually defined, it's nice and easy to quickly check on the parameter names when using RouteLink(). Finally, I wanted to be able to access the name of the current Route during a request. 3. Recovering the Route Name The RouteDefinitionAttribute creates a NamedRoute class; a simple derivative of Route, but with a Name property. When the Routes class examines its fields and caches all the defined Routes, it has access to the name of the Route through the name of the field against which it is defined. It was therefore a pretty easy matter to have Routes give NamedRoute its name when it creates its cache of Routes. This means that the Route which is found in RequestContext.RouteData.Route is now a NamedRoute, and I can recover the Route's name during a request. For visibility, I made NamedRoute.ToString() return the Route name and URL pattern, like this: The screenshot is from an example project I’ve made on bitbucket; it contains all the named route classes and an MVC 3 application which demonstrates their use. I’ve found this way of defining and using Routes much tidier than the default MVC system, and you find it useful too

    Read the article

  • Adding RSS to tags in Orchard

    - by Bertrand Le Roy
    A year ago, I wrote a scary post about RSS in Orchard. RSS was one of the first features we implemented in our CMS, and it has stood the test of time rather well, but the post was explaining things at a level that was probably too abstract whereas my readers were expecting something a little more practical. Well, this post is going to correct this by showing how I built a module that adds RSS feeds for each tag on the site. Hopefully it will show that it's not very complicated in practice, and also that the infrastructure is pretty well thought out. In order to provide RSS, we need to do two things: generate the XML for the feed, and inject the address of that feed into the existing tag listing page, in order to make the feed discoverable. Let's start with the discoverability part. One might be tempted to replace the controller or the view that are responsible for the listing of the items under a tag. Fortunately, there is no need to do any of that, and we can be a lot less obtrusive. Instead, we can implement a filter: public class TagRssFilter : FilterProvider, IResultFilter .csharpcode, .csharpcode pre { font-size: small; color: black; font-family: consolas, "Courier New", courier, monospace; background-color: #ffffff; /*white-space: pre;*/ } .csharpcode pre { margin: 0em; } .csharpcode .rem { color: #008000; } .csharpcode .kwrd { color: #0000ff; } .csharpcode .str { color: #006080; } .csharpcode .op { color: #0000c0; } .csharpcode .preproc { color: #cc6633; } .csharpcode .asp { background-color: #ffff00; } .csharpcode .html { color: #800000; } .csharpcode .attr { color: #ff0000; } .csharpcode .alt { background-color: #f4f4f4; width: 100%; margin: 0em; } .csharpcode .lnum { color: #606060; } On this filter, we can implement the OnResultExecuting method and simply check whether the current request is targeting the list of items under a tag. If that is the case, we can just register our new feed: public void OnResultExecuting(ResultExecutingContext filterContext) { var routeValues = filterContext.RouteData.Values; if (routeValues["area"] as string == "Orchard.Tags" && routeValues["controller"] as string == "Home" && routeValues["action"] as string == "Search") { var tag = routeValues["tagName"] as string; if (! string.IsNullOrWhiteSpace(tag)) { var workContext = _wca.GetContext(); _feedManager.Register( workContext.CurrentSite + " – " + tag, "rss", new RouteValueDictionary { { "tag", tag } } ); } } } The registration of the new feed is just specifying the title of the feed, its format (RSS) and the parameters that it will need (the tag). _wca and _feedManager are just instances of IWorkContextAccessor and IFeedManager that Orchard injected for us. That is all that's needed to get the following tag to be added to the head of our page, without touching an existing controller or view: <link rel="alternate" type="application/rss+xml" title="VuLu - Science" href="/rss?tag=Science"/> Nifty. Of course, if we navigate to the URL of that feed, we'll get a 404. This is because no implementation of IFeedQueryProvider knows about the tag parameter yet. Let's build one that does: public class TagFeedQuery : IFeedQueryProvider, IFeedQuery IFeedQueryProvider has one method, Match, that we can implement to take over any feed request that has a tag parameter: public FeedQueryMatch Match(FeedContext context) { var tagName = context.ValueProvider.GetValue("tag"); if (tagName == null) return null; return new FeedQueryMatch { FeedQuery = this, Priority = -5 }; } This is just saying that if there is a tag parameter, we will handle it. All that remains to be done is the actual building of the feed now that we have accepted to handle it. This is done by implementing the Execute method of the IFeedQuery interface: public void Execute(FeedContext context) { var tagValue = context.ValueProvider.GetValue("tag"); if (tagValue == null) return; var tagName = (string)tagValue.ConvertTo(typeof (string)); var tag = _tagService.GetTagByName(tagName); if (tag == null) return; var site = _services.WorkContext.CurrentSite; var link = new XElement("link"); context.Response.Element.SetElementValue("title", site.SiteName + " - " + tagName); context.Response.Element.Add(link); context.Response.Element.SetElementValue("description", site.SiteName + " - " + tagName); context.Response.Contextualize(requestContext => link.Add(GetTagUrl(tagName, requestContext))); var items = _tagService.GetTaggedContentItems(tag.Id, 0, 20); foreach (var item in items) { context.Builder.AddItem(context, item.ContentItem); } } This code is resolving the tag content item from its name and then gets content items tagged with it, using the tag services provided by the Orchard.Tags module. Then we add those items to the feed. And that is it. To summarize, we handled the request unobtrusively in order to inject the feed's link, then handled requests for feeds with a tag parameter and generated the list of items for that tag. It remains fairly simple and still it is able to handle arbitrary content types. That makes me quite happy about our little piece of over-engineered code from last year. The full code for this can be found in the Vandelay.TagCloud module: http://orchardproject.net/gallery/List/Modules/ Orchard.Module.Vandelay.TagCloud/1.2

