Search Results

Search found 9682 results on 388 pages for 'anonymous types'.

Page 379/388 | < Previous Page | 375 376 377 378 379 380 381 382 383 384 385 386  | Next Page >

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • What's wrong with Bundler working with RubyGems to push a Git repo to Heroku?

    - by stanigator
    I've made sure that all the files are in the root of the repository as recommended in this discussion. However, as I follow the instructions in this section of the book, I can't get through the section without the problems. What do you think is happening with my system that's causing the error? I have no clue at the moment of what the problem means despite reading the following in the log. Thanks in advance for your help! stanley@ubuntu:~/rails_sample/first_app$ git push heroku master Warning: Permanently added the RSA host key for IP address '50.19.85.156' to the list of known hosts. Counting objects: 96, done. Compressing objects: 100% (79/79), done. Writing objects: 100% (96/96), 28.81 KiB, done. Total 96 (delta 22), reused 0 (delta 0) -----> Heroku receiving push -----> Ruby/Rails app detected -----> Installing dependencies using Bundler version 1.2.0.pre Running: bundle install --without development:test --path vendor/bundle --binstubs bin/ --deployment Fetching gem metadata from https://rubygems.org/....... Installing rake (0.9.2.2) Installing i18n (0.6.0) Installing multi_json (1.3.5) Installing activesupport (3.2.3) Installing builder (3.0.0) Installing activemodel (3.2.3) Installing erubis (2.7.0) Installing journey (1.0.3) Installing rack (1.4.1) Installing rack-cache (1.2) Installing rack-test (0.6.1) Installing hike (1.2.1) Installing tilt (1.3.3) Installing sprockets (2.1.3) Installing actionpack (3.2.3) Installing mime-types (1.18) Installing polyglot (0.3.3) Installing treetop (1.4.10) Installing mail (2.4.4) Installing actionmailer (3.2.3) Installing arel (3.0.2) Installing tzinfo (0.3.33) Installing activerecord (3.2.3) Installing activeresource (3.2.3) Installing coffee-script-source (1.3.3) Installing execjs (1.3.2) Installing coffee-script (2.2.0) Installing rack-ssl (1.3.2) Installing json (1.7.3) with native extensions Installing rdoc (3.12) Installing thor (0.14.6) Installing railties (3.2.3) Installing coffee-rails (3.2.2) Installing jquery-rails (2.0.2) Using bundler (1.2.0.pre) Installing rails (3.2.3) Installing sass (3.1.18) Installing sass-rails (3.2.5) Installing sqlite3 (1.3.6) with native extensions Gem::Installer::ExtensionBuildError: ERROR: Failed to build gem native extension. /usr/local/bin/ruby extconf.rb checking for sqlite3.h... no sqlite3.h is missing. Try 'port install sqlite3 +universal' or 'yum install sqlite-devel' and check your shared library search path (the location where your sqlite3 shared library is located). *** extconf.rb failed *** Could not create Makefile due to some reason, probably lack of necessary libraries and/or headers. Check the mkmf.log file for more details. You may need configuration options. Provided configuration options: --with-opt-dir --without-opt-dir --with-opt-include --without-opt-include=${opt-dir}/include --with-opt-lib --without-opt-lib=${opt-dir}/lib --with-make-prog --without-make-prog --srcdir=. --curdir --ruby=/usr/local/bin/ruby --with-sqlite3-dir --without-sqlite3-dir --with-sqlite3-include --without-sqlite3-include=${sqlite3-dir}/include --with-sqlite3-lib --without-sqlite3-lib=${sqlite3-dir}/lib --enable-local --disable-local Gem files will remain installed in /tmp/build_3tplrxvj7qa81/vendor/bundle/ruby/1.9.1/gems/sqlite3-1.3.6 for inspection. Results logged to /tmp/build_3tplrxvj7qa81/vendor/bundle/ruby/1.9.1/gems/sqlite3-1.3.6/ext/sqlite3/gem_make.out An error occurred while installing sqlite3 (1.3.6), and Bundler cannot continue. Make sure that `gem install sqlite3 -v '1.3.6'` succeeds before bundling. ! ! Failed to install gems via Bundler. ! ! Heroku push rejected, failed to compile Ruby/rails app To [email protected]:growing-mountain-2788.git ! [remote rejected] master -> master (pre-receive hook declined) error: failed to push some refs to '[email protected]:growing-mountain-2788.git' ------Gemfile------------------------ As requested, here's the auto-generated gemfile: source 'https://rubygems.org' gem 'rails', '3.2.3' # Bundle edge Rails instead: # gem 'rails', :git => 'git://github.com/rails/rails.git' gem 'sqlite3' gem 'json' # Gems used only for assets and not required # in production environments by default. group :assets do gem 'sass-rails', '~> 3.2.3' gem 'coffee-rails', '~> 3.2.1' # See https://github.com/sstephenson/execjs#readme for more supported runtimes # gem 'therubyracer', :platform => :ruby gem 'uglifier', '>= 1.0.3' end gem 'jquery-rails' # To use ActiveModel has_secure_password # gem 'bcrypt-ruby', '~> 3.0.0' # To use Jbuilder templates for JSON # gem 'jbuilder' # Use unicorn as the app server # gem 'unicorn' # Deploy with Capistrano # gem 'capistrano' # To use debugger # gem 'ruby-debug'

