Search Results

Search found 9682 results on 388 pages for 'anonymous types'.

Page 378/388 | < Previous Page | 374 375 376 377 378 379 380 381 382 383 384 385  | Next Page >

  • Delphi Pascal - Using SetFilePointerEx and GetFileSizeEx, Getting Physical Media exact size when reading as a file

    - by SuicideClutchX2
    I am having trouble understanding how to delcare GetFileSizeEx and SetFilePointerEx in Delphi 2009 so that I can use them since they are not in the RTL or Windows.pas. I was able to compile with the following: function GetFileSizeEx(hFile: THandle; lpFileSizeHigh: Pointer): DWORD; external 'kernel32'; Then using GetFileSizeEx(PD, Pointer(DriveSize)); to get the size. But could not get it to work, the disk handle I am using is valid and I have had no problem reading the data or working under the 2gb mark with the older API's. GetFileSize of course returns 4294967295. I have had greater trouble trying to use SetFilePointerEx with the data types it uses. The overall project needs to read the data from a flash card, which is not a problem at all I can do this. My problem is that I can not find the length or size of the media I will be reading. I have code I have used in the past to do this with media under 2GB. But now that I need to read media over 2GB it is a problem. If you still dont understand I am dumping a card with all data including the boot record, etc. This is the code I would normally use to read from the physical disk to grab say the boot record and dump it to file: SetFilePointer(PD,0,nil,FILE_BEGIN); SetLength(Buffer,512); ReadFile(PD,Buffer[0],512,BytesReturned,nil); I just need to figure out how to find the end of an 8gb card and so on as well as being able to set a file pointer beyond the 2gb barrier. I guess any help in the external declarations as well as understand the values that SetFilePointerEx uses (I do not understand the whole High Low thing) would be of great help. var Form1: TForm1; function GetFileSizeEx(hFile: THandle; var FileSize: Int64): DWORD; stdcall; external 'kernel32'; implementation {$R *.dfm} function GetLD(Drive: Char): Cardinal; var Buffer : String; begin Buffer := Format('\\.\%s:',[Drive]); Result := CreateFile(PChar(Buffer),GENERIC_READ Or GENERIC_WRITE,FILE_SHARE_READ,nil,OPEN_EXISTING,0,0); If Result = INVALID_HANDLE_VALUE Then begin Result := CreateFile(PChar(Buffer),GENERIC_READ,FILE_SHARE_READ,nil,OPEN_EXISTING,0,0); end; end; function GetPD(Drive: Byte): Cardinal; var Buffer : String; begin If Drive = 0 Then begin Result := INVALID_HANDLE_VALUE; Exit; end; Buffer := Format('\\.\PHYSICALDRIVE%d',[Drive]); Result := CreateFile(PChar(Buffer),GENERIC_READ Or GENERIC_WRITE,FILE_SHARE_READ,nil,OPEN_EXISTING,0,0); If Result = INVALID_HANDLE_VALUE Then begin Result := CreateFile(PChar(Buffer),GENERIC_READ,FILE_SHARE_READ,nil,OPEN_EXISTING,0,0); end; end; function GetPhysicalDiskNumber(Drive: Char): Byte; var LD : DWORD; DiskExtents : PVolumeDiskExtents; DiskExtent : TDiskExtent; BytesReturned : Cardinal; begin Result := 0; LD := GetLD(Drive); If LD = INVALID_HANDLE_VALUE Then Exit; Try DiskExtents := AllocMem(Max_Path); DeviceIOControl(LD,IOCTL_VOLUME_GET_VOLUME_DISK_EXTENTS,nil,0,DiskExtents,Max_Path,BytesReturned,nil); If DiskExtents^.NumberOfDiskExtents > 0 Then begin DiskExtent := DiskExtents^.Extents[0]; Result := DiskExtent.DiskNumber; end; Finally CloseHandle(LD); end; end; procedure TForm1.Button1Click(Sender: TObject); var PD : DWORD; BytesReturned : Cardinal; Buffer : Array Of Byte; myFile: File; DriveSize: Int64; begin PD := GetPD(GetPhysicalDiskNumber(Edit1.Text[1])); If PD = INVALID_HANDLE_VALUE Then Exit; Try GetFileSizeEx(PD, DriveSize); //SetFilePointer(PD,0,nil,FILE_BEGIN); //etLength(Buffer,512); //ZeroMemory(@Buffer,SizeOf(Buffer)); //ReadFile(PD,Buffer[0],512,BytesReturned,nil); //AssignFile(myFile, 'StickDump.bin'); //ReWrite(myFile, 512); //BlockWrite(myFile, Buffer[0], 1); //CloseFile(myFile); Finally CloseHandle(PD); End; end;

    Read the article

  • Unable to use factory girl with Cucumber and rails 3 (bundler problem)

    - by jbpros
    Hi there, I'm trying to run cucumber features with factory girl factories on a fresh Rails 3 application. Here is my Gemfile: source "http://gemcutter.org" gem "rails", "3.0.0.beta" gem "pg" gem "factory_girl", :git => "git://github.com/thoughtbot/factory_girl.git", :branch => "rails3" gem "rspec-rails", ">= 2.0.0.beta.4" gem "capybara" gem "database_cleaner" gem "cucumber-rails", :require => false Then the bundle install commande just runs smoothly: $ bundle install /usr/lib/ruby/gems/1.8/gems/bundler-0.9.3/lib/bundler/installer.rb:81:Warning: Gem::Dependency#version_requirements is deprecated and will be removed on or after August 2010. Use #requirement Updating git://github.com/thoughtbot/factory_girl.git Fetching source index from http://gemcutter.org Resolving dependencies Installing abstract (1.0.0) from system gems Installing actionmailer (3.0.0.beta) from system gems Installing actionpack (3.0.0.beta) from system gems Installing activemodel (3.0.0.beta) from system gems Installing activerecord (3.0.0.beta) from system gems Installing activeresource (3.0.0.beta) from system gems Installing activesupport (3.0.0.beta) from system gems Installing arel (0.2.1) from system gems Installing builder (2.1.2) from system gems Installing bundler (0.9.13) from system gems Installing capybara (0.3.6) from system gems Installing cucumber (0.6.3) from system gems Installing cucumber-rails (0.3.0) from system gems Installing culerity (0.2.9) from system gems Installing database_cleaner (0.5.0) from system gems Installing diff-lcs (1.1.2) from system gems Installing erubis (2.6.5) from system gems Installing factory_girl (1.2.3) from git://github.com/thoughtbot/factory_girl.git (at rails3) Installing ffi (0.6.3) from system gems Installing i18n (0.3.6) from system gems Installing json_pure (1.2.3) from system gems Installing mail (2.1.3) from system gems Installing memcache-client (1.7.8) from system gems Installing mime-types (1.16) from system gems Installing nokogiri (1.4.1) from system gems Installing pg (0.9.0) from system gems Installing polyglot (0.3.0) from system gems Installing rack (1.1.0) from system gems Installing rack-mount (0.4.7) from system gems Installing rack-test (0.5.3) from system gems Installing rails (3.0.0.beta) from system gems Installing railties (3.0.0.beta) from system gems Installing rake (0.8.7) from system gems Installing rspec (2.0.0.beta.4) from system gems Installing rspec-core (2.0.0.beta.4) from system gems Installing rspec-expectations (2.0.0.beta.4) from system gems Installing rspec-mocks (2.0.0.beta.4) from system gems Installing rspec-rails (2.0.0.beta.4) from system gems Installing selenium-webdriver (0.0.17) from system gems Installing term-ansicolor (1.0.5) from system gems Installing text-format (1.0.0) from system gems Installing text-hyphen (1.0.0) from system gems Installing thor (0.13.4) from system gems Installing treetop (1.4.4) from system gems Installing tzinfo (0.3.17) from system gems Installing webrat (0.7.0) from system gems Your bundle is complete! When I run cucumber, here is the error I get: $ rake cucumber (in /home/jbpros/projects/deorbitburn) /usr/lib/ruby/gems/1.8/gems/bundler-0.9.3/lib/bundler/resolver.rb:97:Warning: Gem::Dependency#version_requirements is deprecated and will be removed on or after August 2010. Use #requirement NOTICE: CREATE TABLE will create implicit sequence "posts_id_seq" for serial column "posts.id" NOTICE: CREATE TABLE / PRIMARY KEY will create implicit index "posts_pkey" for table "posts" /usr/bin/ruby1.8 -I "/usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/lib:lib" "/usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/cucumber" --profile default Using the default profile... git://github.com/thoughtbot/factory_girl.git (at rails3) is not checked out. Please run `bundle install` (Bundler::PathError) /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/source.rb:282:in `load_spec_files' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/source.rb:190:in `local_specs' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:36:in `runtime_gems' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:35:in `each' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:35:in `runtime_gems' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/index.rb:5:in `build' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:34:in `runtime_gems' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:14:in `index' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/index.rb:5:in `build' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:13:in `index' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:55:in `resolve_locally' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:28:in `specs' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:65:in `specs_for' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/environment.rb:23:in `requested_specs' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler/runtime.rb:18:in `setup' /home/jbpros/.bundle/gems/bundler-0.9.13/lib/bundler.rb:68:in `setup' /home/jbpros/projects/deorbitburn/config/boot.rb:7 /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `gem_original_require' /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `polyglot_original_require' /usr/lib/ruby/gems/1.8/gems/polyglot-0.3.0/lib/polyglot.rb:65:in `require' /home/jbpros/projects/deorbitburn/config/application.rb:1 /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `gem_original_require' /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `polyglot_original_require' /usr/lib/ruby/gems/1.8/gems/polyglot-0.3.0/lib/polyglot.rb:65:in `require' /home/jbpros/projects/deorbitburn/config/environment.rb:2 /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `gem_original_require' /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `polyglot_original_require' /usr/lib/ruby/gems/1.8/gems/polyglot-0.3.0/lib/polyglot.rb:65:in `require' /home/jbpros/projects/deorbitburn/features/support/env.rb:8 /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `gem_original_require' /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `polyglot_original_require' /usr/lib/ruby/gems/1.8/gems/polyglot-0.3.0/lib/polyglot.rb:65:in `require' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/../lib/cucumber/rb_support/rb_language.rb:124:in `load_code_file' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/../lib/cucumber/step_mother.rb:85:in `load_code_file' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/../lib/cucumber/step_mother.rb:77:in `load_code_files' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/../lib/cucumber/step_mother.rb:76:in `each' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/../lib/cucumber/step_mother.rb:76:in `load_code_files' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/../lib/cucumber/cli/main.rb:48:in `execute!' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/../lib/cucumber/cli/main.rb:20:in `execute' /usr/lib/ruby/gems/1.8/gems/cucumber-0.6.3/bin/cucumber:8 rake aborted! Command failed with status (1): [/usr/bin/ruby1.8 -I "/usr/lib/ruby/gems/1....] (See full trace by running task with --trace) Do I have to do something special for bundler to check out factory girl's repository on github?

    Read the article

  • What's the best name for a non-mutating "add" method on an immutable collection?

    - by Jon Skeet
    Sorry for the waffly title - if I could come up with a concise title, I wouldn't have to ask the question. Suppose I have an immutable list type. It has an operation Foo(x) which returns a new immutable list with the specified argument as an extra element at the end. So to build up a list of strings with values "Hello", "immutable", "world" you could write: var empty = new ImmutableList<string>(); var list1 = empty.Foo("Hello"); var list2 = list1.Foo("immutable"); var list3 = list2.Foo("word"); (This is C# code, and I'm most interested in a C# suggestion if you feel the language is important. It's not fundamentally a language question, but the idioms of the language may be important.) The important thing is that the existing lists are not altered by Foo - so empty.Count would still return 0. Another (more idiomatic) way of getting to the end result would be: var list = new ImmutableList<string>().Foo("Hello"); .Foo("immutable"); .Foo("word"); My question is: what's the best name for Foo? EDIT 3: As I reveal later on, the name of the type might not actually be ImmutableList<T>, which makes the position clear. Imagine instead that it's TestSuite and that it's immutable because the whole of the framework it's a part of is immutable... (End of edit 3) Options I've come up with so far: Add: common in .NET, but implies mutation of the original list Cons: I believe this is the normal name in functional languages, but meaningless to those without experience in such languages Plus: my favourite so far, it doesn't imply mutation to me. Apparently this is also used in Haskell but with slightly different expectations (a Haskell programmer might expect it to add two lists together rather than adding a single value to the other list). With: consistent with some other immutable conventions, but doesn't have quite the same "additionness" to it IMO. And: not very descriptive. Operator overload for + : I really don't like this much; I generally think operators should only be applied to lower level types. I'm willing to be persuaded though! The criteria I'm using for choosing are: Gives the correct impression of the result of the method call (i.e. that it's the original list with an extra element) Makes it as clear as possible that it doesn't mutate the existing list Sounds reasonable when chained together as in the second example above Please ask for more details if I'm not making myself clear enough... EDIT 1: Here's my reasoning for preferring Plus to Add. Consider these two lines of code: list.Add(foo); list.Plus(foo); In my view (and this is a personal thing) the latter is clearly buggy - it's like writing "x + 5;" as a statement on its own. The first line looks like it's okay, until you remember that it's immutable. In fact, the way that the plus operator on its own doesn't mutate its operands is another reason why Plus is my favourite. Without the slight ickiness of operator overloading, it still gives the same connotations, which include (for me) not mutating the operands (or method target in this case). EDIT 2: Reasons for not liking Add. Various answers are effectively: "Go with Add. That's what DateTime does, and String has Replace methods etc which don't make the immutability obvious." I agree - there's precedence here. However, I've seen plenty of people call DateTime.Add or String.Replace and expect mutation. There are loads of newsgroup questions (and probably SO ones if I dig around) which are answered by "You're ignoring the return value of String.Replace; strings are immutable, a new string gets returned." Now, I should reveal a subtlety to the question - the type might not actually be an immutable list, but a different immutable type. In particular, I'm working on a benchmarking framework where you add tests to a suite, and that creates a new suite. It might be obvious that: var list = new ImmutableList<string>(); list.Add("foo"); isn't going to accomplish anything, but it becomes a lot murkier when you change it to: var suite = new TestSuite<string, int>(); suite.Add(x => x.Length); That looks like it should be okay. Whereas this, to me, makes the mistake clearer: var suite = new TestSuite<string, int>(); suite.Plus(x => x.Length); That's just begging to be: var suite = new TestSuite<string, int>().Plus(x => x.Length); Ideally, I would like my users not to have to be told that the test suite is immutable. I want them to fall into the pit of success. This may not be possible, but I'd like to try. I apologise for over-simplifying the original question by talking only about an immutable list type. Not all collections are quite as self-descriptive as ImmutableList<T> :)