    Read the article

  • C#/.NET Little Wonders: Using &lsquo;default&rsquo; to Get Default Values

    - by James Michael Hare
    Once again, in this series of posts I look at the parts of the .NET Framework that may seem trivial, but can help improve your code by making it easier to write and maintain. The index of all my past little wonders posts can be found here. Today’s little wonder is another of those small items that can help a lot in certain situations, especially when writing generics.  In particular, it is useful in determining what the default value of a given type would be. The Problem: what’s the default value for a generic type? There comes a time when you’re writing generic code where you may want to set an item of a given generic type.  Seems simple enough, right?  We’ll let’s see! Let’s say we want to query a Dictionary<TKey, TValue> for a given key and get back the value, but if the key doesn’t exist, we’d like a default value instead of throwing an exception. So, for example, we might have a the following dictionary defined: 1: var lookup = new Dictionary<int, string> 2: { 3: { 1, "Apple" }, 4: { 2, "Orange" }, 5: { 3, "Banana" }, 6: { 4, "Pear" }, 7: { 9, "Peach" } 8: }; And using those definitions, perhaps we want to do something like this: 1: // assume a default 2: string value = "Unknown"; 3:  4: // if the item exists in dictionary, get its value 5: if (lookup.ContainsKey(5)) 6: { 7: value = lookup[5]; 8: } But that’s inefficient, because then we’re double-hashing (once for ContainsKey() and once for the indexer).  Well, to avoid the double-hashing, we could use TryGetValue() instead: 1: string value; 2:  3: // if key exists, value will be put in value, if not default it 4: if (!lookup.TryGetValue(5, out value)) 5: { 6: value = "Unknown"; 7: } But the “flow” of using of TryGetValue() can get clunky at times when you just want to assign either the value or a default to a variable.  Essentially it’s 3-ish lines (depending on formatting) for 1 assignment.  So perhaps instead we’d like to write an extension method to support a cleaner interface that will return a default if the item isn’t found: 1: public static class DictionaryExtensions 2: { 3: public static TValue GetValueOrDefault<TKey, TValue>(this Dictionary<TKey, TValue> dict, 4: TKey key, TValue defaultIfNotFound) 5: { 6: TValue value; 7:  8: // value will be the result or the default for TValue 9: if (!dict.TryGetValue(key, out value)) 10: { 11: value = defaultIfNotFound; 12: } 13:  14: return value; 15: } 16: } 17:  So this creates an extension method on Dictionary<TKey, TValue> that will attempt to get a value using the given key, and will return the defaultIfNotFound as a stand-in if the key does not exist. This code compiles, fine, but what if we would like to go one step further and allow them to specify a default if not found, or accept the default for the type?  Obviously, we could overload the method to take the default or not, but that would be duplicated code and a bit heavy for just specifying a default.  It seems reasonable that we could set the not found value to be either the default for the type, or the specified value. So what if we defaulted the type to null? 1: public static TValue GetValueOrDefault<TKey, TValue>(this Dictionary<TKey, TValue> dict, 2: TKey key, TValue defaultIfNotFound = null) // ... No, this won’t work, because only reference types (and Nullable<T> wrapped types due to syntactical sugar) can be assigned to null.  So what about a calling parameterless constructor? 1: public static TValue GetValueOrDefault<TKey, TValue>(this Dictionary<TKey, TValue> dict, 2: TKey key, TValue defaultIfNotFound = new TValue()) // ... No, this won’t work either for several reasons.  First, we’d expect a reference type to return null, not an “empty” instance.  Secondly, not all reference types have a parameter-less constructor (string for example does not).  And finally, a constructor cannot be determined at compile-time, while default values can. The Solution: default(T) – returns the default value for type T Many of us know the default keyword for its uses in switch statements as the default case.  But it has another use as well: it can return us the default value for a given type.  And since it generates the same defaults that default field initialization uses, it can be determined at compile-time as well. For example: 1: var x = default(int); // x is 0 2:  3: var y = default(bool); // y is false 4:  5: var z = default(string); // z is null 6:  7: var t = default(TimeSpan); // t is a TimeSpan with Ticks == 0 8:  9: var n = default(int?); // n is a Nullable<int> with HasValue == false Notice that for numeric types the default is 0, and for reference types the default is null.  In addition, for struct types, the value is a default-constructed struct – which simply means a struct where every field has their default value (hence 0 Ticks for TimeSpan, etc.). So using this, we could modify our code to this: 1: public static class DictionaryExtensions 2: { 3: public static TValue GetValueOrDefault<TKey, TValue>(this Dictionary<TKey, TValue> dict, 4: TKey key, TValue defaultIfNotFound = default(TValue)) 5: { 6: TValue value; 7:  8: // value will be the result or the default for TValue 9: if (!dict.TryGetValue(key, out value)) 10: { 11: value = defaultIfNotFound; 12: } 13:  14: return value; 15: } 16: } Now, if defaultIfNotFound is unspecified, it will use default(TValue) which will be the default value for whatever value type the dictionary holds.  So let’s consider how we could use this: 1: lookup.GetValueOrDefault(1); // returns “Apple” 2:  3: lookup.GetValueOrDefault(5); // returns null 4:  5: lookup.GetValueOrDefault(5, “Unknown”); // returns “Unknown” 6:  Again, do not confuse a parameter-less constructor with the default value for a type.  Remember that the default value for any type is the compile-time default for any instance of that type (0 for numeric, false for bool, null for reference types, and struct will all default fields for struct).  Consider the difference: 1: // both zero 2: int i1 = default(int); 3: int i2 = new int(); 4:  5: // both “zeroed” structs 6: var dt1 = default(DateTime); 7: var dt2 = new DateTime(); 8:  9: // sb1 is null, sb2 is an “empty” string builder 10: var sb1 = default(StringBuilder()); 11: var sb2 = new StringBuilder(); So in the above code, notice that the value types all resolve the same whether using default or parameter-less construction.  This is because a value type is never null (even Nullable<T> wrapped types are never “null” in a reference sense), they will just by default contain fields with all default values. However, for reference types, the default is null and not a constructed instance.  Also it should be noted that not all classes have parameter-less constructors (string, for instance, doesn’t have one – and doesn’t need one). Summary Whenever you need to get the default value for a type, especially a generic type, consider using the default keyword.  This handy word will give you the default value for the given type at compile-time, which can then be used for initialization, optional parameters, etc. Technorati Tags: C#,CSharp,.NET,Little Wonders,default