    Read the article

  • asp .net MVC 2.0 Validation

    - by ANDyW
    Hi I’m trying to do some validation in asp .net MVC 2.0 for my application. I want to have some nice client side validation. Validation should be done most time on model side with DataAnnotations with custom attributes( like CompareTo, StringLenght, MinPasswordLenght (from Membership.MinimumumpassworkdLenght value). For that purpose I tried to use xval with jquery.validation. Some specific thing is that most of forms will be working with ajax and most problems are when I want to validate form with ajax. Here is link for sample project http://www.sendspace.com/file/m9gl54 . I got two forms as controls ValidFormControl1.ascx, ValidFormControl2.ascx <% using (Ajax.BeginForm("CreateValidForm", "Test", new AjaxOptions { HttpMethod = "Post" })) {%> <div id="validationSummary1"> <%= Html.ValidationSummary(true)%> </div> <fieldset> <legend>Fields</legend> <div class="editor-label"> <%= Html.LabelFor(model => model.Name)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Name)%> <%= Html.ValidationMessageFor(model => model.Name)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.Email)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Email)%> <%= Html.ValidationMessageFor(model => model.Email)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.Password)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Password)%> <%= Html.ValidationMessageFor(model => model.Password)%> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.ConfirmPassword)%> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.ConfirmPassword)%> <%= Html.ValidationMessageFor(model => model.ConfirmPassword)%> </div> <p> <input type="submit" value="Create" /> </p> </fieldset> <% } %> <%= Html.ClientSideValidation<ValidModel>() .UseValidationSummary("validationSummary1", "Please fix the following problems:") %> Both look same the difference is only validation summaryID (validationSummary1, validationSummary2). Both controls are rendered on one page : Form2 <%Html.RenderPartial("~/Views/Test/ValidFormControl2.ascx", null); %> Form1 <%Html.RenderPartial("~/Views/Test/ValidFormControl.ascx", null); %> Validation property First problem, when we have two controls with same type to validate it don’t work becosue html elements are rendered by field name ( so we have two element with same name “Password” ). Only first form will be validated by client side. The worst thing is that even if we have different types and their fields name is same validation won’t work too ( this thing is what I need to repair it will be stupid to name some unique properites for validation ). Is there any solution for this ? Custom attributes validation Next thing custom attributes validation ( All those error are when I use Ajax for on normal form validation is working without problem. ): CompareTo - Simple compare to that is done in mvc template for account model ( class attribute saying with two property will be compared ) , and it wasn’t show on page. To do it I created own CachingRulesProvider with compareRule and my Attribute. Maybe there is more easy way to do it? StringLenght with minimum and maximum value, I won’t describe how I done it but is there any easy whey to do it? Validation summary When I have two two control on page all summary validation information goes to first control validation summary element, even xval generated script say that elementID are different for summary. Any one know how to repair it? Validation Information Is there any option to turn on messages on place where is Html.ValidationMessageFor(model = model.ConfirmPassword). Becsoue for me it isn’t show up. I would like to have summary and near field information too not only red border. Any one know how to do it? Ajax submit Anyone know how to do easy without massive code in javascript to do submit via javascript. This will be used to change input submit to href element (a). Both look same the difference is only validation summaryID

    Read the article

  • C++0x rvalue references - lvalues-rvalue binding

    - by Doug
    This is a follow-on question to http://stackoverflow.com/questions/2748866/c0x-rvalue-references-and-temporaries In the previous question, I asked how this code should work: void f(const std::string &); //less efficient void f(std::string &&); //more efficient void g(const char * arg) { f(arg); } It seems that the move overload should probably be called because of the implicit temporary, and this happens in GCC but not MSVC (or the EDG front-end used in MSVC's Intellisense). What about this code? void f(std::string &&); //NB: No const string & overload supplied void g1(const char * arg) { f(arg); } void g2(const std::string & arg) { f(arg); } It seems that, based on the answers to my previous question that function g1 is legal (and is accepted by GCC 4.3-4.5, but not by MSVC). However, GCC and MSVC both reject g2 because of clause 13.3.3.1.4/3, which prohibits lvalues from binding to rvalue ref arguments. I understand the rationale behind this - it is explained in N2831 "Fixing a safety problem with rvalue references". I also think that GCC is probably implementing this clause as intended by the authors of that paper, because the original patch to GCC was written by one of the authors (Doug Gregor). However, I don't this is quite intuitive. To me, (a) a const string & is conceptually closer to a string && than a const char *, and (b) the compiler could create a temporary string in g2, as if it were written like this: void g2(const std::string & arg) { f(std::string(arg)); } Indeed, sometimes the copy constructor is considered to be an implicit conversion operator. Syntactically, this is suggested by the form of a copy constructor, and the standard even mentions this specifically in clause 13.3.3.1.2/4, where the copy constructor for derived-base conversions is given a higher conversion rank than other implicit conversions: A conversion of an expression of class type to the same class type is given Exact Match rank, and a conversion of an expression of class type to a base class of that type is given Conversion rank, in spite of the fact that a copy/move constructor (i.e., a user-defined conversion function) is called for those cases. (I assume this is used when passing a derived class to a function like void h(Base), which takes a base class by value.) Motivation My motivation for asking this is something like the question asked in http://stackoverflow.com/questions/2696156/how-to-reduce-redundant-code-when-adding-new-c0x-rvalue-reference-operator-over ("How to reduce redundant code when adding new c++0x rvalue reference operator overloads"). If you have a function that accepts a number of potentially-moveable arguments, and would move them if it can (e.g. a factory function/constructor: Object create_object(string, vector<string>, string) or the like), and want to move or copy each argument as appropriate, you quickly start writing a lot of code. If the argument types are movable, then one could just write one version that accepts the arguments by value, as above. But if the arguments are (legacy) non-movable-but-swappable classes a la C++03, and you can't change them, then writing rvalue reference overloads is more efficient. So if lvalues did bind to rvalues via an implicit copy, then you could write just one overload like create_object(legacy_string &&, legacy_vector<legacy_string> &&, legacy_string &&) and it would more or less work like providing all the combinations of rvalue/lvalue reference overloads - actual arguments that were lvalues would get copied and then bound to the arguments, actual arguments that were rvalues would get directly bound. Questions My questions are then: Is this a valid interpretation of the standard? It seems that it's not the conventional or intended one, at any rate. Does it make intuitive sense? Is there a problem with this idea that I"m not seeing? It seems like you could get copies being quietly created when that's not exactly expected, but that's the status quo in places in C++03 anyway. Also, it would make some overloads viable when they're currently not, but I don't see it being a problem in practice. Is this a significant enough improvement that it would be worth making e.g. an experimental patch for GCC?

    Read the article

  • Condition Variable in Shared Memory - is this code POSIX-conformant?