    Read the article

  • Iphone NSXMLParser NSCFString memory leak

    - by atticusalien
    I am building an app that parses an rss feed. In the app there are two different types of feeds with different names for the elements in the feed, so I have created an NSXMLParser NSObject that takes the name of the elements of each feed before parsing. Here is my code: NewsFeedParser.h #import @interface NewsFeedParser : NSObject { NSInteger NewsSelectedCategory; NSXMLParser *NSXMLNewsParser; NSMutableArray *newsCategories; NSMutableDictionary *NewsItem; NSMutableString *NewsCurrentElement, *NewsCurrentElement1, *NewsCurrentElement2, *NewsCurrentElement3; NSString *NewsItemType, *NewsElement1, *NewsElement2, *NewsElement3; NSInteger NewsNumElements; } - (void) parseXMLFileAtURL:(NSString *)URL; @property(nonatomic, retain) NSString *NewsItemType; @property(nonatomic, retain) NSString *NewsElement1; @property(nonatomic, retain) NSString *NewsElement2; @property(nonatomic, retain) NSString *NewsElement3; @property(nonatomic, retain) NSMutableArray *newsCategories; @property(assign, nonatomic) NSInteger NewsNumElements; @end NewsFeedParser.m #import "NewsFeedParser.h" @implementation NewsFeedParser @synthesize NewsItemType; @synthesize NewsElement1; @synthesize NewsElement2; @synthesize NewsElement3; @synthesize newsCategories; @synthesize NewsNumElements; - (void)parserDidStartDocument:(NSXMLParser *)parser{ } - (void)parseXMLFileAtURL:(NSString *)URL { newsCategories = [[NSMutableArray alloc] init]; URL = [URL stringByReplacingOccurrencesOfString:@" " withString:@""]; URL = [URL stringByReplacingOccurrencesOfString:@"\n" withString:@""]; URL = [URL stringByReplacingOccurrencesOfString:@" " withString:@""]; //you must then convert the path to a proper NSURL or it won't work NSURL *xmlURL = [NSURL URLWithString:URL]; // here, for some reason you have to use NSClassFromString when trying to alloc NSXMLParser, otherwise you will get an object not found error // this may be necessary only for the toolchain [[NSURLCache sharedURLCache] setMemoryCapacity:0]; [[NSURLCache sharedURLCache] setDiskCapacity:0]; NSXMLNewsParser = [[NSXMLParser alloc] initWithContentsOfURL:xmlURL]; // Set self as the delegate of the parser so that it will receive the parser delegate methods callbacks. [NSXMLNewsParser setDelegate:self]; // Depending on the XML document you're parsing, you may want to enable these features of NSXMLParser. [NSXMLNewsParser setShouldProcessNamespaces:NO]; [NSXMLNewsParser setShouldReportNamespacePrefixes:NO]; [NSXMLNewsParser setShouldResolveExternalEntities:NO]; [NSXMLNewsParser parse]; [NSXMLNewsParser release]; } - (void)parser:(NSXMLParser *)parser parseErrorOccurred:(NSError *)parseError { NSString * errorString = [NSString stringWithFormat:@"Unable to download story feed from web site (Error code %i )", [parseError code]]; NSLog(@"error parsing XML: %@", errorString); UIAlertView * errorAlert = [[UIAlertView alloc] initWithTitle:@"Error loading content" message:errorString delegate:self cancelButtonTitle:@"OK" otherButtonTitles:nil]; [errorAlert show]; [errorAlert release]; [errorString release]; } - (void)parser:(NSXMLParser *)parser didStartElement:(NSString *)elementName namespaceURI:(NSString *)namespaceURI qualifiedName:(NSString *)qName attributes:(NSDictionary *)attributeDict{ NewsCurrentElement = [elementName copy]; if ([elementName isEqualToString:NewsItemType]) { // clear out our story item caches... NewsItem = [[NSMutableDictionary alloc] init]; NewsCurrentElement1 = [[NSMutableString alloc] init]; NewsCurrentElement2 = [[NSMutableString alloc] init]; if(NewsNumElements == 3) { NewsCurrentElement3 = [[NSMutableString alloc] init]; } } } - (void)parser:(NSXMLParser *)parser didEndElement:(NSString *)elementName namespaceURI:(NSString *)namespaceURI qualifiedName:(NSString *)qName{ if ([elementName isEqualToString:NewsItemType]) { // save values to an item, then store that item into the array... [NewsItem setObject:NewsCurrentElement1 forKey:NewsElement1]; [NewsItem setObject:NewsCurrentElement2 forKey:NewsElement2]; if(NewsNumElements == 3) { [NewsItem setObject:NewsCurrentElement3 forKey:NewsElement3]; } [newsCategories addObject:[[NewsItem copy] autorelease]]; [NewsCurrentElement release]; [NewsCurrentElement1 release]; [NewsCurrentElement2 release]; if(NewsNumElements == 3) { [NewsCurrentElement3 release]; } [NewsItem release]; } } - (void)parser:(NSXMLParser *)parser foundCharacters:(NSString *)string { //NSLog(@"found characters: %@", string); // save the characters for the current item... if ([NewsCurrentElement isEqualToString:NewsElement1]) { [NewsCurrentElement1 appendString:string]; } else if ([NewsCurrentElement isEqualToString:NewsElement2]) { [NewsCurrentElement2 appendString:string]; } else if (NewsNumElements == 3 && [NewsCurrentElement isEqualToString:NewsElement3]) { [NewsCurrentElement3 appendString:string]; } } - (void)dealloc { [super dealloc]; [newsCategories release]; [NewsItemType release]; [NewsElement1 release]; [NewsElement2 release]; [NewsElement3 release]; } When I create an instance of the class I do like so: NewsFeedParser *categoriesParser = [[NewsFeedParser alloc] init]; if(newsCat == 0) { categoriesParser.NewsItemType = @"article"; categoriesParser.NewsElement1 = @"category"; categoriesParser.NewsElement2 = @"catid"; } else { categoriesParser.NewsItemType = @"article"; categoriesParser.NewsElement1 = @"category"; categoriesParser.NewsElement2 = @"feedUrl"; } [categoriesParser parseXMLFileAtURL:feedUrl]; newsCategories = [[NSMutableArray alloc] initWithArray:categoriesParser.newsCategories copyItems:YES]; [self.tableView reloadData]; [categoriesParser release]; If I run the app with the leaks instrument, the leaks point to the [NSXMLNewsParser parse] call in the NewsFeedParser.m. Here is a screen shot of the Leaks instrument with the NSCFStrings leaking: http://img139.imageshack.us/img139/3997/leaks.png For the life of me I can't figure out where these leaks are coming from. Any help would be greatly appreciated.

    Read the article

  • Debugging cucumber/gem dependencies

    - by mobmad
    How do you debug and fix gem errors like below? Although the below case is very specific, I'm also looking for solution to related problems like "gem already activated [...]", and resources to gem management/debugging. mycomputer:projectfolder username$ cucumber features Using the default profile... WARNING: No DRb server is running. Running features locally: /Users/username/.gem/ruby/1.8/gems/rails-2.3.5/lib/rails/gem_dependency.rb:119:Warning: Gem::Dependency#version_requirements is deprecated and will be removed on or after August 2010. Use #requirement can't activate , already activated ruby-hmac-0.4.0 (Gem::Exception) /Users/username/.gem/ruby/1.8/gems/rails-2.3.5/lib/rails/gem_dependency.rb:101:in `specification' /Users/username/.gem/ruby/1.8/gems/rails-2.3.5/lib/rails/plugin/locator.rb:81:in `plugins' /Library/Ruby/Site/1.8/rubygems/custom_require.rb:31:in `inject' /Users/username/.gem/ruby/1.8/gems/rails-2.3.5/lib/rails/plugin/locator.rb:81:in `each' /Users/username/.gem/ruby/1.8/gems/rails-2.3.5/lib/rails/plugin/locator.rb:81:in `inject' /Users/username/.gem/ruby/1.8/gems/rails-2.3.5/lib/rails/plugin/locator.rb:81:in `plugins' /Users/username/.gem/ruby/1.8/gems/rails-2.3.5/lib/rails/plugin/loader.rb:109:in `locate_plugins' /Users/username/.gem/ruby/1.8/gems/rails-2.3.5/lib/rails/plugin/loader.rb:108:in `map' /Users/username/.gem/ruby/1.8/gems/rails-2.3.5/lib/rails/plugin/loader.rb:108:in `locate_plugins' /Users/username/.gem/ruby/1.8/gems/rails-2.3.5/lib/rails/plugin/loader.rb:32:in `all_plugins' /Users/username/.gem/ruby/1.8/gems/rails-2.3.5/lib/rails/plugin/loader.rb:22:in `plugins' /Users/username/.gem/ruby/1.8/gems/rails-2.3.5/lib/rails/plugin/loader.rb:53:in `add_plugin_load_paths' /Users/username/.gem/ruby/1.8/gems/rails-2.3.5/lib/initializer.rb:294:in `add_plugin_load_paths' /Users/username/.gem/ruby/1.8/gems/rails-2.3.5/lib/initializer.rb:136:in `process' /Users/username/.gem/ruby/1.8/gems/rails-2.3.5/lib/initializer.rb:113:in `send' /Users/username/.gem/ruby/1.8/gems/rails-2.3.5/lib/initializer.rb:113:in `run' /Users/username/Documents/projectfolder.0/sites/projectfolder/config/environment.rb:9 /Library/Ruby/Site/1.8/rubygems/custom_require.rb:31:in `gem_original_require' /Library/Ruby/Site/1.8/rubygems/custom_require.rb:31:in `polyglot_original_require' /Library/Ruby/Gems/1.8/gems/polyglot-0.2.9/lib/polyglot.rb:70:in `require' ./features/support/env.rb:12 /Library/Ruby/Gems/1.8/gems/spork-0.7.5/lib/spork.rb:23:in `prefork' ./features/support/env.rb:9 /Library/Ruby/Site/1.8/rubygems/custom_require.rb:31:in `gem_original_require' /Library/Ruby/Site/1.8/rubygems/custom_require.rb:31:in `polyglot_original_require' /Library/Ruby/Gems/1.8/gems/polyglot-0.2.9/lib/polyglot.rb:70:in `require' /Library/Ruby/Gems/1.8/gems/cucumber-0.4.4/bin/../lib/cucumber/rb_support/rb_language.rb:124:in `load_code_file' /Library/Ruby/Gems/1.8/gems/cucumber-0.4.4/bin/../lib/cucumber/step_mother.rb:84:in `load_code_file' /Library/Ruby/Gems/1.8/gems/cucumber-0.4.4/bin/../lib/cucumber/step_mother.rb:76:in `load_code_files' /Library/Ruby/Gems/1.8/gems/cucumber-0.4.4/bin/../lib/cucumber/step_mother.rb:75:in `each' /Library/Ruby/Gems/1.8/gems/cucumber-0.4.4/bin/../lib/cucumber/step_mother.rb:75:in `load_code_files' /Library/Ruby/Gems/1.8/gems/cucumber-0.4.4/bin/../lib/cucumber/cli/main.rb:47:in `execute!' /Library/Ruby/Gems/1.8/gems/cucumber-0.4.4/bin/../lib/cucumber/cli/main.rb:24:in `execute' /Library/Ruby/Gems/1.8/gems/cucumber-0.4.4/bin/cucumber:8 /usr/bin/cucumber:19:in `load' /usr/bin/cucumber:19 And this is the output from gem list actionmailer (2.3.5, 2.2.2, 1.3.6) actionpack (2.3.5, 2.2.2, 1.13.6) actionwebservice (1.2.6) activerecord (2.3.5, 2.2.2, 1.15.6) activeresource (2.3.5, 2.2.2) activesupport (2.3.5, 2.2.2, 1.4.4) acts_as_ferret (0.4.4, 0.4.3) adamwiggins-rest-client (1.0.4) aslakhellesoy-webrat (0.4.4.1) aslakjo-comatose (2.0.5.12) authlogic (2.1.3) authlogic-oid (1.0.4) builder (2.1.2) capistrano (2.5.17, 2.5.2) cgi_multipart_eof_fix (2.5.0) configuration (1.1.0) cucumber (0.4.4) cucumber-rails (0.3.0) daemons (1.0.10) database_cleaner (0.5.0) diff-lcs (1.1.2) dnssd (1.3.1, 0.6.0) fakeweb (1.2.8) fastthread (1.0.7, 1.0.1) fcgi (0.8.8, 0.8.7) ferret (0.11.6) gem_plugin (0.2.3) gemcutter (0.4.1) heroku (1.8.0) highline (1.5.2, 1.5.0) hoe (2.5.0) hpricot (0.8.2, 0.6.164) json (1.2.2) json_pure (1.2.2) launchy (0.3.5) libxml-ruby (1.1.3, 1.1.2) linecache (0.43) log4r (1.1.5) mime-types (1.16) mongrel (1.1.5) mysql (2.8.1) needle (1.3.0) net-scp (1.0.2, 1.0.1) net-sftp (2.0.4, 2.0.1, 1.1.1) net-ssh (2.0.20, 2.0.4, 1.1.4) net-ssh-gateway (1.0.1, 1.0.0) nifty-generators (0.3.2) nokogiri (1.4.1) oauth (0.3.6) oniguruma (1.1.0) plist (3.1.0) polyglot (0.2.9) rack (1.1.0, 1.0.1) rack-test (0.5.3) rails (2.3.5, 2.2.2, 1.2.6) rake (0.8.7, 0.8.3) RedCloth (4.2.2, 4.1.1) rest-client (1.4.0) rspec (1.3.0) rspec-rails (1.3.2) ruby-activeldap (0.8.3.1) ruby-debug-base (0.10.3) ruby-debug-ide (0.4.9) ruby-hmac (0.4.0) ruby-net-ldap (0.0.4) ruby-openid (2.1.7, 2.1.2) ruby-yadis (0.3.4) rubyforge (2.0.4) rubygems-update (1.3.6) rubynode (0.1.5) rubyzip (0.9.4) sanitize (1.2.0) sequel (3.0.0) sinatra (0.9.2) spork (0.7.5) sqlite3-ruby (1.2.5, 1.2.4) taps (0.2.26) term-ansicolor (1.0.4) termios (0.9.4) textpow (0.10.1) thor (0.9.9) treetop (1.4.2) twitter4r (0.3.2, 0.3.1) ultraviolet (0.10.2) webrat (0.7.0) will_paginate (2.3.12) xmpp4r (0.5, 0.4)