    Read the article

  • Deterministic/Consistent Unique Masking

    - by Dinesh Rajasekharan-Oracle
    One of the key requirements while masking data in large databases or multi database environment is to consistently mask some columns, i.e. for a given input the output should always be the same. At the same time the masked output should not be predictable. Deterministic masking also eliminates the need to spend enormous amount of time spent in identifying data relationships, i.e. parent and child relationships among columns defined in the application tables. In this blog post I will explain different ways of consistently masking the data across databases using Oracle Data Masking and Subsetting The readers of post should have minimal knowledge on Oracle Enterprise Manager 12c, Application Data Modeling, Data Masking concepts. For more information on these concepts, please refer to Oracle Data Masking and Subsetting document Oracle Data Masking and Subsetting 12c provides four methods using which users can consistently yet irreversibly mask their inputs. 1. Substitute 2. SQL Expression 3. Encrypt 4. User Defined Function SUBSTITUTE The substitute masking format replaces the original value with a value from a pre-created database table. As the method uses a hash based algorithm in the back end the mappings are consistent. For example consider DEPARTMENT_ID in EMPLOYEES table is replaced with FAKE_DEPARTMENT_ID from FAKE_TABLE. The substitute masking transformation that all occurrences of DEPARTMENT_ID say ‘101’ will be replaced with ‘502’ provided same substitution table and column is used , i.e. FAKE_TABLE.FAKE_DEPARTMENT_ID. The following screen shot shows the usage of the Substitute masking format with in a masking definition: Note that the uniqueness of the masked value depends on the number of columns being used in the substitution table i.e. if the original table contains 50000 unique values, then for the masked output to be unique and deterministic the substitution column should also contain 50000 unique values without which only consistency is maintained but not uniqueness. SQL EXPRESSION SQL Expression replaces an existing value with the output of a specified SQL Expression. For example while masking an EMPLOYEES table the EMAIL_ID of an employee has to be in the format EMPLOYEE’s [email protected] while FIRST_NAME and LAST_NAME are the actual column names of the EMPLOYEES table then the corresponding SQL Expression will look like %FIRST_NAME%||’.’||%LAST_NAME%||’@COMPANY.COM’. The advantage of this technique is that if you are masking FIRST_NAME and LAST_NAME of the EMPLOYEES table than the corresponding EMAIL ID will be replaced accordingly by the masking scripts. One of the interesting aspect’s of a SQL Expressions is that you can use sub SQL expressions, which means that you can write a nested SQL and use it as SQL Expression to address a complex masking business use cases. SQL Expression can also be used to consistently replace value with hashed value using Oracle’s PL/SQL function ORA_HASH. The following SQL Expression will help in the previous example for replacing the DEPARTMENT_IDs with a hashed number ORA_HASH (%DEPARTMENT_ID%, 1000) The following screen shot shows the usage of encrypt masking format with in the masking definition: ORA_HASH takes three arguments: 1. Expression which can be of any data type except LONG, LOB, User Defined Type [nested table type is allowed]. In the above example I used the Original value as expression. 2. Number of hash buckets which can be number between 0 and 4294967295. The default value is 4294967295. You can also co-relate the number of hash buckets to a range of numbers. In the above example above the bucket value is specified as 1000, so the end result will be a hashed number in between 0 and 1000. 