    - by GrahamS
    We've been trying to use a mutex and condition variable to synchronise access to named shared memory on a LynuxWorks LynxOS-SE system (POSIX-conformant). One shared memory block is called "/sync" and contains the mutex and condition variable, the other is "/data" and contains the actual data we are syncing access to. We're seeing failures from pthread_cond_signal() if both processes don't perform the mmap() calls in exactly the same order, or if one process mmaps in some other piece of shared memory before it mmaps the sync memory. This example code is about as short as I can make it: #include <sys/types.h> #include <sys/stat.h> #include <sys/mman.h> #include <sys/file.h> #include <stdlib.h> #include <pthread.h> #include <errno.h> #include <iostream> #include <string> using namespace std; static const string shm_name_sync("/sync"); static const string shm_name_data("/data"); struct shared_memory_sync { pthread_mutex_t mutex; pthread_cond_t condition; }; struct shared_memory_data { int a; int b; }; //Create 2 shared memory objects // - sync contains 2 shared synchronisation objects (mutex and condition) // - data not important void create() { // Create and map 'sync' shared memory int fd_sync = shm_open(shm_name_sync.c_str(), O_CREAT|O_RDWR, S_IRUSR|S_IWUSR); ftruncate(fd_sync, sizeof(shared_memory_sync)); void* addr_sync = mmap(0, sizeof(shared_memory_sync), PROT_READ|PROT_WRITE, MAP_SHARED, fd_sync, 0); shared_memory_sync* p_sync = static_cast<shared_memory_sync*> (addr_sync); // init the cond and mutex pthread_condattr_t cond_attr; pthread_condattr_init(&cond_attr); pthread_condattr_setpshared(&cond_attr, PTHREAD_PROCESS_SHARED); pthread_cond_init(&(p_sync->condition), &cond_attr); pthread_condattr_destroy(&cond_attr); pthread_mutexattr_t m_attr; pthread_mutexattr_init(&m_attr); pthread_mutexattr_setpshared(&m_attr, PTHREAD_PROCESS_SHARED); pthread_mutex_init(&(p_sync->mutex), &m_attr); pthread_mutexattr_destroy(&m_attr); // Create the 'data' shared memory int fd_data = shm_open(shm_name_data.c_str(), O_CREAT|O_RDWR, S_IRUSR|S_IWUSR); ftruncate(fd_data, sizeof(shared_memory_data)); void* addr_data = mmap(0, sizeof(shared_memory_data), PROT_READ|PROT_WRITE, MAP_SHARED, fd_data, 0); shared_memory_data* p_data = static_cast<shared_memory_data*> (addr_data); // Run the second process while it sleeps here. sleep(10); int res = pthread_cond_signal(&(p_sync->condition)); assert(res==0); // <--- !!!THIS ASSERT WILL FAIL ON LYNXOS!!! munmap(addr_sync, sizeof(shared_memory_sync)); shm_unlink(shm_name_sync.c_str()); munmap(addr_data, sizeof(shared_memory_data)); shm_unlink(shm_name_data.c_str()); } //Open the same 2 shared memory objects but in reverse order // - data // - sync void open() { sleep(2); int fd_data = shm_open(shm_name_data.c_str(), O_RDWR, S_IRUSR|S_IWUSR); void* addr_data = mmap(0, sizeof(shared_memory_data), PROT_READ|PROT_WRITE, MAP_SHARED, fd_data, 0); shared_memory_data* p_data = static_cast<shared_memory_data*> (addr_data); int fd_sync = shm_open(shm_name_sync.c_str(), O_RDWR, S_IRUSR|S_IWUSR); void* addr_sync = mmap(0, sizeof(shared_memory_sync), PROT_READ|PROT_WRITE, MAP_SHARED, fd_sync, 0); shared_memory_sync* p_sync = static_cast<shared_memory_sync*> (addr_sync); // Wait on the condvar pthread_mutex_lock(&(p_sync->mutex)); pthread_cond_wait(&(p_sync->condition), &(p_sync->mutex)); pthread_mutex_unlock(&(p_sync->mutex)); munmap(addr_sync, sizeof(shared_memory_sync)); munmap(addr_data, sizeof(shared_memory_data)); } int main(int argc, char** argv) { if(argc>1) { open(); } else { create(); } return (0); } Run this program with no args, then another copy with args, and the first one will fail at the assert checking the pthread_cond_signal(). But change the open() function to mmap() the "/sync" memory first and it will all work fine. This seems like a major bug in LynxOS but LynuxWorks claim that using mutex and condition variable in this way is not covered by the POSIX standard, so they are not interested. Can anyone determine if this code does violate POSIX? Or does anyone have any convincing documentation that it is POSIX compliant?

    Read the article

  • System.Timers.Timer leaking due to "direct delegate roots"

    - by alimbada
    Apologies for the rather verbose and long-winded post, but this problem's been perplexing me for a few weeks now so I'm posting as much information as I can in order to get this resolved quickly. We have a WPF UserControl which is being loaded by a 3rd party app. The 3rd party app is a presentation application which loads and unloads controls on a schedule defined by an XML file which is downloaded from a server. Our control, when it is loaded into the application makes a web request to a web service and uses the data from the response to display some information. We're using an MVVM architecture for the control. The entry point of the control is a method that is implementing an interface exposed by the main app and this is where the control's configuration is set up. This is also where I set the DataContext of our control to our MainViewModel. The MainViewModel has two other view models as properties and the main UserControl has two child controls. Depending on the data received from the web service, the main UserControl decides which child control to display, e.g. if there is a HTTP error or the data received is not valid, then display child control A, otherwise display child control B. As you'd expect, these two child controls bind two separate view models each of which is a property of MainViewModel. Now child control B (which is displayed when the data is valid) has a RefreshService property/field. RefreshService is an object that is responsible for updating the model in a number of ways and contains 4 System.Timers.Timers; a _modelRefreshTimer a _viewRefreshTimer a _pageSwitchTimer a _retryFeedRetrievalOnErrorTimer (this is only enabled when something goes wrong with retrieving data). I should mention at this point that there are two types of data; the first changes every minute, the second changes every few hours. The controls' configuration decides which type we are using/displaying. If data is of the first type then we update the model quite frequently (every 30 seconds) using the _modelRefreshTimer's events. If the data is of the second type then we update the model after a longer interval. However, the view still needs to be refreshed every 30 seconds as stale data needs to be removed from the view (hence the _viewRefreshTimer). The control also paginates the data so we can see more than we can fit on the display area. This works by breaking the data up into Lists and switching the CurrentPage (which is a List) property of the view model to the right List. This is done by handling the _pageSwitchTimer's Elapsed event. Now the problem My problem is that the control, when removed from the visual tree doesn't dispose of it's timers. This was first noticed when we started getting an unusually high number of requests on the web server end very soon after deploying this control and found that requests were being made at least once a second! We found that the timers were living on and not stopping hours after the control had been removed from view and that the more timers there were the more requests piled up at the web server. My first solution was to implement IDisposable for the RefreshService and do some clean up when the control's UnLoaded event was fired. Within the RefreshServices Dispose method I've set Enabled to false for all the timers, then used the Stop() method on all of them. I've then called Dispose() too and set them to null. None of this worked. After some reading around I found that event handlers may hold references to Timers and prevent them from being disposed and collected. After some more reading and researching I found that the best way around this was to use the Weak Event Pattern. Using this blog and this blog I've managed to work around the shortcomings in the Weak Event pattern. However, none of this solves the problem. Timers are still not being disabled or stopped (let alone disposed) and web requests are continuing to build up. Mem Profiler tells me that "This type has N instances that are directly rooted by a delegate. This can indicate the delegate has not been properly removed" (where N is the number of instances). As far as I can tell though, all listeners of the Elapsed event for the timers are being removed during the cleanup so I can't understand why the timers continue to run. Thanks for reading. Eagerly awaiting your suggestions/comments/solutions (if you got this far :-p)