    Read the article

  • What is the best way to provide an AutoMappingOverride for an interface in fluentnhibernate automapp

    - by Tom
    In my quest for a version-wide database filter for an application, I have written the following code: using System; using System.Collections.Generic; using System.Linq; using System.Text; using FluentNHibernate.Automapping; using FluentNHibernate.Automapping.Alterations; using FluentNHibernate.Mapping; using MvcExtensions.Model; using NHibernate; namespace MvcExtensions.Services.Impl.FluentNHibernate { public interface IVersionAware { string Version { get; set; } } public class VersionFilter : FilterDefinition { const string FILTERNAME = "MyVersionFilter"; const string COLUMNNAME = "Version"; public VersionFilter() { this.WithName(FILTERNAME) .WithCondition("Version = :"+COLUMNNAME) .AddParameter(COLUMNNAME, NHibernateUtil.String ); } public static void EnableVersionFilter(ISession session,string version) { session.EnableFilter(FILTERNAME).SetParameter(COLUMNNAME, version); } public static void DisableVersionFilter(ISession session) { session.DisableFilter(FILTERNAME); } } public class VersionAwareOverride : IAutoMappingOverride<IVersionAware> { #region IAutoMappingOverride<IVersionAware> Members public void Override(AutoMapping<IVersionAware> mapping) { mapping.ApplyFilter<VersionFilter>(); } #endregion } } But, since overrides do not work on interfaces, I am looking for a way to implement this. Currently I'm using this (rather cumbersome) way for each class that implements the interface : public class SomeVersionedEntity : IModelId, IVersionAware { public virtual int Id { get; set; } public virtual string Version { get; set; } } public class SomeVersionedEntityOverride : IAutoMappingOverride<SomeVersionedEntity> { #region IAutoMappingOverride<SomeVersionedEntity> Members public void Override(AutoMapping<SomeVersionedEntity> mapping) { mapping.ApplyFilter<VersionFilter>(); } #endregion } I have been looking at IClassmap interfaces etc, but they do not seem to provide a way to access the ApplyFilter method, so I have not got a clue here... Since I am probably not the first one who has this problem, I am quite sure that it should be possible; I am just not quite sure how this works.. EDIT : I have gotten a bit closer to a generic solution: This is the way I tried to solve it : Using a generic class to implement alterations to classes implementing an interface : public abstract class AutomappingInterfaceAlteration<I> : IAutoMappingAlteration { public void Alter(AutoPersistenceModel model) { model.OverrideAll(map => { var recordType = map.GetType().GetGenericArguments().Single(); if (typeof(I).IsAssignableFrom(recordType)) { this.GetType().GetMethod("overrideStuff").MakeGenericMethod(recordType).Invoke(this, new object[] { model }); } }); } public void overrideStuff<T>(AutoPersistenceModel pm) where T : I { pm.Override<T>( a => Override(a)); } public abstract void Override<T>(AutoMapping<T> am) where T:I; } And a specific implementation : public class VersionAwareAlteration : AutomappingInterfaceAlteration<IVersionAware> { public override void Override<T>(AutoMapping<T> am) { am.Map(x => x.Version).Column("VersionTest"); am.ApplyFilter<VersionFilter>(); } } Unfortunately I get the following error now : [InvalidOperationException: Collection was modified; enumeration operation may not execute.] System.ThrowHelper.ThrowInvalidOperationException(ExceptionResource resource) +51 System.Collections.Generic.Enumerator.MoveNextRare() +7661017 System.Collections.Generic.Enumerator.MoveNext() +61 System.Linq.WhereListIterator`1.MoveNext() +156 FluentNHibernate.Utils.CollectionExtensions.Each(IEnumerable`1 enumerable, Action`1 each) +239 FluentNHibernate.Automapping.AutoMapper.ApplyOverrides(Type classType, IList`1 mappedProperties, ClassMappingBase mapping) +345 FluentNHibernate.Automapping.AutoMapper.MergeMap(Type classType, ClassMappingBase mapping, IList`1 mappedProperties) +43 FluentNHibernate.Automapping.AutoMapper.Map(Type classType, List`1 types) +566 FluentNHibernate.Automapping.AutoPersistenceModel.AddMapping(Type type) +85 FluentNHibernate.Automapping.AutoPersistenceModel.CompileMappings() +746 EDIT 2 : I managed to get a bit further; I now invoke "Override" using reflection for each class that implements the interface : public abstract class PersistenceOverride<I> { public void DoOverrides(AutoPersistenceModel model,IEnumerable<Type> Mytypes) { foreach(var t in Mytypes.Where(x=>typeof(I).IsAssignableFrom(x))) ManualOverride(t,model); } private void ManualOverride(Type recordType,AutoPersistenceModel model) { var t_amt = typeof(AutoMapping<>).MakeGenericType(recordType); var t_act = typeof(Action<>).MakeGenericType(t_amt); var m = typeof(PersistenceOverride<I>) .GetMethod("MyOverride") .MakeGenericMethod(recordType) .Invoke(this, null); model.GetType().GetMethod("Override").MakeGenericMethod(recordType).Invoke(model, new object[] { m }); } public abstract Action<AutoMapping<T>> MyOverride<T>() where T:I; } public class VersionAwareOverride : PersistenceOverride<IVersionAware> { public override Action<AutoMapping<T>> MyOverride<T>() { return am => { am.Map(x => x.Version).Column(VersionFilter.COLUMNNAME); am.ApplyFilter<VersionFilter>(); }; } } However, for one reason or another my generated hbm files do not contain any "filter" fields.... Maybe somebody could help me a bit further now ??

    Read the article

  • Driving me INSANE: Unable to Retrieve Metadata for

    - by Loren
    I've been spending the past 3 days trying to fix this problem I'm encountering - it's driving me insane... I'm not quite sure what is causing this bug - here are the details: MVC4 + Entity Framework 4.4 + MySql + POCO/Code First I'm setting up the above configuration .. here are my classes: namespace BTD.DataContext { public class BTDContext : DbContext { public BTDContext() : base("name=BTDContext") { } protected override void OnModelCreating(DbModelBuilder modelBuilder) { base.OnModelCreating(modelBuilder); //modelBuilder.Conventions.Remove<System.Data.Entity.Infrastructure.IncludeMetadataConvention>(); } public DbSet<Product> Products { get; set; } public DbSet<ProductImage> ProductImages { get; set; } } } namespace BTD.Data { [Table("Product")] public class Product { [Key] public long ProductId { get; set; } [DisplayName("Manufacturer")] public int? ManufacturerId { get; set; } [Required] [StringLength(150)] public string Name { get; set; } [Required] [DataType(DataType.MultilineText)] public string Description { get; set; } [Required] [StringLength(120)] public string URL { get; set; } [Required] [StringLength(75)] [DisplayName("Meta Title")] public string MetaTitle { get; set; } [DataType(DataType.MultilineText)] [DisplayName("Meta Description")] public string MetaDescription { get; set; } [Required] [StringLength(25)] public string Status { get; set; } [DisplayName("Create Date/Time")] public DateTime CreateDateTime { get; set; } [DisplayName("Edit Date/Time")] public DateTime EditDateTime { get; set; } } [Table("ProductImage")] public class ProductImage { [Key] public long ProductImageId { get; set; } public long ProductId { get; set; } public long? ProductVariantId { get; set; } [Required] public byte[] Image { get; set; } public bool PrimaryImage { get; set; } public DateTime CreateDateTime { get; set; } public DateTime EditDateTime { get; set; } } } Here is my web.config setup... <connectionStrings> <add name="BTDContext" connectionString="Server=localhost;Port=3306;Database=btd;User Id=root;Password=mypassword;" providerName="MySql.Data.MySqlClient" /> </connectionStrings> The database AND tables already exist... I'm still pretty new with mvc but was using this tutorial The application builds fine.. however when I try to add a controller using Product (BTD.Data) as my model class and BTDContext (BTD.DataContext) as my data context class I receive the following error: Unable to retrieve metadata for BTD.Data.Product using the same DbCompiledModel to create context against different types of database servers is not supported. Instead, create a separate DbCompiledModel for each type of server being used. I am at a complete loss - I've scoured google with almost every different variation of that error message above I can think of but to no avail. Here are the things i can verify... MySql is working properly I'm using MySql Connector version 6.5.4 and have created other ASP.net web forms + entity framework applications with ZERO problems I have also tried including/removing this in my web.config: <system.data> <DbProviderFactories> <remove invariant="MySql.Data.MySqlClient"/> <add name="MySQL Data Provider" invariant="MySql.Data.MySqlClient" description=".Net Framework Data Provider for MySQL" type="MySql.Data.MySqlClient.MySqlClientFactory, MySql.Data, Version=6.5.4.0, Culture=neutral, PublicKeyToken=c5687fc88969c44d" /> </DbProviderFactories> I've literally been working on this bug for days - I'm to the point now that I would be willing to pay someone to solve it.. no joke... I'd really love to use MVC 4 and Razor - I was so excited to get started on this, but now i'm pretty discouraged - I truly appreciate any help/guidance on this! Also note - i'm using Entityframework from Nuget... Another Note I was using the default visual studio template that creates your MVC project with the account pages and other stuff. I JUST removed all references to the added files because they were trying to use the "DefaultConnection" which didn't exist - so i thought those files may be what was causing the error - however still no luck after removing them - I just wanted to let everyone know i'm using the visual studio MVC project template which pre-creates a bunch of files. I will be trying to recreate this all from a blank MVC project which doesn't have those files - i will update this once i test that Other References It appears someone else is having the same issues I am - the only difference is they are using sql server - I tried tweaking all my code to follow the suggestions on this stackoverflow question/answer here but still to no avail

    Read the article

  • MySQL Binary Storage using BLOB VS OS File System: large files, large quantities, large problems.

    - by Quantico773
    Hi Guys, Versions I am running (basically latest of everything): PHP: 5.3.1 MySQL: 5.1.41 Apache: 2.2.14 OS: CentOS (latest) Here is the situation. I have thousands of very important documents, ranging from customer contracts to voice signatures (recordings of customer authorisation for contracts), with file types including, but not limited to jpg, gif, png, tiff, doc, docx, xls, wav, mp3, pdf, etc. All of these documents are currently stored on several servers including Windows 32 bit, CentOS and Mac, among others. Some files are also stored on employees desktop computers and laptops, and some are still hard copies stored in hundreds of boxes and filing cabinets. Now because customers or lawyers could demand evidence of contracts at any time, my company has to be able to search and locate the correct document(s) effectively, for this reason ALL of these files have to be digitised (if not already) and correlated into some sort of order for searching and accessing. As the programmer, I have created a full Customer Relations Management tool that the whole company uses. This includes Customer Profiles management, Order and job Tracking tools, Job/sale creation and management modules, etc, and at the moment any file that is needed at a customer profile level (drivers licence, credit authority, etc) or at a job/sale level (contracts, voice signatures, etc) can be uploaded to the server and sits in a parent/child hierarchy structure, just like Windows Explorer or any other typical file managment model. The structure appears as such: drivers_license |- DL_123.jpg voice_signatures |- VS_123.wav |- VS_4567.wav contracts So the files are uplaoded using PHP and Apache, and are stored in the file system of the OS. At the time of uploading, certain information about the file(s) is stored in a MySQL database. Some of the information stored is: TABLE: FileUploads FileID CustomerID (the customer id that the file belongs to, they all have this.) JobID/SaleID (the id of the job/sale associated, if any.) FileSize FileType UploadedDateTime UploadedBy FilePath (the directory path the file is stored in.) FileName (current file name of uploaded file, combination of CustomerID and JobID/SaleID if applicable.) FileDescription OriginalFileName (original name of the source file when uploaded, including extension.) So as you can see, the file is linked to the database by the File Name. When I want to provide a customers' files for download to a user all I have to do is "SELECT * FROM FileUploads WHERE CustomerID = 123 OR JobID = 2345;" and this will output all the file details I require, and with the FilePath and FileName I can provide the link for download. http... server / FilePath / FileName There are a number of problems with this method: Storing files in this "database unconcious" environment means data integrity is not kept. If a record is deleted, the file may not be deleted also, or vice versa. Files are strewn all over the place, different servers, computers, etc. The file name is the ONLY thing matching the binary to the database and customer profile and customer records. etc, etc. There are so many reasons, some of which are described here: http://www.dreamwerx.net/site/article01 . Also there is an interesting article here too: sietch.net/ViewNewsItem.aspx?NewsItemID=124 . SO, after much research I have pretty much decided I am going to store ALL of these files in the database, as a BLOB or LONGBLOB, but there are still many considerations before I do this. I know that storing them in the database is a viable option, however there are a number of methods of storing them. I also know storing them is one thing; correlating and accessing them in a manageable way is another thing entirely. The article provided at this link: dreamwerx.net/site/article01 describes a way of splitting the uploaded binary files into 64kb chunks and storing each chunk with the FileID, and then streaming the actual binary file to the client using headers. This is a really cool idea since it alleviates preassure on the servers memory; instead of loading an entire 100mb file into the RAM and then sending it to the client, it is doing it 64kb at a time. I have tried this (and updated his scripts) and this is totally successful, in a very small frame of testing. So if you are in agreeance that this method is a viable, stable and robust long-term option to store moderately large files (1kb to couple hundred megs), and large quantities of these files, let me know what other considerations or ideas you have. Also, I am considering getting a current "File Management" PHP script that gives an interface for managing files stored in the File System and converting it to manage files stored in the database. If there is already any software out there that does this, please let me know. I guess there are many questions I could ask, and all the information is up there ^^ so please, discuss all aspects of this and we can pass ideas back and forth and teach each other. Cheers, Quantico773