3. Seed, can be any number which decides the consistency, i.e. for a given seed value the output will always be same. The default seed is 0. In the above SQL Expression a seed in not specified, so it to 0. If you have to use a non default seed then the function will look like. ORA_HASH (%DEPARTMENT_ID%, 1000, 1234 The uniqueness depends on the input and the number of hash buckets used. However as ORA_HASH uses a 32 bit algorithm, considering birthday paradox or pigeonhole principle there is a 0.5 probability of collision after 232-1 unique values. ENCRYPT Encrypt masking format uses a blend of 3DES encryption algorithm, hashing, and regular expression to produce a deterministic and unique masked output. The format of the masked output corresponds to the specified regular expression. As this technique uses a key [string] to encrypt the data, the same string can be used to decrypt the data. The key also acts as seed to maintain consistent outputs for a given input. The following screen shot shows the usage of encrypt masking format with in the masking definition: Regular Expressions may look complex for the first time users but you will soon realize that it’s a simple language. There are many resources in internet, oracle documentation, oracle learning library, my oracle support on writing a Regular Expressions, out of all the following My Oracle Support document helped me to get started with Regular Expressions: Oracle SQL Support for Regular Expressions[Video](Doc ID 1369668.1) USER DEFINED FUNCTION [UDF] User Defined Function or UDF provides flexibility for the users to code their own masking logic in PL/SQL, which can be called from masking Defintion. The standard format of an UDF in Oracle Data Masking and Subsetting is: Function udf_func (rowid varchar2, column_name varchar2, original_value varchar2) returns varchar2; Where • rowid is the row identifier of the column that needs to be masked • column_name is the name of the column that needs to be masked • original_value is the column value that needs to be masked You can achieve deterministic masking by using Oracle’s built in hash functions like, ORA_HASH, DBMS_CRYPTO.MD4, DBMS_CRYPTO.MD5, DBMS_UTILITY. GET_HASH_VALUE.Please refers to the Oracle Database Documentation for more information on the Oracle Hash functions. For example the following masking UDF generate deterministic unique hexadecimal values for a given string input: CREATE OR REPLACE FUNCTION RD_DUX (rid varchar2, column_name varchar2, orig_val VARCHAR2) RETURN VARCHAR2 DETERMINISTIC PARALLEL_ENABLE IS stext varchar2 (26); no_of_characters number(2); BEGIN no_of_characters:=6; stext:=substr(RAWTOHEX(DBMS_CRYPTO.HASH(UTL_RAW.CAST_TO_RAW(text),1)),0,no_of_characters); RETURN stext; END; The uniqueness depends on the input and length of the string and number of bits used by hash algorithm. In the above function MD4 hash is used [denoted by argument 1 in the DBMS_CRYPTO.HASH function which is a 128 bit algorithm which produces 2^128-1 unique hashed values , however this is limited by the length of the input string which is 6, so only 6^6 unique values will be generated. Also do not forget about the birthday paradox/pigeonhole principle mentioned earlier in this post. An another example is to consistently replace characters or numbers preserving the length and special characters as shown below: CREATE OR REPLACE FUNCTION RD_DUS(rid varchar2,column_name varchar2,orig_val VARCHAR2) RETURN VARCHAR2 DETERMINISTIC PARALLEL_ENABLE IS stext varchar2(26); BEGIN DBMS_RANDOM.SEED(orig_val); stext:=TRANSLATE(orig_val,'ABCDEFGHILKLMNOPQRSTUVWXYZ',DBMS_RANDOM.STRING('U',26)); stext:=TRANSLATE(stext,'abcdefghijklmnopqrstuvwxyz',DBMS_RANDOM.STRING('L',26)); stext:=TRANSLATE(stext,'0123456789',to_char(DBMS_RANDOM.VALUE(1,9))); stext:=REPLACE(stext,'.','0'); RETURN stext; END; The following screen shot shows the usage of an UDF with in a masking definition: To summarize, Oracle Data Masking and Subsetting helps you to consistently mask data across databases using one or all of the methods described in this post. It saves the hassle of identifying the parent-child relationships defined in the application table. Happy Masking