    Read the article

  • php - upload script mkdir saying file already exists when same directory even though different filename

    - by neeko
    my upload script says my file already exists when i try upload even though different filename <?php // Start a session for error reporting session_start(); ?> <?php // Check, if username session is NOT set then this page will jump to login page if (!isset($_SESSION['username'])) { header('Location: index.html'); } // Call our connection file include('config.php'); // Check to see if the type of file uploaded is a valid image type function is_valid_type($file) { // This is an array that holds all the valid image MIME types $valid_types = array("image/jpg", "image/JPG", "image/jpeg", "image/bmp", "image/gif", "image/png"); if (in_array($file['type'], $valid_types)) return 1; return 0; } // Just a short function that prints out the contents of an array in a manner that's easy to read // I used this function during debugging but it serves no purpose at run time for this example function showContents($array) { echo "<pre>"; print_r($array); echo "</pre>"; } // Set some constants // Grab the User ID we sent from our form $user_id = $_SESSION['username']; $category = $_POST['category']; // This variable is the path to the image folder where all the images are going to be stored // Note that there is a trailing forward slash $TARGET_PATH = "img/users/$category/$user_id/"; mkdir($TARGET_PATH, 0755, true); // Get our POSTed variables $fname = $_POST['fname']; $lname = $_POST['lname']; $contact = $_POST['contact']; $price = $_POST['price']; $image = $_FILES['image']; // Build our target path full string. This is where the file will be moved do // i.e. images/picture.jpg $TARGET_PATH .= $image['name']; // Make sure all the fields from the form have inputs if ( $fname == "" || $lname == "" || $image['name'] == "" ) { $_SESSION['error'] = "All fields are required"; header("Location: error.php"); exit; } // Check to make sure that our file is actually an image // You check the file type instead of the extension because the extension can easily be faked if (!is_valid_type($image)) { $_SESSION['error'] = "You must upload a jpeg, gif, or bmp"; header("Location: error.php"); exit; } // Here we check to see if a file with that name already exists // You could get past filename problems by appending a timestamp to the filename and then continuing if (file_exists($TARGET_PATH)) { $_SESSION['error'] = "A file with that name already exists"; header("Location: error.php"); exit; } // Lets attempt to move the file from its temporary directory to its new home if (move_uploaded_file($image['tmp_name'], $TARGET_PATH)) { // NOTE: This is where a lot of people make mistakes. // We are *not* putting the image into the database; we are putting a reference to the file's location on the server $imagename = $image['name']; $sql = "insert into people (price, contact, category, username, fname, lname, expire, filename) values (:price, :contact, :category, :user_id, :fname, :lname, now() + INTERVAL 1 MONTH, :imagename)"; $q = $conn->prepare($sql) or die("failed!"); $q->bindParam(':price', $price, PDO::PARAM_STR); $q->bindParam(':contact', $contact, PDO::PARAM_STR); $q->bindParam(':category', $category, PDO::PARAM_STR); $q->bindParam(':user_id', $user_id, PDO::PARAM_STR); $q->bindParam(':fname', $fname, PDO::PARAM_STR); $q->bindParam(':lname', $lname, PDO::PARAM_STR); $q->bindParam(':imagename', $imagename, PDO::PARAM_STR); $q->execute(); $sql1 = "UPDATE people SET firstname = (SELECT firstname FROM user WHERE username=:user_id1) WHERE username=:user_id2"; $q = $conn->prepare($sql1) or die("failed!"); $q->bindParam(':user_id1', $user_id, PDO::PARAM_STR); $q->bindParam(':user_id2', $user_id, PDO::PARAM_STR); $q->execute(); $sql2 = "UPDATE people SET surname = (SELECT surname FROM user WHERE username=:user_id1) WHERE username=:user_id2"; $q = $conn->prepare($sql2) or die("failed!"); $q->bindParam(':user_id1', $user_id, PDO::PARAM_STR); $q->bindParam(':user_id2', $user_id, PDO::PARAM_STR); $q->execute(); header("Location: search.php"); exit; } else { // A common cause of file moving failures is because of bad permissions on the directory attempting to be written to // Make sure you chmod the directory to be writeable $_SESSION['error'] = "Could not upload file. Check read/write persmissions on the directory"; header("Location: error.php"); exit; } ?>

    Read the article

  • xs:choice unbounded list

    - by Matt
    I want to define an XSD schema for an XML document, example below: <?xml version="1.0" encoding="utf-8"?> <view xmlns="http://localhost/model_data" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://localhost/model_data XMLSchemaView.xsd" path="wibble" id="wibble"> <text name="PageTitle">Homepage</text> <text name="Keywords">home foo bar</text> <image name="MainImage"> <description>lolem ipsum</description> <title>i haz it</title> <url>/images/main-image.jpg</url> <type>image/jpeg</type> <alt>alt text for image</alt> <width>400</width> <height>300</height> </image> <link name="TermsAndConditionsLink"> <url>/tnc.html</url> <title>Terms and Conditions</title> <target>_blank</target> </link> </view> There's a view root element and then an unknown number of field elements (of various types). I'm using the following XSD schema: <?xml version="1.0" encoding="utf-8"?> <xs:schema xmlns:xs="http://www.w3.org/2001/XMLSchema" xmlns="http://localhost/model_data" targetNamespace="http://localhost/model_data" id="XMLSchema1"> <xs:element name="text" type="text_field"/> <xs:element name="view" type="model_data"/> <xs:complexType name="model_data"> <xs:choice maxOccurs="unbounded"> <xs:element name="text" type="text_field"/> <xs:element name="image" type="image_field"/> <xs:element name="link" type="link_field"/> </xs:choice> <xs:attribute name="path" type="xs:string"/> <xs:attribute name="id" type="xs:string"/> </xs:complexType> <xs:complexType name="image_field"> <xs:all> <xs:element name="description" type="xs:string"/> <xs:element name="title" type="xs:string"/> <xs:element name="type" type="xs:string"/> <xs:element name="url" type="xs:string"/> <xs:element name="alt" type="xs:string"/> <xs:element name="height" type="xs:int"/> <xs:element name="width" type="xs:int"/> </xs:all> <xs:attribute name="name" type="xs:string"/> </xs:complexType> <xs:complexType name="text_field"> <xs:simpleContent> <xs:extension base="xs:string"> <xs:attribute name="name" type="xs:string"/> </xs:extension> </xs:simpleContent> </xs:complexType> <xs:complexType name="link_field"> <xs:all> <xs:element name="target" type="xs:string"/> <xs:element name="title" type="xs:string"/> <xs:element name="url" type="xs:string"/> </xs:all> <xs:attribute name="name" type="xs:string"/> </xs:complexType> </xs:schema> This looks like it should work to me, but it doesn't and I always get the following error: Element <text> is not allowed under element <view>. Reason: The following elements are expected at this location (see below) <text> <image> <link> Error location: view / text Details cvc-model-group: Element <text> unexpected by type 'model_data' of element <view>. cvc-elt.5.2.1: The element <view> is not valid with respect to the actual type definition 'model_data'. I've never really used XSD schemas before, so I'd really appreciate it if someone could point out where I'm going wrong.