    Read the article

  • Help with malloc and free: Glibc detected: free(): invalid pointer

    - by nunos
    I need help with debugging this piece of code. I know the problem is in malloc and free but can't find exactly where, why and how to fix it. Please don't answer: "Use gdb" and that's it. I would use gdb to debug it, but I still don't know much about it and am still learning it, and would like to have, in the meanwhile, another solution. Thanks. #include <stdio.h> #include <stdlib.h> #include <ctype.h> #include <unistd.h> #include <string.h> #include <sys/wait.h> #include <sys/types.h> #define MAX_COMMAND_LENGTH 256 #define MAX_ARGS_NUMBER 128 #define MAX_HISTORY_NUMBER 100 #define PROMPT ">>> " int num_elems; typedef enum {false, true} bool; typedef struct { char **arg; char *infile; char *outfile; int background; } Command_Info; int parse_cmd(char *cmd_line, Command_Info *cmd_info) { char *arg; char *args[MAX_ARGS_NUMBER]; int i = 0; arg = strtok(cmd_line, " "); while (arg != NULL) { args[i] = arg; arg = strtok(NULL, " "); i++; } num_elems = i;precisa em free_mem if (num_elems == 0) return 0; cmd_info->arg = (char **) ( malloc(num_elems * sizeof(char *)) ); cmd_info->infile = NULL; cmd_info->outfile = NULL; cmd_info->background = 0; bool b_infile = false; bool b_outfile = false; int iarg = 0; for (i = 0; i < num_elems; i++) { if ( !strcmp(args[i], "<") ) { if ( b_infile || i == num_elems-1 || !strcmp(args[i+1], "<") || !strcmp(args[i+1], ">") || !strcmp(args[i+1], "&") ) return -1; i++; cmd_info->infile = malloc(strlen(args[i]) * sizeof(char)); strcpy(cmd_info->infile, args[i]); b_infile = true; } else if (!strcmp(args[i], ">")) { if ( b_outfile || i == num_elems-1 || !strcmp(args[i+1], ">") || !strcmp(args[i+1], "<") || !strcmp(args[i+1], "&") ) return -1; i++; cmd_info->outfile = malloc(strlen(args[i]) * sizeof(char)); strcpy(cmd_info->outfile, args[i]); b_outfile = true; } else if (!strcmp(args[i], "&")) { if ( i == 0 || i != num_elems-1 || cmd_info->background ) return -1; cmd_info->background = true; } else { cmd_info->arg[iarg] = malloc(strlen(args[i]) * sizeof(char)); strcpy(cmd_info->arg[iarg], args[i]); iarg++; } } cmd_info->arg[iarg] = NULL; return 0; } void print_cmd(Command_Info *cmd_info) { int i; for (i = 0; cmd_info->arg[i] != NULL; i++) printf("arg[%d]=\"%s\"\n", i, cmd_info->arg[i]); printf("arg[%d]=\"%s\"\n", i, cmd_info->arg[i]); printf("infile=\"%s\"\n", cmd_info->infile); printf("outfile=\"%s\"\n", cmd_info->outfile); printf("background=\"%d\"\n", cmd_info->background); } void get_cmd(char* str) { fgets(str, MAX_COMMAND_LENGTH, stdin); str[strlen(str)-1] = '\0'; } pid_t exec_simple(Command_Info *cmd_info) { pid_t pid = fork(); if (pid < 0) { perror("Fork Error"); return -1; } if (pid == 0) { if ( (execvp(cmd_info->arg[0], cmd_info->arg)) == -1) { perror(cmd_info->arg[0]); exit(1); } } return pid; } void type_prompt(void) { printf("%s", PROMPT); } void syntax_error(void) { printf("msh syntax error\n"); } void free_mem(Command_Info *cmd_info) { int i; for (i = 0; cmd_info->arg[i] != NULL; i++) free(cmd_info->arg[i]); free(cmd_info->arg); free(cmd_info->infile); free(cmd_info->outfile); } int main(int argc, char* argv[]) { char cmd_line[MAX_COMMAND_LENGTH]; Command_Info cmd_info; //char* history[MAX_HISTORY_NUMBER]; while (true) { type_prompt(); get_cmd(cmd_line); if ( parse_cmd(cmd_line, &cmd_info) == -1) { syntax_error(); continue; } if (!strcmp(cmd_line, "")) continue; if (!strcmp(cmd_info.arg[0], "exit")) exit(0); pid_t pid = exec_simple(&cmd_info); waitpid(pid, NULL, 0); free_mem(&cmd_info); } return 0; }

    Read the article

  • Ethernet Communication Error

    - by SivaKumar
    Hi, I wrote a program to query the status of the Ethernet printer for that i created a TCP Stream Socket and i send the query command to the printer.In case of Error less condition it returns No error status but in error case its getting hang at recv command.Even i used Non blocking now the recv command returns nothing and error set as Resource temporarily unavailable. code: #include <stdio.h> #include <sys/types.h> #include <sys/socket.h> #include <netinet/in.h> #include <netdb.h> #include <string.h> #include <unistd.h> #include <arpa/inet.h> #include <errno.h> #include <stdlib.h> #include <fcntl.h> #include <sys/ioctl.h> #include <sys/socket.h> #include <signal.h> #include <termios.h> #include <poll.h> #include <netinet/tcp.h> #include <stdarg.h> int main() { int ConnectSocket,ConnectSocket1,select_err,err,nRet,nBytesRead; struct timeval waitTime = {10,30}; fd_set socket_set; unsigned char * dataBuf = NULL; unsigned char tempVar, tempVar1, tempVar2, tempVar3; char reset[] = "\033E 2\r"; char print[] = "\033A 1\r"; char buf[1024]={0}; ConnectSocket = socket(AF_INET, SOCK_STREAM, IPPROTO_TCP); printf("The Socket ID is %d\n",ConnectSocket); if (ConnectSocket < 0) { perror("socket()"); return 0; } struct sockaddr_in clientService; clientService.sin_family = AF_INET; clientService.sin_addr.s_addr = inet_addr("192.168.0.129"); //Printer IP clientService.sin_port = htons( 9100); // Printer Port if ( connect( ConnectSocket, (struct sockaddr*) &clientService, sizeof(clientService) ) == -1) { perror("connect()"); close(ConnectSocket); return -1; } /* if((nRet = ioctl(ConnectSocket , FIONREAD, &nBytesRead) == -1)) { perror("ioctl()"); } perror("ioctl()"); */ FD_ZERO(&socket_set); FD_SET(ConnectSocket, &socket_set); do { errno=0; select_err = select(ConnectSocket+1, NULL, &socket_set, NULL, &waitTime); }while(errno==EINPROGRESS); if (-1 == select_err || 0 == select_err) { int optVal = 0; int optLen = sizeof(optVal); if(select_err == -1) { perror("select() write-side"); } else { //Timeout errno=0; err = getsockopt(ConnectSocket, SOL_SOCKET, SO_ERROR, (char*)&optVal, &optLen); printf("the return of the getsockopt is %d\n",err); printf("the opt val is %s\n",(char*)optVal); perror("getsockopt()"); if(err == -1) { perror("getsockopt() write-side"); } } printf("Select Failed during write - ConnectSocket: %d\n", ConnectSocket); //close(ConnectSocket); return -1; } err = send(ConnectSocket,print,sizeof(print)-1, 0); printf("\n No of Bytes Send is %d\n",err); if(err == -1 || err ==0) { perror("send()"); //close(ConnectSocket); return -1; } FD_ZERO(&socket_set); FD_SET(ConnectSocket, &socket_set); do { errno=0; select_err = select(ConnectSocket+1, NULL, &socket_set, NULL, &waitTime); }while(errno==EINPROGRESS); if (-1 == select_err || 0 == select_err) { printf("Select Failed during write - ConnectSocket: %d\n", ConnectSocket); return -1; } err = send(ConnectSocket,reset,sizeof(reset)-1, 0); printf("\n No of Bytes Send is %d\n",err); if(err == -1 || err ==0) { perror("send()"); //close(ConnectSocket); return -1; } FD_ZERO(&socket_set); FD_SET(ConnectSocket, &socket_set); printf("i am in reading \n"); select_err = select(ConnectSocket+1, &socket_set, NULL, NULL, &waitTime); printf("the retun of the read side select is %d \n",select_err); perror("select()"); if (-1 == select_err|| 0 == select_err) { printf("Read timeout; ConnectSocket: %d\n", ConnectSocket); close(ConnectSocket); perror("close()"); return -1; } printf("Before Recv\n"); nBytesRead = recv(ConnectSocket , buf, 1024, 0); printf("No of Bytes read is %d\n",nBytesRead); printf("%s\n",buf); if(nBytesRead == -1) { perror("recv()"); close(ConnectSocket); perror("clode()"); return -1; } close(ConnectSocket); return 1; }

    Read the article

  • Accessing a Service from within an XNA Content Pipeline Extension

    - by David Wallace
    I need to allow my content pipeline extension to use a pattern similar to a factory. I start with a dictionary type: public delegate T Mapper<T>(MapFactory<T> mf, XElement d); public class MapFactory<T> { Dictionary<string, Mapper<T>> map = new Dictionary<string, Mapper<T>>(); public void Add(string s, Mapper<T> m) { map.Add(s, m); } public T Get(XElement xe) { if (xe == null) throw new ArgumentNullException( "Invalid document"); var key = xe.Name.ToString(); if (!map.ContainsKey(key)) throw new ArgumentException( key + " is not a valid key."); return map[key](this, xe); } public IEnumerable<T> GetAll(XElement xe) { if (xe == null) throw new ArgumentNullException( "Invalid document"); foreach (var e in xe.Elements()) { var val = e.Name.ToString(); if (map.ContainsKey(val)) yield return map[val](this, e); } } } Here is one type of object I want to store: public partial class TestContent { // Test type public string title; // Once test if true public bool once; // Parameters public Dictionary<string, object> args; public TestContent() { title = string.Empty; args = new Dictionary<string, object>(); } public TestContent(XElement xe) { title = xe.Name.ToString(); args = new Dictionary<string, object>(); xe.ParseAttribute("once", once); } } XElement.ParseAttribute is an extension method that works as one might expect. It returns a boolean that is true if successful. The issue is that I have many different types of tests, each of which populates the object in a way unique to the specific test. The element name is the key to MapFactory's dictionary. This type of test, while atypical, illustrates my problem. public class LogicTest : TestBase { string opkey; List<TestBase> items; public override bool Test(BehaviorArgs args) { if (items == null) return false; if (items.Count == 0) return false; bool result = items[0].Test(args); for (int i = 1; i < items.Count; i++) { bool other = items[i].Test(args); switch (opkey) { case "And": result &= other; if (!result) return false; break; case "Or": result |= other; if (result) return true; break; case "Xor": result ^= other; break; case "Nand": result = !(result & other); break; case "Nor": result = !(result | other); break; default: result = false; break; } } return result; } public static TestContent Build(MapFactory<TestContent> mf, XElement xe) { var result = new TestContent(xe); string key = "Or"; xe.GetAttribute("op", key); result.args.Add("key", key); var names = mf.GetAll(xe).ToList(); if (names.Count() < 2) throw new ArgumentException( "LogicTest requires at least two entries."); result.args.Add("items", names); return result; } } My actual code is more involved as the factory has two dictionaries, one that turns an XElement into a content type to write and another used by the reader to create the actual game objects. I need to build these factories in code because they map strings to delegates. I have a service that contains several of these factories. The mission is to make these factory classes available to a content processor. Neither the processor itself nor the context it uses as a parameter have any known hooks to attach an IServiceProvider or equivalent. Any ideas?