    Read the article

  • Using IIS Logs for Performance Testing with Visual Studio

    - by Tarun Arora
    In this blog post I’ll show you how you can play back the IIS Logs in Visual Studio to automatically generate the web performance tests. You can also download the sample solution I am demo-ing in the blog post. Introduction Performance testing is as important for new websites as it is for evolving websites. If you already have your website running in production you could mine the information available in IIS logs to analyse the dense zones (most used pages) and performance test those pages rather than wasting time testing & tuning the least used pages in your application. What are IIS Logs To help with server use and analysis, IIS is integrated with several types of log files. These log file formats provide information on a range of websites and specific statistics, including Internet Protocol (IP) addresses, user information and site visits as well as dates, times and queries. If you are using IIS 7 and above you will find the log files in the following directory C:\Interpub\Logs\ Walkthrough 1. Download and Install Log Parser from the Microsoft download Centre. You should see the LogParser.dll in the install folder, the default install location is C:\Program Files (x86)\Log Parser 2.2. LogParser.dll gives us a library to query the iis log files programmatically. By the way if you haven’t used Log Parser in the past, it is a is a powerful, versatile tool that provides universal query access to text-based data such as log files, XML files and CSV files, as well as key data sources on the Windows operating system such as the Event Log, the Registry, the file system, and Active Directory. More details… 2. Create a new test project in Visual Studio. Let’s call it IISLogsToWebPerfTestDemo.   3.  Delete the UnitTest1.cs class that gets created by default. Right click the solution and add a project of type class library, name it, IISLogsToWebPerfTestEngine. Delete the default class Program.cs that gets created with the project. 4. Under the IISLogsToWebPerfTestEngine project add a reference to Microsoft.VisualStudio.QualityTools.WebTestFramework – c:\Program Files (x86)\Microsoft Visual Studio 10.0\Common7\IDE\PublicAssemblies\Microsoft.VisualStudio.QualityTools.WebTestFramework.dll LogParser also called MSUtil - c:\users\tarora\documents\visual studio 2010\Projects\IisLogsToWebPerfTest\IisLogsToWebPerfTestEngine\obj\Debug\Interop.MSUtil.dll 5. Right click IISLogsToWebPerfTestEngine project and add a new classes – IISLogReader.cs The IISLogReader class queries the iis logs using the log parser. using System; using System.Collections.Generic; using System.Text; using MSUtil; using LogQuery = MSUtil.LogQueryClassClass; using IISLogInputFormat = MSUtil.COMIISW3CInputContextClassClass; using LogRecordSet = MSUtil.ILogRecordset; using Microsoft.VisualStudio.TestTools.WebTesting; using System.Diagnostics; namespace IisLogsToWebPerfTestEngine { // By making use of log parser it is possible to query the iis log using select queries public class IISLogReader { private string _iisLogPath; public IISLogReader(string iisLogPath) { _iisLogPath = iisLogPath; } public IEnumerable<WebTestRequest> GetRequests() { LogQuery logQuery = new LogQuery(); IISLogInputFormat iisInputFormat = new IISLogInputFormat(); // currently these columns give us suffient information to construct the web test requests string query = @"SELECT s-ip, s-port, cs-method, cs-uri-stem, cs-uri-query FROM " + _iisLogPath; LogRecordSet recordSet = logQuery.Execute(query, iisInputFormat); // Apply a