    Read the article

  • Policy based design and defaults.

    - by Noah Roberts
    Hard to come up with a good title for this question. What I really need is to be able to provide template parameters with different number of arguments in place of a single parameter. Doesn't make a lot of sense so I'll go over the reason: template < typename T, template <typename,typename> class Policy = default_policy > struct policy_based : Policy<T, policy_based<T,Policy> > { // inherits R Policy::fun(arg0, arg1, arg2,...,argn) }; // normal use: policy_base<type_a> instance; // abnormal use: template < typename PolicyBased > // No T since T is always the same when you use this struct custom_policy {}; policy_base<type_b,custom_policy> instance; The deal is that for many abnormal uses the Policy will be based on one single type T, and can't really be parameterized on T so it makes no sense to take T as a parameter. For other uses, including the default, a Policy can make sense with any T. I have a couple ideas but none of them are really favorites. I thought that I had a better answer--using composition instead of policies--but then I realized I have this case where fun() actually needs extra information that the class itself won't have. This is like the third time I've refactored this silly construct and I've got quite a few custom versions of it around that I'm trying to consolidate. I'd like to get something nailed down this time rather than just fish around and hope it works this time. So I'm just fishing for ideas right now hoping that someone has something I'll be so impressed by that I'll switch deities. Anyone have a good idea? Edit: You might be asking yourself why I don't just retrieve T from the definition of policy based in the template for default_policy. The reason is that default_policy is actually specialized for some types T. Since asking the question I have come up with something that may be what I need, which will follow, but I could still use some other ideas. template < typename T > struct default_policy; template < typename T, template < typename > class Policy = default_policy > struct test : Policy<test<T,Policy>> {}; template < typename T > struct default_policy< test<T, default_policy> > { void f() {} }; template < > struct default_policy< test<int, default_policy> > { void f(int) {} }; Edit: Still messing with it. I wasn't too fond of the above since it makes default_policy permanently coupled with "test" and so couldn't be reused in some other method, such as with multiple templates as suggested below. It also doesn't scale at all and requires a list of parameters at least as long as "test" has. Tried a few different approaches that failed until I found another that seems to work so far: template < typename T > struct default_policy; template < typename T, template < typename > class Policy = default_policy > struct test : Policy<test<T,Policy>> {}; template < typename PolicyBased > struct fetch_t; template < typename PolicyBased, typename T > struct default_policy_base; template < typename PolicyBased > struct default_policy : default_policy_base<PolicyBased, typename fetch_t<PolicyBased>::type> {}; template < typename T, template < typename > class Policy > struct fetch_t< test<T,Policy> > { typedef T type; }; template < typename PolicyBased, typename T > struct default_policy_base { void f() {} }; template < typename PolicyBased > struct default_policy_base<PolicyBased,int> { void f(int) {} };

    Read the article

  • Find inner arrays in nested arrays

    - by 50ndr33
    I have a nested array in PHP: array ( '0' => "+5x", '1' => array ( '0' => "+", '1' => "(", '2' => "+3", '3' => array ( '0' => "+", '1' => "(", '2' => array ( // I want to find this one. '0' => "+", '1' => "(", '2' => "+5", '3' => "-3", '4' => ")" ), '3' => "-3", '4' => ")" ), '4' => ")" ) ); I need to process the innermost arrays here, the one with the comment: "I want to find this one." Is there a function for that? I have thought about doing (written as an idea, not as correct PHP): foreach ($array as $id => $value) { if ($value is array) { $name = $id; foreach ($array[$id] as $id_2 => $value_2) { if ($value_2 is array) { $name .= "." . $id_2; foreach ($array[$id][$id_2] as $id_3 => $value_3) { if ($value_3 is array) { $name .= "." . $id_3; foreach ($array[$id][$id_2][$id_3] as $id_4 => $value_4) { if ($value_4 is array) { $name .= "." . $id_4; foreach [and so it goes on]; } else { $listOfInnerArrays[] = $name; break; } } } else { $listOfInnerArrays[] = $name; break; } } } else { $listOfInnerArrays[] = $name; break; } } } } So what it does is it makes $name the current key in the array. If the value is an array, it goes into it with foreach and adds "." and the id of the array. So we would in the example array end up with: array ( '0' => "1.3.2", ) Then I can process those values to access the innner arrays. The problem is that the array that I'm trying to find the inner arrays of is dynamic and made of a user input. (It splits an input string where it finds + or -, and puts it in a separate nested array if it contains brackets. So if the user types a lot of brackets, there will be a lot of nested arrays.) Therefore I need to make this pattern go for 20 times down, and still it will only catch 20 nested arrays no matter what. Is there a function for that, again? Or is there a way to make it do this without my long code? Maybe make a loop make the necessary number of the foreach pattern and run it through eval()? Long answer to J. Bruni: <?php $liste = array ( '0' => "+5x", '1' => array ( '0' => "+", '1' => "(", '2' => "+3", '3' => array ( '0' => "+", '1' => "(", '2' => array ( '0' => "+", '1' => "(", '2' => "+5", '3' => "-3", '4' => ")" ), '3' => "-3", '4' => ")" ), '4' => ")" ) ); function find_deepest( $item, $key ) { echo "0"; if ( !is_array( $item ) ) return false; foreach( $item as $sub_item ) { if ( is_array( $sub_item ) ) return false; } echo "1"; print_r( $item ); return true; } array_walk_recursive( $liste, 'find_deepest' ); echo "<pre>"; print_r($liste); ?> I wrote echo 0 and 1 to see what the script did, and here is the output: 00000000000000 Array ( [0] => +5x [1] => Array ( [0] => + [1] => ( [2] => +3 [3] => Array ( [0] => + [1] => ( [2] => Array ( [0] => + [1] => ( [2] => +5 [3] => -3 [4] => ) ) [3] => -3 [4] => ) ) [4] => ) ) )

    Read the article

  • Linux C: "Interactive session" with separate read and write named pipes?