    Read the article

  • migrating webclient to WCF; WCF client serializes parametername of method

    - by Wouter
    I'm struggling with migrating from webservice/webclient architecture to WCF architecture. The object are very complex, with lots of nested xsd's and different namespaces. Proxy classes are generated by adding a Web Reference to an original wsdl with 30+ webmethods and using xsd.exe for generating the missing SOAPFault objects. My pilot WCF Service consists of only 1 webmethod which matches the exact syntax of one of the original methods: 1 object as parameter, returning 1 other object as result value. I greated a WCF Interface using those proxy classes, using attributes: XMLSerializerFormat and ServiceContract on the interface, OperationContract on one method from original wsdl specifying Action, ReplyAction, all with the proper namespaces. I create incoming client messages using SoapUI; I generated a project from the original WSDL files (causing the SoapUI project to have 30+ methods) and created one new Request at the one implemented WebMethod, changed the url to my wcf webservice and send the message. Because of the specified (Reply-)Action in the OperationContractAttribute, the message is actually received and properly deserialized into an object. To get this far (40 hours of googling), a lot of frustration led me to using a custom endpoint in which the WCF 'wrapped tags' are removed, the namespaces for nested types are corrected, and the generated wsdl get's flattened (for better compatibility with other tools then MS VisualStudio). Interface code is this: [XmlSerializerFormat(Use = OperationFormatUse.Literal, Style = OperationFormatStyle.Document, SupportFaults = true)] [ServiceContract(Namespace = Constants.NamespaceStufZKN)] public interface IOntvangAsynchroon { [OperationContract(Action = Constants.NamespaceStufZKN + "/zakLk01", ReplyAction = Constants.NamespaceStufZKN + "/zakLk01", Name = "zakLk01")] [FaultContract(typeof(Fo03Bericht), Namespace = Constants.NamespaceStuf)] Bv03Bericht zakLk01([XmlElement("zakLk01", Namespace = Constants.NamespaceStufZKN)] ZAKLk01 zakLk011); When I use a Webclient in code to send a message, everything works. My problem is, when I use a WCF client. I use ChannelFactory< IOntvangAsynchroon to send a message. But the generated xml looks different: it includes the parametername of the method! It took me a lot of time to figure this one out, but here's what happens: Correct xml (stripped soap envelope): <soap:Body> <zakLk01 xmlns="http://www.egem.nl/StUF/sector/zkn/0310"> <stuurgegevens> <berichtcode xmlns="http://www.egem.nl/StUF/StUF0301">Bv01</berichtcode> <zender xmlns="http://www.egem.nl/StUF/StUF0301"> <applicatie>ONBEKEND</applicatie> </zender> </stuurgegevens> <parameters> </parameters> </zakLk01> </soap:Body> Bad xml: <soap:Body> <zakLk01 xmlns="http://www.egem.nl/StUF/sector/zkn/0310"> <zakLk011> <stuurgegevens> <berichtcode xmlns="http://www.egem.nl/StUF/StUF0301">Bv01</berichtcode> <zender xmlns="http://www.egem.nl/StUF/StUF0301"> <applicatie>ONBEKEND</applicatie> </zender> </stuurgegevens> <parameters> </parameters> </zakLk011> </zakLk01> </soap:Body> Notice the 'zakLk011' element? It is the name of the parameter of the method in my interface! So NOW it is zakLk011, but it when my parameter name was 'zakLk01', the xml seemed to contain some magical duplicate of the tag above, but without namespace. Of course, you can imagine me going crazy over what was happening before finding out it was the parametername! I know have actually created a WCF Service, at which I cannot send messages using a WCF Client anymore. For clarity: The method does get invoked using the WCF Client on my webservice, but the parameter object is empty. Because I'm using a custom endpoint to log the incoming xml, I can see the message is received fine, but just with the wrong syntax! WCF client code: ZAKLk01 stufbericht = MessageFactory.CreateZAKLk01(); ChannelFactory<IOntvangAsynchroon> factory = new ChannelFactory<IOntvangAsynchroon>(new BasicHttpBinding(), new EndpointAddress("http://localhost:8193/Roxit/Link/zkn0310")); factory.Endpoint.Behaviors.Add(new LinkEndpointBehavior()); IOntvangAsynchroon client = factory.CreateChannel(); client.zakLk01(stufbericht); I am not using a generated client, i just reference the webservice like i am lot's of times. Can anyone please help me? I can't google anything on this...

    Read the article

  • [SOLVED] Iphone NSXMLParser NSCFString memory leak

    - by atticusalien
    I am building an app that parses an rss feed. In the app there are two different types of feeds with different names for the elements in the feed, so I have created an NSXMLParser NSObject that takes the name of the elements of each feed before parsing. Here is my code: NewsFeedParser.h #import @interface NewsFeedParser : NSObject { NSInteger NewsSelectedCategory; NSXMLParser *NSXMLNewsParser; NSMutableArray *newsCategories; NSMutableDictionary *NewsItem; NSMutableString *NewsCurrentElement, *NewsCurrentElement1, *NewsCurrentElement2, *NewsCurrentElement3; NSString *NewsItemType, *NewsElement1, *NewsElement2, *NewsElement3; NSInteger NewsNumElements; } - (void) parseXMLFileAtURL:(NSString *)URL; @property(nonatomic, retain) NSString *NewsItemType; @property(nonatomic, retain) NSString *NewsElement1; @property(nonatomic, retain) NSString *NewsElement2; @property(nonatomic, retain) NSString *NewsElement3; @property(nonatomic, retain) NSMutableArray *newsCategories; @property(assign, nonatomic) NSInteger NewsNumElements; @end NewsFeedParser.m #import "NewsFeedParser.h" @implementation NewsFeedParser @synthesize NewsItemType; @synthesize NewsElement1; @synthesize NewsElement2; @synthesize NewsElement3; @synthesize newsCategories; @synthesize NewsNumElements; - (void)parserDidStartDocument:(NSXMLParser *)parser{ } - (void)parseXMLFileAtURL:(NSString *)URL { newsCategories = [[NSMutableArray alloc] init]; URL = [URL stringByReplacingOccurrencesOfString:@" " withString:@""]; URL = [URL stringByReplacingOccurrencesOfString:@"\n" withString:@""]; URL = [URL stringByReplacingOccurrencesOfString:@" " withString:@""]; //you must then convert the path to a proper NSURL or it won't work NSURL *xmlURL = [NSURL URLWithString:URL]; // here, for some reason you have to use NSClassFromString when trying to alloc NSXMLParser, otherwise you will get an object not found error // this may be necessary only for the toolchain [[NSURLCache sharedURLCache] setMemoryCapacity:0]; [[NSURLCache sharedURLCache] setDiskCapacity:0]; NSXMLNewsParser = [[NSXMLParser alloc] initWithContentsOfURL:xmlURL]; // Set self as the delegate of the parser so that it will receive the parser delegate methods callbacks. [NSXMLNewsParser setDelegate:self]; // Depending on the XML document you're parsing, you may want to enable these features of NSXMLParser. [NSXMLNewsParser setShouldProcessNamespaces:NO]; [NSXMLNewsParser setShouldReportNamespacePrefixes:NO]; [NSXMLNewsParser setShouldResolveExternalEntities:NO]; [NSXMLNewsParser parse]; [NSXMLNewsParser release]; } - (void)parser:(NSXMLParser *)parser parseErrorOccurred:(NSError *)parseError { NSString * errorString = [NSString stringWithFormat:@"Unable to download story feed from web site (Error code %i )", [parseError code]]; NSLog(@"error parsing XML: %@", errorString); UIAlertView * errorAlert = [[UIAlertView alloc] initWithTitle:@"Error loading content" message:errorString delegate:self cancelButtonTitle:@"OK" otherButtonTitles:nil]; [errorAlert show]; [errorAlert release]; [errorString release]; } - (void)parser:(NSXMLParser *)parser didStartElement:(NSString *)elementName namespaceURI:(NSString *)namespaceURI qualifiedName:(NSString *)qName attributes:(NSDictionary *)attributeDict{ NewsCurrentElement = [elementName copy]; if ([elementName isEqualToString:NewsItemType]) { // clear out our story item caches... NewsItem = [[NSMutableDictionary alloc] init]; NewsCurrentElement1 = [[NSMutableString alloc] init]; NewsCurrentElement2 = [[NSMutableString alloc] init]; if(NewsNumElements == 3) { NewsCurrentElement3 = [[NSMutableString alloc] init]; } } } - (void)parser:(NSXMLParser *)parser didEndElement:(NSString *)elementName namespaceURI:(NSString *)namespaceURI qualifiedName:(NSString *)qName{ if ([elementName isEqualToString:NewsItemType]) { // save values to an item, then store that item into the array... [NewsItem setObject:NewsCurrentElement1 forKey:NewsElement1]; [NewsItem setObject:NewsCurrentElement2 forKey:NewsElement2]; if(NewsNumElements == 3) { [NewsItem setObject:NewsCurrentElement3 forKey:NewsElement3]; } [newsCategories addObject:[[NewsItem copy] autorelease]]; [NewsCurrentElement release]; [NewsCurrentElement1 release]; [NewsCurrentElement2 release]; if(NewsNumElements == 3) { [NewsCurrentElement3 release]; } [NewsItem release]; } } - (void)parser:(NSXMLParser *)parser foundCharacters:(NSString *)string { //NSLog(@"found characters: %@", string); // save the characters for the current item... if ([NewsCurrentElement isEqualToString:NewsElement1]) { [NewsCurrentElement1 appendString:string]; } else if ([NewsCurrentElement isEqualToString:NewsElement2]) { [NewsCurrentElement2 appendString:string]; } else if (NewsNumElements == 3 && [NewsCurrentElement isEqualToString:NewsElement3]) { [NewsCurrentElement3 appendString:string]; } } - (void)dealloc { [super dealloc]; [newsCategories release]; [NewsItemType release]; [NewsElement1 release]; [NewsElement2 release]; [NewsElement3 release]; } When I create an instance of the class I do like so: NewsFeedParser *categoriesParser = [[NewsFeedParser alloc] init]; if(newsCat == 0) { categoriesParser.NewsItemType = @"article"; categoriesParser.NewsElement1 = @"category"; categoriesParser.NewsElement2 = @"catid"; } else { categoriesParser.NewsItemType = @"article"; categoriesParser.NewsElement1 = @"category"; categoriesParser.NewsElement2 = @"feedUrl"; } [categoriesParser parseXMLFileAtURL:feedUrl]; newsCategories = [[NSMutableArray alloc] initWithArray:categoriesParser.newsCategories copyItems:YES]; [self.tableView reloadData]; [categoriesParser release]; If I run the app with the leaks instrument, the leaks point to the [NSXMLNewsParser parse] call in the NewsFeedParser.m. Here is a screen shot of the Leaks instrument with the NSCFStrings leaking: http://img139.imageshack.us/img139/3997/leaks.png For the life of me I can't figure out where these leaks are coming from. Any help would be greatly appreciated.

    Read the article

  • Is there an equivalent to Java's ClassFileTransformer in .NET? (a way to replace a class)

    - by Alix
    I've been searching for this for quite a while with no luck so far. Is there an equivalent to Java's ClassFileTransformer in .NET? Basically, I want to create a class CustomClassFileTransformer (which in Java would implement the interface ClassFileTransformer) that gets called whenever a class is loaded, and is allowed to tweak it and replace it with the tweaked version. I know there are frameworks that do similar things, but I was looking for something more straightforward, like implementing my own ClassFileTransformer. Is it possible? EDIT #1. More details about why I need this: Basically, I have a C# application and I need to monitor the instructions it wants to run in order to detect read or write operations to fields (operations Ldfld and Stfld) and insert some instructions before the read/write takes place. I know how to do this (except for the part where I need to be invoked to replace the class): for every method whose code I want to monitor, I must: Get the method's MethodBody using MethodBase.GetMethodBody() Transform it to byte array with MethodBody.GetILAsByteArray(). The byte[] it returns contains the bytecode. Analyse the bytecode as explained here, possibly inserting new instructions or deleting/modifying existing ones by changing the contents of the array. Create a new method and use the new bytecode to create its body, with MethodBuilder.CreateMethodBody(byte[] il, int count), where il is the array with the bytecode. I put all these tweaked methods in a new class and use the new class to replace the one that was originally going to be loaded. An alternative to replacing classes would be somehow getting notified whenever a method is invoked. Then I'd replace the call to that method with a call to my own tweaked method, which I would tweak only the first time is invoked and then I'd put it in a dictionary for future uses, to reduce overhead (for future calls I'll just look up the method and invoke it; I won't need to analyse the bytecode again). I'm currently investigating ways to do this and LinFu looks pretty interesting, but if there was something like a ClassFileTransformer it would be much simpler: I just rewrite the class, replace it, and let the code run without monitoring anything. An additional note: the classes may be sealed. I want to be able to replace any kind of class, I cannot impose restrictions on their attributes. EDIT #2. Why I need to do this at runtime. I need to monitor everything that is going on so that I can detect every access to data. This applies to the code of library classes as well. However, I cannot know in advance which classes are going to be used, and even if I knew every possible class that may get loaded it would be a huge performance hit to tweak all of them instead of waiting to see whether they actually get invoked or not. POSSIBLE (BUT PRETTY HARDCORE) SOLUTION. In case anyone is interested (and I see the question has been faved, so I guess someone is), this is what I'm looking at right now. Basically I'd have to implement the profiling API and I'll register for the events that I'm interested in, in my case whenever a JIT compilation starts. An extract of the blogpost: In your ICorProfilerCallback2::ModuleLoadFinished callback, you call ICorProfilerInfo2::GetModuleMetadata to get a pointer to a metadata interface on that module. QI for the metadata interface you want. Search MSDN for "IMetaDataImport", and grope through the table of contents to find topics on the metadata interfaces. Once you're in metadata-land, you have access to all the types in the module, including their fields and function prototypes. You may need to parse metadata signatures and this signature parser may be of use to you. In your ICorProfilerCallback2::JITCompilationStarted callback, you may use ICorProfilerInfo2::GetILFunctionBody to inspect the original IL, and ICorProfilerInfo2::GetILFunctionBodyAllocator and then ICorProfilerInfo2::SetILFunctionBody to replace that IL with your own. The great news: I get notified when a JIT compilation starts and I can replace the bytecode right there, without having to worry about replacing the class, etc. The not-so-great news: you cannot invoke managed code from the API's callback methods, which makes sense but means I'm on my own parsing the IL code, etc, as opposed to be able to use Cecil, which would've been a breeze. I don't think there's a simpler way to do this without using AOP frameworks (such as PostSharp). If anyone has any other idea please let me know. I'm not marking the question as answered yet.