bit of transformation while (!recordSet.atEnd()) { ILogRecord record = recordSet.getRecord(); if (record.getValueEx("cs-method").ToString() == "GET") { string server = record.getValueEx("s-ip").ToString(); string path = record.getValueEx("cs-uri-stem").ToString(); string querystring = record.getValueEx("cs-uri-query").ToString(); StringBuilder urlBuilder = new StringBuilder(); urlBuilder.Append("http://"); urlBuilder.Append(server); urlBuilder.Append(path); if (!String.IsNullOrEmpty(querystring)) { urlBuilder.Append("?"); urlBuilder.Append(querystring); } // You could make substitutions by introducing parameterized web tests. WebTestRequest request = new WebTestRequest(urlBuilder.ToString()); Debug.WriteLine(request.UrlWithQueryString); yield return request; } recordSet.moveNext(); } Console.WriteLine(" That's it! Closing the reader"); recordSet.close(); } } }   6. Connect the dots by adding the project reference ‘IisLogsToWebPerfTestEngine’ to ‘IisLogsToWebPerfTest’. Right click the ‘IisLogsToWebPerfTest’ project and add a new class ‘WebTest1Coded.cs’ The WebTest1Coded.cs inherits from the WebTest class. By overriding the GetRequestMethod we can inject the log files to the IISLogReader class which uses Log parser to query the log file and extract the web requests to generate the web test request which is yielded back for play back when the test is run. namespace IisLogsToWebPerfTest { using System; using System.Collections.Generic; using System.Text; using Microsoft.VisualStudio.TestTools.WebTesting; using Microsoft.VisualStudio.TestTools.WebTesting.Rules; using IisLogsToWebPerfTestEngine; // This class is a coded web performance test implementation, that simply passes // the path of the iis logs to the IisLogReader class which does the heavy // lifting of reading the contents of the log file and converting them to tests. // You could have multiple such classes that inherit from WebTest and implement // GetRequestEnumerator Method and pass differnt log files for different tests. public class WebTest1Coded : WebTest { public WebTest1Coded() { this.PreAuthenticate = true; } public override IEnumerator<WebTestRequest> GetRequestEnumerator() { // substitute the highlighted path with the path of the iis log file IISLogReader reader = new IISLogReader(@"C:\Demo\iisLog1.log"); foreach (WebTestRequest request in reader.GetRequests()) { yield return request; } } } }   7. Its time to fire the test off and see the iis log playback as a web performance test. From the Test menu choose Test View Window you should be able to see the WebTest1Coded test show up. Highlight the test and press Run selection (you can also debug the test in case you face any failures during test execution). 8. Optionally you can create a Load Test by keeping ‘WebTest1Coded’ as the base test. Conclusion You have just helped your testing team, you now have become the coolest developer in your organization! Jokes apart, log parser and web performance test together allow you to save a lot of time by not having to worry about what to test or even worrying about how to record the test. If you haven’t already, download the solution from here. You can take this to the next level by using LogParser to extract the log files as part of an end of day batch to a database. See the usage trends by user this solution over a longer term and have your tests consume the web requests now stored in the database to generate the web performance tests. If you like the post, don’t forget to share … Keep RocKiNg!

    Read the article

< Previous Page | 367 368 369 370 371 372 373 374 375 376 377 378  | Next Page >