    - by ~sd-imi
    Hi all, I am trying to work with "Introduction to Interprocess Communication Using Named Pipes - Full-Duplex Communication Using Named Pipes", http://developers.sun.com/solaris/articles/named_pipes.html#5 ; in particular fd_server.c (included below for reference) Here is my info and compile line: :~$ cat /etc/issue Ubuntu 10.04 LTS \n \l :~$ gcc --version gcc (Ubuntu 4.4.3-4ubuntu5) 4.4.3 :~$ gcc fd_server.c -o fd_server fd_server.c creates two named pipes, one for reading and one for writing. What one can do, is: in one terminal, run the server and read (through cat) its write pipe: :~$ ./fd_server & 2/dev/null [1] 11354 :~$ cat /tmp/np2 and in another, write (using echo) to server's read pipe: :~$ echo "heeellloooo" /tmp/np1 going back to first terminal, one can see: :~$ cat /tmp/np2 HEEELLLOOOO 0[1]+ Exit 13 ./fd_server 2 /dev/null What I would like to do, is make sort of a "interactive" (or "shell"-like) session; that is, the server is run as usual, but instead of running "cat" and "echo", I'd like to use something akin to screen. What I mean by that, is that screen can be called like screen /dev/ttyS0 38400, and then it makes a sort of a interactive session, where what is typed in terminal is passed to /dev/ttyS0, and its response is written to terminal. Now, of course, I cannot use screen, because in my case the program has two separate nodes, and as far as I can tell, screen can refer to only one. How would one go about to achieve this sort of "interactive" session in this context (with two separate read/write pipes)? Thanks, Cheers! Code below: #include <stdio.h> #include <errno.h> #include <ctype.h> #include <sys/types.h> #include <sys/stat.h> #include <fcntl.h> //#include <fullduplex.h> /* For name of the named-pipe */ #define NP1 "/tmp/np1" #define NP2 "/tmp/np2" #define MAX_BUF_SIZE 255 #include <stdlib.h> //exit #include <string.h> //strlen int main(int argc, char *argv[]) { int rdfd, wrfd, ret_val, count, numread; char buf[MAX_BUF_SIZE]; /* Create the first named - pipe */ ret_val = mkfifo(NP1, 0666); if ((ret_val == -1) && (errno != EEXIST)) { perror("Error creating the named pipe"); exit (1); } ret_val = mkfifo(NP2, 0666); if ((ret_val == -1) && (errno != EEXIST)) { perror("Error creating the named pipe"); exit (1); } /* Open the first named pipe for reading */ rdfd = open(NP1, O_RDONLY); /* Open the second named pipe for writing */ wrfd = open(NP2, O_WRONLY); /* Read from the first pipe */ numread = read(rdfd, buf, MAX_BUF_SIZE); buf[numread] = '0'; fprintf(stderr, "Full Duplex Server : Read From the pipe : %sn", buf); /* Convert to the string to upper case */ count = 0; while (count < numread) { buf[count] = toupper(buf[count]); count++; } /* * Write the converted string back to the second * pipe */ write(wrfd, buf, strlen(buf)); } Edit: Right, just to clarify - it seems I found a document discussing something very similar, it is http://en.wikibooks.org/wiki/Serial_Programming/Serial_Linux#Configuration_with_stty - a modification of the script there ("For example, the following script configures the device and starts a background process for copying all received data from the serial device to standard output...") for the above program is below: # stty raw # ( ./fd_server 2>/dev/null; )& bgPidS=$! ( cat < /tmp/np2 ; )& bgPid=$! # Read commands from user, send them to device echo $(kill -0 $bgPidS 2>/dev/null ; echo $?) while [ "$(kill -0 $bgPidS 2>/dev/null ; echo $?)" -eq "0" ] && read cmd; do # redirect debug msgs to stderr, as here we're redirected to /tmp/np1 echo "$? - $bgPidS - $bgPid" >&2 echo "$cmd" echo -e "\nproc: $(kill -0 $bgPidS 2>/dev/null ; echo $?)" >&2 done >/tmp/np1 echo OUT # Terminate background read process - if they still exist if [ "$(kill -0 $bgPid 2>/dev/null ; echo $?)" -eq "0" ] ; then kill $bgPid fi if [ "$(kill -0 $bgPidS 2>/dev/null ; echo $?)" -eq "0" ] ; then kill $bgPidS fi # stty cooked So, saving the script as say starter.sh and calling it, results with the following session: $ ./starter.sh 0 i'm typing here and pressing [enter] at end 0 - 13496 - 13497 I'M TYPING HERE AND PRESSING [ENTER] AT END 0~?.N=?(?~? ?????}????@??????~? [garble] proc: 0 OUT which is what I'd call for "interactive session" (ignoring the debug statements) - server waits for me to enter a command; it gives its output after it receives a command (and as in this case it exits after first command, so does the starter script as well). Except that, I'd like to not have buffered input, but sent character by character (meaning the above session should exit after first key press, and print out a single letter only - which is what I expected stty raw would help with, but it doesn't: it just kills reaction to both Enter and Ctrl-C :) ) I was just wandering if there already is an existing command (akin to screen in respect to serial devices, I guess) that would accept two such named pipes as arguments, and establish a "terminal" or "shell" like session through them; or would I have to use scripts as above and/or program own 'client' that will behave as a terminal..

    Read the article

  • OpenSSL in C++ email client - server closes connection with TLSv1 Alert message