    Read the article

  • Threading extra state through a parser in Scala

    - by Travis Brown
    I'll give you the tl;dr up front I'm trying to use the state monad transformer in Scalaz 7 to thread extra state through a parser, and I'm having trouble doing anything useful without writing a lot of t m a -> t m b versions of m a -> m b methods. An example parsing problem Suppose I have a string containing nested parentheses with digits inside them: val input = "((617)((0)(32)))" I also have a stream of fresh variable names (characters, in this case): val names = Stream('a' to 'z': _*) I want to pull a name off the top of the stream and assign it to each parenthetical expression as I parse it, and then map that name to a string representing the contents of the parentheses, with the nested parenthetical expressions (if any) replaced by their names. To make this more concrete, here's what I'd want the output to look like for the example input above: val target = Map( 'a' -> "617", 'b' -> "0", 'c' -> "32", 'd' -> "bc", 'e' -> "ad" ) There may be either a string of digits or arbitrarily many sub-expressions at a given level, but these two kinds of content won't be mixed in a single parenthetical expression. To keep things simple, we'll assume that the stream of names will never contain either duplicates or digits, and that it will always contain enough names for our input. Using parser combinators with a bit of mutable state The example above is a slightly simplified version of the parsing problem in this Stack Overflow question. I answered that question with a solution that looked roughly like this: import scala.util.parsing.combinator._ class ParenParser(names: Iterator[Char]) extends RegexParsers { def paren: Parser[List[(Char, String)]] = "(" ~> contents <~ ")" ^^ { case (s, m) => (names.next -> s) :: m } def contents: Parser[(String, List[(Char, String)])] = "\\d+".r ^^ (_ -> Nil) | rep1(paren) ^^ ( ps => ps.map(_.head._1).mkString -> ps.flatten ) def parse(s: String) = parseAll(paren, s).map(_.toMap) } It's not too bad, but I'd prefer to avoid the mutable state. What I want Haskell's Parsec library makes adding user state to a parser trivially easy: import Control.Applicative ((*>), (<$>), (<*)) import Data.Map (fromList) import Text.Parsec paren = do (s, m) <- char '(' *> contents <* char ')' h : t <- getState putState t return $ (h, s) : m where contents = flip (,) [] <$> many1 digit <|> (\ps -> (map (fst . head) ps, concat ps)) <$> many1 paren main = print $ runParser (fromList <$> paren) ['a'..'z'] "example" "((617)((0)(32)))" This is a fairly straightforward translation of my Scala parser above, but without mutable state. What I've tried I'm trying to get as close to the Parsec solution as I can using Scalaz's state monad transformer, so instead of Parser[A] I'm working with StateT[Parser, Stream[Char], A]. I have a "solution" that allows me to write the following: import scala.util.parsing.combinator._ import scalaz._, Scalaz._ object ParenParser extends ExtraStateParsers[Stream[Char]] with RegexParsers { protected implicit def monadInstance = parserMonad(this) def paren: ESP[List[(Char, String)]] = (lift("(" ) ~> contents <~ lift(")")).flatMap { case (s, m) => get.flatMap( names => put(names.tail).map(_ => (names.head -> s) :: m) ) } def contents: ESP[(String, List[(Char, String)])] = lift("\\d+".r ^^ (_ -> Nil)) | rep1(paren).map( ps => ps.map(_.head._1).mkString -> ps.flatten ) def parse(s: String, names: Stream[Char]) = parseAll(paren.eval(names), s).map(_.toMap) } This works, and it's not that much less concise than either the mutable state version or the Parsec version. But my ExtraStateParsers is ugly as sin—I don't want to try your patience more than I already have, so I won't include it here (although here's a link, if you really want it). I've had to write new versions of every Parser and Parsers method I use above for my ExtraStateParsers and ESP types (rep1, ~>, <~, and |, in case you're counting). If I had needed to use other combinators, I'd have had to write new state transformer-level versions of them as well. Is there a cleaner way to do this? I'd love to see an example of a Scalaz 7's state monad transformer being used to thread state through a parser, but Scala 6 or Haskell examples would also be useful.

    Read the article

  • Problem with From field in contact form and mail() function

    - by Matthew
    I've got a contact form with 3 fields and a textarea... I use jQuery to validate it and then php to send emails. This contact form works fine but, when I receive an email, From field isn't correct. I'd like to want that From field shows text typed in the Name field of the contact form. Now I get a From field like this: <[email protected]> For example, if an user types "Matthew" in the name field, I'd like to want that this word "Matthew" appears in the From field. This is my code (XHTML, jQuery, PHP): <div id="contact"> <h3 id="formHeader">Send Us a Message!</h3> <form id="contactForm" method="post" action=""> <div id="risposta"></div> <!-- End Risposta Div --> <span>Name:</span> <input type="text" id="formName" value="" /><br /> <span>E-mail:</span> <input type="text" id="formEmail" value="" /><br /> <span>Subject:</span> <input type="text" id="formSubject" value="" /><br /> <span>Message:</span> <textarea id="formMessage" rows="9" cols="20"></textarea><br /> <input type="submit" id="formSend" value="Send" /> </form> </div> <script type="text/javascript"> $(document).ready(function(){ $("#formSend").click(function(){ var valid = ''; var nome = $("#formName").val(); var mail = $("#formEmail").val(); var oggetto = $("#formSubject").val(); var messaggio = $("#formMessage").val(); if (nome.length<1) { valid += '<span>Name field empty.</span><br />'; } if (!mail.match(/^([a-z0-9._-]+@[a-z0-9._-]+\.[a-z]{2,4}$)/i)) { valid += '<span>Email not valid or empty field.</span><br />'; } if (oggetto.length<1) { valid += '<span>Subject field empty.</span><br />'; } if (valid!='') { $("#risposta").fadeIn("slow"); $("#risposta").html("<span><b>Error:</b></span><br />"+valid); $("#risposta").css("background-color","#ffc0c0"); } else { var datastr ='nome=' + nome + '&mail=' + mail + '&oggetto=' + oggetto + '&messaggio=' + encodeURIComponent(messaggio); $("#risposta").css("display", "block"); $("#risposta").css("background-color","#FFFFA0"); $("#risposta").html("<span>Sending message...</span>"); $("#risposta").fadeIn("slow"); setTimeout("send('"+datastr+"')",2000); } return false; }); }); function send(datastr){ $.ajax({ type: "POST", url: "contactForm.php", data: datastr, cache: false, success: function(html) { $("#risposta").fadeIn("slow"); $("#risposta").html('<span>Message successfully sent.</span>'); $("#risposta").css("background-color","#e1ffc0"); setTimeout('$("#risposta").fadeOut("slow")',2000); } }); } </script> <?php $mail = $_POST['mail']; $nome = $_POST['nome']; $oggetto = $_POST['oggetto']; $text = $_POST['messaggio']; $ip = $_SERVER['REMOTE_ADDR']; $to = "[email protected]"; $message = $text."<br /><br />IP: ".$ip."<br />"; $headers = "From: $nome \n"; $headers .= "Reply-To: $mail \n"; $headers .= "MIME-Version: 1.0 \n"; $headers .= "Content-Type: text/html; charset=UTF-8 \n"; mail($to, $oggetto, $message, $headers); ?>

    Read the article

  • setIncludesSubentities: in an NSFetchRequest is broken for entities across multiple persistent store

    - by SG
    Prior art which doesn't quite address this: http://stackoverflow.com/questions/1774359/core-data-migration-error-message-model-does-not-contain-configuration-xyz I have narrowed this down to a specific issue. It takes a minute to set up, though; please bear with me. The gist of the issue is that a persistentStoreCoordinator (apparently) cannot preserve the part of an object graph where a managedObject is marked as a subentity of another when they are stored in different files. Here goes... 1) I have 2 xcdatamodel files, each containing a single entity. In runtime, when the managed object model is constructed, I manually define one entity as subentity of another using setSubentities:. This is because defining subentities across multiple files in the editor is not supported yet. I then return the complete model with modelByMergingModels. //Works! [mainEntity setSubentities:canvasEntities]; NSLog(@"confirm %@ is super for %@", [[[canvasEntities lastObject] superentity] name], [[canvasEntities lastObject] name]); //Output: "confirm Note is super for Browser" 2) I have modified the persistentStoreCoordinator method so that it sets a different store for each entity. Technically, it uses configurations, and each entity has one and only one configuration defined. //Also works! for ( NSString *configName in [[HACanvasPluginManager shared].registeredCanvasTypes valueForKey:@"viewControllerClassName"] ) { storeUrl = [NSURL fileURLWithPath:[[self applicationDocumentsDirectory] stringByAppendingPathComponent:[configName stringByAppendingPathExtension:@"sqlite"]]]; //NSLog(@"entities for configuration '%@': %@", configName, [[[self managedObjectModel] entitiesForConfiguration:configName] valueForKey:@"name"]); //Output: "entities for configuration 'HATextCanvasController': (Note)" //Output: "entities for configuration 'HAWebCanvasController': (Browser)" if (![persistentStoreCoordinator addPersistentStoreWithType:NSSQLiteStoreType configuration:configName URL:storeUrl options:options error:&error]) //etc 3) I have a fetchRequest set for the parent entity, with setIncludesSubentities: and setAffectedStores: just to be sure we get both 1) and 2) covered. When inserting objects of either entity, they both are added to the context and they both are fetched by the fetchedResultsController and displayed in the tableView as expected. // Create the fetch request for the entity. NSFetchRequest *fetchRequest = [[NSFetchRequest alloc] init]; [fetchRequest setEntity:entity]; [fetchRequest setIncludesSubentities:YES]; //NECESSARY to fetch all canvas types [fetchRequest setSortDescriptors:sortDescriptors]; [fetchRequest setFetchBatchSize:20]; // Set the batch size to a suitable number. [fetchRequest setAffectedStores:[[managedObjectContext persistentStoreCoordinator] persistentStores]]; [fetchRequest setReturnsObjectsAsFaults:NO]; Here is where it starts misbehaving: after closing and relaunching the app, ONLY THE PARENT ENTITY is fetched. If I change the entity of the request using setEntity: to the entity for 'Note', all notes are fetched. If I change it to the entity for 'Browser', all the browsers are fetched. Let me reiterate that during the run in which an object is first inserted into the context, it will appear in the list. It is only after save and relaunch that a fetch request fails to traverse the hierarchy. Therefore, I can only conclude that it is the storage of the inheritance that is the problem. Let's recap why: - Both entities can be created, inserted into the context, and viewed, so the model is working - Both entities can be fetched with a single request, so the inheritance is working - I can confirm that the files are being stored separately and objects are going into their appropriate stores, so saving is working - Launching the app with either entity set for the request works, so retrieval from the store is working - This also means that traversing different stores with the request is working - By using a single store instead of multiple, the problem goes away completely, so creating, storing, fetching, viewing etc is working correctly. This leaves only one culprit (to my mind): the inheritance I'm setting with setSubentities: is effective only for objects creating during the session. Either objects/entities are being stored stripped of the inheritance info, or entity inheritance as defined programmatically only applies to new instances, or both. Either of these is unacceptable. Either it's a bug or I am way, way off course. I have been at this every which way for two days; any insight is greatly appreciated. The current workaround - just using a single store - works completely, except it won't be future-proof in the event that I remove one of the models from the app etc. It also boggles the mind because I can't see why you would have all this infrastructure for storing across multiple stores and for setting affected stores in fetch requests if it by core definition (of setSubentities:) doesn't work.

    Read the article

  • Intellij Idea 13.x and ASM 5.x library incompatible?

    - by Jarrod Roberson
    I can't get Intellij Idea 13.0 to compile my code against ASM 5.0.3 I have a multi-module Maven project. It compiles and installs successfully. Apparently com.google.findbugs:findbugs has a dependency on asm:asm:3.3 and I want to use org.ow2.asm:asm:5.0.3 to manipulate some bytecode. So in the parent pom.xml I exclude the asm:asm:3.3 dependencies from the classpath. This works fine when I run mvn install from the command line. I can't get the Build - Make Project menu selection to work in Intellij Idea. Here is the relevant parts of my pom.xml files. parent.pom <dependency> <groupId>org.ow2.asm</groupId> <artifactId>asm</artifactId> <version>5.0.3</version> </dependency> <dependency> <groupId>org.ow2.asm</groupId> <artifactId>asm-tree</artifactId> <version>5.0.3</version> </dependency> <dependency> <groupId>org.ow2.asm</groupId> <artifactId>asm-util</artifactId> <version>5.0.3</version> </dependency> <dependency> <groupId>org.ow2.asm</groupId> <artifactId>asm-commons</artifactId> <version>5.0.3</version> </dependency> <dependency> <groupId>com.google.code.findbugs</groupId> <artifactId>findbugs</artifactId> <version>2.0.3</version> <exclusions> <exclusion> <groupId>asm</groupId> <artifactId>asm</artifactId> </exclusion> <exclusion> <groupId>asm</groupId> <artifactId>asm-commons</artifactId> </exclusion> <exclusion> <groupId>asm</groupId> <artifactId>asm-tree</artifactId> </exclusion> </exclusions> </dependency> Here is the code that is failing 18 public static void main(final String[] args) throws IOException 19 { 20 final InputStream is = NotEmptyTest.class.getResourceAsStream("/com/vertigrated/annotation/NotEmptyTest.class"); 21 final ClassReader cr = new ClassReader(is); 22 final ClassNode cn = new ClassNode(); 23 cr.accept(cn, 0); 24 for (final MethodNode mn : cn.methods) 25 { 26 - 38 snipped for brevity 39 } 40 } 41 } Here is the error message: Information:Using javac 1.7.0_25 to compile java sources Information:java: Errors occurred while compiling module 'tests' Information:Compilation completed with 1 error and 2 warnings in 2 sec Information:1 error Information:2 warnings /<path to my source code>/NotEmptyTest.java Error:Error:line (24)java: incompatible types required: org.objectweb.asm.tree.MethodNode found: java.lang.Object Warning:Warning:java: /<path to my project>//NotEmptyTest.java uses unchecked or unsafe operations. Warning:Warning:java: Recompile with -Xlint:unchecked for details. As you can see in the screen capture, it reports the correct version of the libraries in the Javadoc but the AutoComplete shows the old 3.3 non-typesafe return value of List instead of List<MethodNode>: Here is what Maven knows, which is correct: [INFO] --- maven-dependency-plugin:2.8:list (default-cli) @ tests --- [INFO] [INFO] The following files have been resolved: [INFO] com.google.code.findbugs:bcel:jar:2.0.1:compile [INFO] junit:junit:jar:4.11:test [INFO] xml-apis:xml-apis:jar:1.0.b2:compile [INFO] com.apple:AppleJavaExtensions:jar:1.4:compile [INFO] javax.inject:javax.inject:jar:1:compile [INFO] jaxen:jaxen:jar:1.1.6:compile [INFO] org.ow2.asm:asm-util:jar:5.0.3:compile [INFO] com.google.inject:guice:jar:3.0:compile [INFO] dom4j:dom4j:jar:1.6.1:compile [INFO] com.google.code.findbugs:jFormatString:jar:2.0.1:compile [INFO] net.jcip:jcip-annotations:jar:1.0:compile [INFO] org.ow2.asm:asm-tree:jar:5.0.3:compile [INFO] commons-lang:commons-lang:jar:2.6:compile [INFO] com.google.code.findbugs:jsr305:jar:2.0.1:compile [INFO] org.hamcrest:hamcrest-core:jar:1.3:test [INFO] aopalliance:aopalliance:jar:1.0:compile [INFO] com.google.code.findbugs:findbugs:jar:2.0.3:compile [INFO] org.ow2.asm:asm-commons:jar:5.0.3:compile [INFO] org.ow2.asm:asm:jar:5.0.3:compile How do I get Intellij Idea to use the correct dependency internally?

    Read the article

  • Implementation question involving implementing an interface

    - by Vivin Paliath
    I'm writing a set of collection classes for different types of Trees. I'm doing this as a learning exercise and I'm also hoping it turns out to be something useful. I really want to do this the right way and so I've been reading Effective Java and I've also been looking at the way Joshua Bloch implemented the collection classes by looking at the source. I seem to have a fair idea of what is being done, but I still have a few things to sort out. I have a Node<T> interface and an AbstractNode<T> class that implements the Node interface. I then created a GenericNode<T> (a node that can have 0 to n children, and that is part of an n-ary tree) class that extends AbstractNode<T> and implements Node<T>. This part was easy. Next, I created a Tree<T> interface and an AbstractTree<T> class that implements the Tree<T> interface. After that, I started writing a GenericTree<T> class that extends AbstractTree<T> and implements Tree<T>. This is where I started having problems. As far as the design is concerned, a GenericTree<T> can only consist of nodes of type GenericTreeNode<T>. This includes the root. In my Tree<T> interface I have: public interface Tree<T> { void setRoot(Node<T> root); Node<T> getRoot(); List<Node<T>> postOrder(); ... rest omitted ... } And, AbstractTree<T> implements this interface: public abstract class AbstractTree<T> implements Tree<T> { protected Node<T> root; protected AbstractTree() { } protected AbstractTree(Node<T> root) { this.root = root; } public void setRoot(Node<T> root) { this.root = root; } public Node<T> getRoot() { return this.root; } ... rest omitted ... } In GenericTree<T>, I can have: public GenericTree(Node<T> root) { super(root); } But what this means is that you can create a generic tree using any subtype of Node<T>. You can also set the root of a tree to any subtype of Node<T>. I want to be able to restrict the type of the node to the type of the tree that it can represent. To fix this, I can do this: public GenericTree(GenericNode<T> root) { super(root); } However, setRoot still accepts a parameter of type Node<T>. Which means a user can still create a tree with the wrong type of root node. How do I enforce this constraint? The only way I can think of doing is either: Do an instanceof which limits the check to runtime. I'm not a huge fan of this. Remove setRoot from the interface and have the base class implement this method. This means that it is not part of the contract and anyone who wants to make a new type of tree needs to remember to implement this method. Is there a better way? The second question I have concerns the return type of postOrder which is List<Node<T>>. This means that if a user is operating on a GenericTree<T> object and calls postOrder, he or she receives a list that consists of Node<T> objects. This means when iterating through (using a foreach construct) they would have perform an explicit cast to GenericNode<T> if they want to use methods that are only defined in that class. I don't like having to place this burden on the user. What are my options in this case? I can only think of removing the method from the interface and have the subclass implement this method making sure that it returns a list of appropriate subtype of Node<T>. However, this once again removes it from the contract and it's anyone who wants to create a new type of tree has to remember to implement this method. Is there a better way?

    Read the article

  • Why does this XML validation via XSD fail in libxml2 (but succeed in xmllint) and how do I fix it?

    - by mtree
    If I run this XML validation via xmllint: xmllint --noout --schema schema.xsd test.xml I get this success message: .../test.xml validates However if I run the same validation via libxml2's C API: int result = xmlSchemaValidateDoc(...) I get a return value of 1845 and this failure message: Element '{http://example.com/XMLSchema/1.0}foo': No matching global declaration available for the validation root. Which I can make absolutely no sense of. :( schema.xsd: <?xml version="1.0" encoding="utf-8" ?> <!DOCTYPE xs:schema PUBLIC "-//W3C//DTD XMLSCHEMA 200102//EN" "XMLSchema.dtd" > <xs:schema xmlns:xs="http://www.w3.org/2001/XMLSchema" xmlns="http://example.com/XMLSchema/1.0" targetNamespace="http://example.com/XMLSchema/1.0" elementFormDefault="qualified" attributeFormDefault="unqualified"> <xs:element name="foo"> </xs:element> </xs:schema> test.xml: <?xml version="1.0" encoding="UTF-8"?> <foo xmlns="http://example.com/XMLSchema/1.0"> </foo> main.c: #include <stdio.h> #include <sys/stat.h> #include <sys/types.h> #include <string.h> #include <libxml/parser.h> #include <libxml/valid.h> #include <libxml/xmlschemas.h> u_int32_t get_file_size(const char *file_name) { struct stat buf; if ( stat(file_name, &buf) != 0 ) return(0); return (unsigned int)buf.st_size; } void handleValidationError(void *ctx, const char *format, ...) { char *errMsg; va_list args; va_start(args, format); vasprintf(&errMsg, format, args); va_end(args); fprintf(stderr, "Validation Error: %s", errMsg); free(errMsg); } int main (int argc, const char * argv[]) { const char *xsdPath = argv[1]; const char *xmlPath = argv[2]; printf("\n"); printf("XSD File: %s\n", xsdPath); printf("XML File: %s\n", xmlPath); int xmlLength = get_file_size(xmlPath); char *xmlSource = (char *)malloc(sizeof(char) * xmlLength); FILE *p = fopen(xmlPath, "r"); char c; unsigned int i = 0; while ((c = fgetc(p)) != EOF) { xmlSource[i++] = c; } printf("\n"); printf("XML Source:\n\n%s\n", xmlSource); fclose(p); printf("\n"); int result = 42; xmlSchemaParserCtxtPtr parserCtxt = NULL; xmlSchemaPtr schema = NULL; xmlSchemaValidCtxtPtr validCtxt = NULL; xmlDocPtr xmlDocumentPointer = xmlParseMemory(xmlSource, xmlLength); parserCtxt = xmlSchemaNewParserCtxt(xsdPath); if (parserCtxt == NULL) { fprintf(stderr, "Could not create XSD schema parsing context.\n"); goto leave; } schema = xmlSchemaParse(parserCtxt); if (schema == NULL) { fprintf(stderr, "Could not parse XSD schema.\n"); goto leave; } validCtxt = xmlSchemaNewValidCtxt(schema); if (!validCtxt) { fprintf(stderr, "Could not create XSD schema validation context.\n"); goto leave; } xmlSetStructuredErrorFunc(NULL, NULL); xmlSetGenericErrorFunc(NULL, handleValidationError); xmlThrDefSetStructuredErrorFunc(NULL, NULL); xmlThrDefSetGenericErrorFunc(NULL, handleValidationError); result = xmlSchemaValidateDoc(validCtxt, xmlDocumentPointer); leave: if (parserCtxt) { xmlSchemaFreeParserCtxt(parserCtxt); } if (schema) { xmlSchemaFree(schema); } if (validCtxt) { xmlSchemaFreeValidCtxt(validCtxt); } printf("\n"); printf("Validation successful: %s (result: %d)\n", (result == 0) ? "YES" : "NO", result); return 0; } console output: XSD File: /Users/dephiniteloop/Desktop/xml_validate/schema.xsd XML File: /Users/dephiniteloop/Desktop/xml_validate/test.gkml XML Source: <?xml version="1.0" encoding="UTF-8"?> <foo xmlns="http://example.com/XMLSchema/1.0"> </foo> Validation Error: Element '{http://example.com/XMLSchema/1.0}foo': No matching global declaration available for the validation root. Validation successful: NO (result: 1845) In case it matters: I'm on OSX 10.6.7 with its default libxml2.dylib (/Developer/SDKs/MacOSX10.6.sdk/usr/lib/libxml2.2.7.3.dylib)

    Read the article

  • How to create a SOAP REQUEST using ASP.NET (VB) without using Visual

    - by user311691
    Hi all , I urgently need your help . I am new to consuming a web service using SOAP protocol. I have been given a demo webservice URL which ends in .WSDL and NOT .asml?WSDL. The problem is I cannot add a web reference using Visual studio OR Disco.exe or Wsdl.exe - This webservice has been created on a java platform and for security reasons the only way to make a invoke the webservice is at runtime using SOAP protocol IN asp.net (VB). I I have created some code but cannot seem to send the soap object to the receiving web service. If I could get a solution with step by step instructions on how I can send a SOAP REQUEST. Below is my code and all am trying to do is send a SOAP REQUEST and receive a SOAP RESPONSE which I will display in my browser. <%@ page language="vb" %> <%@ Import Namespace="System.Data"%> <%@ Import Namespace="System.Xml"%> <%@ Import Namespace="System.Net"%> <%@ Import Namespace="System.IO"%> <%@ Import Namespace="System.Text"%> <script runat=server> Private Sub Page_Load() Dim objHTTPReq As HttpWebRequest Dim WebserviceUrl As String = "http://xx.xx.xx:8084/asy/wsdl/asy.wsdl" objHTTPReq = CType(WebRequest.Create(WebserviceUrl), HttpWebRequest) Dim soapXML As String soapXML = "<?xml version='1.0' encoding='utf-8'?>" & _ " <soap:Envelope xmlns:xsi='http://www.w3.org/2001/XMLSchema-instance'" & _ " xmlns:xsd='http://www.w3.org/2001/XMLSchema'"& _ " xmlns:soap='http://schemas.xmlsoap.org/soap/envelope/' >"& _ " <soap:Body> "& _ " <validatePaymentData xmlns='http://asybanks.webservices.asycuda.org'> " & _ " <bankCode>"& bankCode &"</bankCode> " & _ " <PaymentDataType>" & _ " <paymentType>"& payment_type &"</paymentType> " & _ " <amount>"& ass_amount &"</amount> " & _ " <ReferenceType>" & _ " <year>"& year &"</year> " & _ " <customsOfficeCode>"& station &"</customsOfficeCode> " & _ " </ReferenceType>" & _ " <accountNumber>"& zra_account &"</accountNumber> " & _ " </PaymentDataType> " & _ " </validatePaymentData> " & _ " </soap:Body> " & _ " </soap:Envelope> " objHTTPReq.Headers.Add("SOAPAction", "http://asybanks.webservices.asycuda.org") objHTTPReq.ContentType = "text/xml; charset=utf-8" objHTTPReq.ContentLength = soapXML.Length objHTTPReq.Accept = "text/xml" objHTTPReq.Method = "POST" Dim objHTTPRes As HttpWebResponse = CType(objHTTPReq.GetResponse(), HttpWebResponse) Dim dataStream As Stream = objHTTPRes.GetResponseStream() Dim reader As StreamReader = new StreamReader(dataStream) Dim responseFromServer As String = reader.ReadToEnd() OurXml.text = responseFromServer End Sub </script> <html xmlns="http://www.w3.org/1999/xhtml"> <head runat="server"> <title> XML TRANSACTION SIMULATION - N@W@ TJ </title> </head> <body> <form id="form1" runat="server"> <div> <p>ZRA test Feedback:</p> <asp:label id="OurXml" runat="server"/> </div> </form> </body> </html> the demo webservice looks like this: <?xml version="1.0" encoding="UTF-8" ?> - <!-- WEB SERVICE JAVA DEMO --> - <definitions targetNamespace="http://asybanks.webservices.asycuda.org" xmlns="http://schemas.xmlsoap.org/wsdl/" xmlns:apachesoap="http://xml.apache.org/xml-soap" xmlns:soap="http://schemas.xmlsoap.org/wsdl/soap/" xmlns:xs="http://www.w3.org/2001/XMLSchema" xmlns:y="http://asybanks.webservices.asycuda.org"> - <types> - <xs:schema elementFormDefault="qualified" targetNamespace="http://asybanks.webservices.asycuda.org" xmlns="http://www.w3.org/2001/XMLSchema"> SOME OTHER INFORMATION AT THE BOTTOM <soap:address location="http://xx.xx.xx:8084/asy/services/asy" /> </port> </service> </definitions> From the above excerpt of the wsdl url webservice, I am not sure which namespace to use for soapACTION - please advise.... Please if you could comment every stage of a soap request and provide a working demo - I would be most grateful as I would be learning rather than just assuming stuff :)