    - by mice
    My app connects to a IMAP email server. One client configured his server to reject SSLv2 certificates, and now my app fails to connect to the server. All other email clients connect to this server successfully. My app uses openssl. I debugged by creating minimal openssl client and attempt to connect to the server. Below is the code with connects to the mail server (using Windows sockets, but same problem is with unix sockets). Server sends its initial IMAP greeting message, but after client sends 1st command, server closes connection. In Wireshark, I see that after sending command to server, it returns TLSv1 error message 21 (Encrypted Alert) and connection is gone. I'm looking for proper setup of OpenSSL for this connection to succeed. Thanks #include <stdio.h> #include <memory.h> #include <errno.h> #include <sys/types.h> #include <winsock2.h> #include <openssl/crypto.h> #include <openssl/x509.h> #include <openssl/pem.h> #include <openssl/ssl.h> #include <openssl/err.h> #define CHK_NULL(x) if((x)==NULL) exit(1) #define CHK_ERR(err,s) if((err)==-1) { perror(s); exit(1); } #define CHK_SSL(err) if((err)==-1) { ERR_print_errors_fp(stderr); exit(2); } SSL *ssl; char buf[4096]; void write(const char *s){ int err = SSL_write(ssl, s, strlen(s)); printf("> %s\n", s); CHK_SSL(err); } void read(){ int n = SSL_read(ssl, buf, sizeof(buf) - 1); CHK_SSL(n); if(n==0){ printf("Finished\n"); exit(1); } buf[n] = 0; printf("%s\n", buf); } void main(){ int err=0; SSLeay_add_ssl_algorithms(); SSL_METHOD *meth = SSLv23_client_method(); SSL_load_error_strings(); SSL_CTX *ctx = SSL_CTX_new(meth); CHK_NULL(ctx); WSADATA data; WSAStartup(0x202, &data); int sd = socket(AF_INET, SOCK_STREAM, IPPROTO_TCP); CHK_ERR(sd, "socket"); struct sockaddr_in sa; memset(&sa, 0, sizeof(sa)); sa.sin_family = AF_INET; sa.sin_addr.s_addr = inet_addr("195.137.27.14"); sa.sin_port = htons(993); err = connect(sd,(struct sockaddr*) &sa, sizeof(sa)); CHK_ERR(err, "connect"); /* ----------------------------------------------- */ /* Now we have TCP connection. Start SSL negotiation. */ ssl = SSL_new(ctx); CHK_NULL(ssl); SSL_set_fd(ssl, sd); err = SSL_connect(ssl); CHK_SSL(err); // Following two steps are optional and not required for data exchange to be successful. /* printf("SSL connection using %s\n", SSL_get_cipher(ssl)); X509 *server_cert = SSL_get_peer_certificate(ssl); CHK_NULL(server_cert); printf("Server certificate:\n"); char *str = X509_NAME_oneline(X509_get_subject_name(server_cert),0,0); CHK_NULL(str); printf(" subject: %s\n", str); OPENSSL_free(str); str = X509_NAME_oneline(X509_get_issuer_name (server_cert),0,0); CHK_NULL(str); printf(" issuer: %s\n", str); OPENSSL_free(str); // We could do all sorts of certificate verification stuff here before deallocating the certificate. X509_free(server_cert); */ printf("\n\n"); read(); // get initial IMAP greeting write("1 CAPABILITY\r\n"); // send 1st command read(); // get reply to cmd; server closes connection here write("2 LOGIN a b\r\n"); read(); SSL_shutdown(ssl); closesocket(sd); SSL_free(ssl); SSL_CTX_free(ctx); }

    Read the article

  • Stacked up with web service configuration

    - by Allan Chua
    I'm currently stacked with the web service that im creating right now. when Testing it in local it all works fine but when I try to deploy it to the web server it throws me the following error An error occurred while trying to make a request to URI '...my web service URI here....'. This could be due to attempting to access a service in a cross-domain way without a proper cross-domain policy in place, or a policy that is unsuitable for SOAP services. You may need to contact the owner of the service to publish a cross-domain policy file and to ensure it allows SOAP-related HTTP headers to be sent. This error may also be caused by using internal types in the web service proxy without using the InternalsVisibleToAttribute attribute. Please see the inner exception for more details. here is my web config. <?xml version="1.0"?> <configuration> <configSections> </configSections> <system.webServer> <modules runAllManagedModulesForAllRequests="true"> </modules> <validation validateIntegratedModeConfiguration="false" /> <security> <requestFiltering> <requestLimits maxAllowedContentLength="2000000000" /> </requestFiltering> </security> </system.webServer> <connectionStrings> <add name="........" providerName="System.Data.SqlClient" /> </connectionStrings> <appSettings> <!-- Testing --> <add key="DataConnectionString" value="..........." /> </appSettings> <system.web> <compilation debug="true" targetFramework="4.0"> <buildProviders> <add extension=".rdlc" type="Microsoft.Reporting.RdlBuildProvider, Microsoft.ReportViewer.WebForms, Version=10.0.0.0, Culture=neutral, PublicKeyToken=b03f5f7f11d50a3a" /> </buildProviders> </compilation> <httpRuntime executionTimeout="1200" maxRequestLength="2000000" /> </system.web> <system.serviceModel> <serviceHostingEnvironment aspNetCompatibilityEnabled="true" multipleSiteBindingsEnabled="true" /> <behaviors> <serviceBehaviors> <behavior name="Service1"> <serviceMetadata httpGetEnabled="true" /> <serviceDebug includeExceptionDetailInFaults="true" /> <dataContractSerializer maxItemsInObjectGraph="2000000000" /> </behavior> <behavior name=""> <serviceMetadata httpGetEnabled="true" /> <serviceDebug includeExceptionDetailInFaults="false" /> </behavior> <behavior name="nextSPOTServiceBehavior"> <serviceMetadata httpsGetEnabled="true"/> <serviceDebug includeExceptionDetailInFaults="true" /> <dataContractSerializer maxItemsInObjectGraph="2000000000" /> </behavior> </serviceBehaviors> </behaviors> <bindings> <basicHttpBinding> <binding name="SecureBasic" closeTimeout="00:10:00" openTimeout="00:10:00" receiveTimeout="00:10:00" sendTimeout="00:10:00" maxBufferSize="2147483647" maxReceivedMessageSize="2147483647"> <security mode="Transport" /> <readerQuotas maxArrayLength="2000000" maxStringContentLength="2000000"/> </binding> <binding name="BasicHttpBinding_IDownloadManagerService" closeTimeout="00:10:00" openTimeout="00:10:00" receiveTimeout="00:10:00" sendTimeout="00:10:00" maxBufferSize="2147483647" maxReceivedMessageSize="2147483647"> <security mode="Transport" /> </binding> </basicHttpBinding> </bindings> <services> <service behaviorConfiguration="nextSPOTServiceBehavior" name="NextSPOTDownloadManagerWebServiceTester.Web.WebServices.DownloadManagerService"> <endpoint binding="basicHttpBinding" bindingConfiguration="SecureBasic" name="basicHttpSecure" contract="NextSPOTDownloadManagerWebServiceTester.Web.WebServices.IDownloadManagerService" /> <!--<endpoint binding="basicHttpBinding" bindingConfiguration="" name="basicHttp" contract="NextSPOTDownloadManagerWebServiceTester.Web.WebServices.IDownloadManagerService" />--> <!--<endpoint address="" binding="basicHttpBinding" bindingConfiguration="BasicHttpBinding_IDownloadManagerService" contract="NextSPOTDownloadManagerWebServiceTester.Web.WebServices.IDownloadManagerService" /> <endpoint address="mex" binding="mexHttpsBinding" contract="IMetadataExchange" />--> </service> </services > </system.serviceModel> </configuration>

    Read the article

  • Is multithreading the right way to go for my case?