    Read the article

  • linux thread synchronization

    - by johnnycrash
    I am new to linux and linux threads. I have spent some time googling to try to understand the differences between all the functions available for thread synchronization. I still have some questions. I have found all of these different types of synchronizations, each with a number of functions for locking, unlocking, testing the lock, etc. gcc atomic operations futexes mutexes spinlocks seqlocks rculocks conditions semaphores My current (but probably flawed) understanding is this: semaphores are process wide, involve the filesystem (virtually I assume), and are probably the slowest. Futexes might be the base locking mechanism used by mutexes, spinlocks, seqlocks, and rculocks. Futexes might be faster than the locking mechanisms that are based on them. Spinlocks dont block and thus avoid context swtiches. However they avoid the context switch at the expense of consuming all the cycles on a CPU until the lock is released (spinning). They should only should be used on multi processor systems for obvious reasons. Never sleep in a spinlock. The seq lock just tells you when you finished your work if a writer changed the data the work was based on. You have to go back and repeat the work in this case. Atomic operations are the fastest synch call, and probably are used in all the above locking mechanisms. You do not want to use atomic operations on all the fields in your shared data. You want to use a lock (mutex, futex, spin, seq, rcu) or a single atomic opertation on a lock flag when you are accessing multiple data fields. My questions go like this: Am I right so far with my assumptions? Does anyone know the cpu cycle cost of the various options? I am adding parallelism to the app so we can get better wall time response at the expense of running fewer app instances per box. Performances is the utmost consideration. I don't want to consume cpu with context switching, spinning, or lots of extra cpu cycles to read and write shared memory. I am absolutely concerned with number of cpu cycles consumed. Which (if any) of the locks prevent interruption of a thread by the scheduler or interrupt...or am I just an idiot and all synchonization mechanisms do this. What kinds of interruption are prevented? Can I block all threads or threads just on the locking thread's CPU? This question stems from my fear of interrupting a thread holding a lock for a very commonly used function. I expect that the scheduler might schedule any number of other workers who will likely run into this function and then block because it was locked. A lot of context switching would be wasted until the thread with the lock gets rescheduled and finishes. I can re-write this function to minimize lock time, but still it is so commonly called I would like to use a lock that prevents interruption...across all processors. I am writing user code...so I get software interrupts, not hardware ones...right? I should stay away from any functions (spin/seq locks) that have the word "irq" in them. Which locks are for writing kernel or driver code and which are meant for user mode? Does anyone think using an atomic operation to have multiple threads move through a linked list is nuts? I am thinking to atomicly change the current item pointer to the next item in the list. If the attempt works, then the thread can safely use the data the current item pointed to before it was moved. Other threads would now be moved along the list. futexes? Any reason to use them instead of mutexes? Is there a better way than using a condition to sleep a thread when there is no work? When using gcc atomic ops, specifically the test_and_set, can I get a performance increase by doing a non atomic test first and then using test_and_set to confirm? *I know this will be case specific, so here is the case. There is a large collection of work items, say thousands. Each work item has a flag that is initialized to 0. When a thread has exclusive access to the work item, the flag will be one. There will be lots of worker threads. Any time a thread is looking for work, they can non atomicly test for 1. If they read a 1, we know for certain that the work is unavailable. If they read a zero, they need to perform the atomic test_and_set to confirm. So if the atomic test_and_set is 500 cpu cycles because it is disabling pipelining, causes cpu's to communicate and L2 caches to flush/fill .... and a simple test is 1 cycle .... then as long as I had a better ratio of 500 to 1 when it came to stumbling upon already completed work items....this would be a win.* I hope to use mutexes or spinlocks to sparilngly protect sections of code that I want only one thread on the SYSTEM (not jsut the CPU) to access at a time. I hope to sparingly use gcc atomic ops to select work and minimize use of mutexes and spinlocks. For instance: a flag in a work item can be checked to see if a thread has worked it (0=no, 1=yes or in progress). A simple test_and_set tells the thread if it has work or needs to move on. I hope to use conditions to wake up threads when there is work. Thanks!

    Read the article

  • Reverse engineering windows mobile live search CellID location awareness protocol (yikes)...

    - by Jean-Charles
    I wasn't sure of how to form the question so I apologize if the title is misleading. Additionally, you may want to get some coffee and take a seat for this one ... It's long. Basically, I'm trying to reverse engineer the protocol used by the Windows Mobile Live Search application to get location based on cellID. Before I go on, I am aware of other open source services (such as OpenCellID) but this is more for the sake of education and a bit for redundancy. According to the packets I captured, a POST request is made to ... mobile.search.live.com/positionlookupservice_1/service.aspx ... with a few specific headers (agent, content-length, etc) and no body. Once this goes through, the server sends back a 100-Continue response. At this point, the application submits this data (I chopped off the packet header): 00 00 00 01 00 00 00 05 55 54 ........UT 46 2d 38 05 65 6e 2d 55 53 05 65 6e 2d 55 53 01 F-8.en-US.en-US. 06 44 65 76 69 63 65 05 64 75 6d 6d 79 01 06 02 .Device.dummy... 50 4c 08 0e 52 65 76 65 72 73 65 47 65 6f 63 6f PL..ReverseGeoco 64 65 01 07 0b 47 50 53 43 68 69 70 49 6e 66 6f de...GPSChipInfo 01 20 06 09 43 65 6c 6c 54 6f 77 65 72 06 03 43 . ..CellTower..C 47 49 08 03 4d 43 43 b6 02 07 03 4d 4e 43 03 34 GI..MCC....MNC.4 31 30 08 03 4c 41 43 cf 36 08 02 43 49 fd 01 00 10..LAC.6..CI... 00 00 00 ... And receives this in response (packet and HTTP response headers chopped): 00 00 00 01 00 00 00 00 01 06 02 50 4c ...........PL 06 08 4c 6f 63 61 6c 69 74 79 06 08 4c 6f 63 61 ..Locality..Loca 74 69 6f 6e 07 03 4c 61 74 09 34 32 2e 33 37 35 tion..Lat.42.375 36 32 31 07 04 4c 6f 6e 67 0a 2d 37 31 2e 31 35 621..Long.-71.15 38 39 33 38 00 07 06 52 61 64 69 75 73 09 32 30 8938...Radius.20 30 30 2e 30 30 30 30 00 42 07 0c 4c 6f 63 61 6c 00.0000.B..Local 69 74 79 4e 61 6d 65 09 57 61 74 65 72 74 6f 77 ityName.Watertow 6e 07 16 41 64 6d 69 6e 69 73 74 72 61 74 69 76 n..Administrativ 65 41 72 65 61 4e 61 6d 65 0d 4d 61 73 73 61 63 eAreaName.Massac 68 75 73 65 74 74 73 07 10 50 6f 73 74 61 6c 43 husetts..PostalC 6f 64 65 4e 75 6d 62 65 72 05 30 32 34 37 32 07 odeNumber.02472. 0b 43 6f 75 6e 74 72 79 4e 61 6d 65 0d 55 6e 69 .CountryName.Uni 74 65 64 20 53 74 61 74 65 73 00 00 00 ted States... Now, here is what I've determined so far: All strings are prepended with one byte that is the decimal equivalent of their length. There seem to be three different casts that are used throughout the request and response. They show up as one byte before the length byte. I've concluded that the three types map out as follows: 0x06 - parent element (subsequent values are children, closed with 0x00) 0x07 - string 0x08 - int? Based on these determinations, here is what the request and response look like in a more readable manner (values surrounded by brackets denote length and values surrounded by parenthesis denote a cast): \0x00\0x00\0x00\0x01\0x00\0x00\0x00 [5]UTF-8 [5]en-US [5]en-US \0x01 [6]Device [5]dummy \0x01 (6)[2]PL (8)[14]ReverseGeocode\0x01 (7)[11]GPSChipInfo[1]\0x20 (6)[9]CellTower (6)[3]CGI (8)[3]MCC\0xB6\0x02 //310 (7)[3]MNC[3]410 //410 (8)[3]LAC\0xCF\0x36 //6991 (8)[2]CI\0xFD\0x01 //259 \0x00 \0x00 \0x00 \0x00 and.. \0x00\0x00\0x00\0x01\0x00\0x00\0x00 \0x00\0x01 (6)[2]PL (6)[8]Locality (6)[8]Location (7)[3]Lat[9]42.375621 (7)[4]Long[10]-71.158938 \0x00 (7)[6]Radius[9]2000.0000 \0x00 \0x42 //"B" ... Has to do with GSM (7)[12]LocalityName[9]Watertown (7)[22]AdministrativeAreaName[13]Massachusetts (7)[16]PostalCodeNumber[5]02472 (7)[11]CountryName[13]United States \0x00 \0x00\0x00 My analysis seems to work out pretty well except for a few things: The 0x01s throughout confuse me ... At first I thought they were some sort of base level element terminators but I'm not certain. I'm not sure the 7-byte header is, in fact, a seven byte header. I wonder if it's maybe 4 bytes and that the three remaining 0x00s are of some other significance. The trailing 0x00s. Why is it that there is only one on the request but two on the response? The type 8 cast mentioned above ... I can't seem to figure out how those values are being encoded. I added comments to those lines with what the values should correspond to. Any advice on these four points will be greatly appreciated. And yes, these packets were captured in Watertown, MA. :)

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • C# Reading and Writing a Char[] to and from a Byte[] - Updated with Solution

    - by Simon G
    Hi, I have a byte array of around 10,000 bytes which is basically a blob from delphi that contains char, string, double and arrays of various types. This need to be read in and updated via C#. I've created a very basic reader that gets the byte array from the db and converts the bytes to the relevant object type when accessing the property which works fine. My problem is when I try to write to a specific char[] item, it doesn't seem to update the byte array. I've created the following extensions for reading and writing: public static class CharExtension { public static byte ToByte( this char c ) { return Convert.ToByte( c ); } public static byte ToByte( this char c, int position, byte[] blob ) { byte b = c.ToByte(); blob[position] = b; return b; } } public static class CharArrayExtension { public static byte[] ToByteArray( this char[] c ) { byte[] b = new byte[c.Length]; for ( int i = 1; i < c.Length; i++ ) { b[i] = c[i].ToByte(); } return b; } public static byte[] ToByteArray( this char[] c, int positon, int length, byte[] blob ) { byte[] b = c.ToByteArray(); Array.Copy( b, 0, blob, positon, length ); return b; } } public static class ByteExtension { public static char ToChar( this byte[] b, int position ) { return Convert.ToChar( b[position] ); } } public static class ByteArrayExtension { public static char[] ToCharArray( this byte[] b, int position, int length ) { char[] c = new char[length]; for ( int i = 0; i < length; i++ ) { c[i] = b.ToChar( position ); position += 1; } return c; } } to read and write chars and char arrays my code looks like: Byte[] _Blob; // set from a db field public char ubin { get { return _tariffBlob.ToChar( 14 ); } set { value.ToByte( 14, _Blob ); } } public char[] usercaplas { get { return _tariffBlob.ToCharArray( 2035, 10 ); } set { value.ToByteArray( 2035, 10, _Blob ); } } So to write to the objects I can do: ubin = 'C'; // this will update the byte[] usercaplas = new char[10] { 'A', 'B', etc. }; // this will update the byte[] usercaplas[3] = 'C'; // this does not update the byte[] I know the reason is that the setter property is not being called but I want to know is there a way around this using code similar to what I already have? I know a possible solution is to use a private variable called _usercaplas that I set and update as needed however as the byte array is nearly 10,000 bytes in length the class is already long and I would like a simpler approach as to reduce the overall code length and complexity. Thank Solution Here's my solution should anyone want it. If you have a better way of doing then let me know please. First I created a new class for the array: public class CharArrayList : ArrayList { char[] arr; private byte[] blob; private int length = 0; private int position = 0; public CharArrayList( byte[] blob, int position, int length ) { this.blob = blob; this.length = length; this.position = position; PopulateInternalArray(); SetArray(); } private void PopulateInternalArray() { arr = blob.ToCharArray( position, length ); } private void SetArray() { foreach ( char c in arr ) { this.Add( c ); } } private void UpdateInternalArray() { this.Clear(); SetArray(); } public char this[int i] { get { return arr[i]; } set { arr[i] = value; UpdateInternalArray(); } } } Then I created a couple of extension methods to help with converting to a byte[] public static byte[] ToByteArray( this CharArrayList c ) { byte[] b = new byte[c.Count]; for ( int i = 0; i < c.Count; i++ ) { b[i] = Convert.ToChar( c[i] ).ToByte(); } return b; } public static byte[] ToByteArray( this CharArrayList c, byte[] blob, int position, int length ) { byte[] b = c.ToByteArray(); Array.Copy( b, 0, blob, position, length ); return b; } So to read and write to the object: private CharArrayList _usercaplass; public CharArrayList usercaplas { get { if ( _usercaplass == null ) _usercaplass = new CharArrayList( _tariffBlob, 2035, 100 ); return _usercaplass; } set { _usercaplass = value; _usercaplass.ToByteArray( _tariffBlob, 2035, 100 ); } } As mentioned before its not an ideal solutions as I have to have private variables and extra code in the setter but I couldnt see a way around it.

    Read the article

< Previous Page | 374 375 376 377 378 379 380 381 382 383 384 385  | Next Page >