    - by Julien Lebosquain
    Hello, I'm currently designing a multi-client / server application. I'm using plain good old sockets because WCF or similar technology is not what I need. Let me explain: it isn't the classical case of a client simply calling a service; all clients can 'interact' with each other by sending a packet to the server, which will then do some action, and possible re-dispatch an answer message to one or more clients. Although doable with WCF, the application will get pretty complex with hundreds of different messages. For each connected client, I'm of course using asynchronous methods to send and receive bytes. I've got the messages fully working, everything's fine. Except that for each line of code I'm writing, my head just burns because of multithreading issues. Since there could be around 200 clients connected at the same time, I chose to go the fully multithreaded way: each received message on a socket is immediately processed on the thread pool thread it was received, not on a single consumer thread. Since each client can interact with other clients, and indirectly with shared objects on the server, I must protect almost every object that is mutable. I first went with a ReaderWriterLockSlim for each resource that must be protected, but quickly noticed that there are more writes overall than reads in the server application, and switched to the well-known Monitor to simplify the code. So far, so good. Each resource is protected, I have helper classes that I must use to get a lock and its protected resource, so I can't use an object without getting a lock. Moreover, each client has its own lock that is entered as soon as a packet is received from its socket. It's done to prevent other clients from making changes to the state of this client while it has some messages being processed, which is something that will happen frequently. Now, I don't just need to protect resources from concurrent accesses. I must keep every client in sync with the server for some collections I have. One tricky part that I'm currently struggling with is the following: I have a collection of clients. Each client has its own unique ID. When a client connects, it must receive the IDs of every connected client, and each one of them must be notified of the newcomer's ID. When a client disconnects, every other client must know it so that its ID is no longer valid for them. Every client must always have, at a given time, the same clients collection as the server so that I can assume that everybody knows everybody. This way if I'm sending a message to client #1 telling "Client #2 has done something", I know that it will always be correctly interpreted: Client 1 will never wonder "but who is Client 2 anyway?". My first attempt for handling the connection of a new client (let's call it X) was this pseudo-code (remember that newClient is already locked here): lock (clients) { foreach (var client in clients) { lock (client) { client.Send("newClient with id X has connected"); } } clients.Add(newClient); newClient.Send("the list of other clients"); } Now imagine that in the same time, another client has sent a packet that translates into a message that must be broadcasted to every connected client, the pseudo-code will be something like this (remember that the current client - let's call it Y - is already locked here): lock (clients) { foreach (var client in clients) { lock (client) { client.Send("something"); } } } An obvious deadlock occurs here: on one thread X is locked, the clients lock has been entered, started looping through the clients, and at one moment must get Y's lock... which is already acquired on the second thread, itself waiting for the clients collection lock to be released! This is not the only case like this in the server application. There are other collections which must be kept in sync with the clients, some properties on a client can be changed by another one, etc. I tried other types of locks, lock-free mechanisms and a bunch of other things. Either there were obvious deadlocks when I'm using too much locks for safety, or obvious race conditions otherwise. When I finally find a good middle point between the two, it usually comes with very subtle race conditions / dead locks and other multi-threading issues... my head hurts very quickly since for any single line of code I'm writing I have to review almost the whole application to ensure everything will behave correctly with any number of threads. So here's my final question: how would you resolve this specific case, the general case, and more importantly: aren't I going the wrong way here? I have little problems with the .NET framework, C#, simple concurrency or algorithms in general. Still, I'm lost here. I know I could use only one thread processing the incoming requests and everything will be fine. However, that won't scale well at all with more clients... But I'm thinking more and more to go this simple way. What do you think? Thanks in advance to you, StackOverflow people which have taken the time to read this huge question. I really had to explain the whole context if I want to get some help.

    Read the article

  • With XSLT, how can I use this if-test with an array, when search element is returned by a template call inside the for loop?

    - by codesforcoffee
    I think this simple example might ask the question a lot more clearly. I have an input file with multiple products. There are 10 types of product (2 product IDs is fine enough for this example), but the input will have 200 products, and I only want to output the info for the first product of each type. (Output info for the lowest priced one, so the first one will be the lowest price because I sort by Price first.) So I want to read in each product, but only output the product's info if I haven't already output a product with that same ID. I couldn't figure out how to get the processID template to return a value that I need to do my if-check on, that uses parameters from inside the for-each Product loop -then properly close the if tag in the right place so it won't output the open Product tag unless it passes the if test. I know the following code does not work, but it illustrates the idea and gives me a place to start: <?xml version="1.0" encoding="utf-8"?> <xsl:stylesheet version="1.0" xmlns:xsl="http://www.w3.org/1999/XSL/Transform"> <xsl:output method="xml" encoding="UTF-8" indent="yes" cdata-section-elements="prod_name adv_notes"/> <xsl:template match="/"> <List> <xsl:for-each select="ProductGroup"> <xsl:sort select="ActiveProducts/Product/Rate"/> <xsl:variable name="IDarray"> <xsl:for-each select="ActiveProducts/Product"> <xsl:variable name="CurrentID"> <xsl:call-template name="processID"> <xsl:with-param name="ProductCode" select="ProductCode" /> </xsl:call-template> </xsl:variable> <xsl:if test="not(contains($IDarray, $CurrentID))"> <child elem="{@elem}"> <xsl:select value-of="$CurrentID" /> </child> <Product> <xsl:attribute name="ID"> <xsl:select value-of="$CurrentID" /> </xsl:attribute> <prod_name> <xsl:value-of select="../ProductName"/> </prod_name> <rate> <xsl:value-of select="../Rate"/> </rate> </Product> </xsl:if> </xsl:for-each> </xsl:variable> </xsl:for-each> </List> </xsl:template> <xsl:template name="processID"> <xsl:param name="ProductCode"/> <xsl:choose> <xsl:when test="starts-with($ProductCode, '515')">5</xsl:when> <xsl:when test="starts-with($ProductCode, '205')">2</xsl:when> </xsl:choose> </xsl:template> Thanks so much in advance, I know some of the awesome programmers here can help! :) -Holly An input would look like this: <ProductGroup> <ActiveProducts> <Product> <ProductCode> 5155 </ProductCode> <ProductName> House </ProductName> <Rate> 3.99 </Rate> </Product> <Product> <ProductCode> 5158 </ProductCode> <ProductName> House </ProductName> <Rate> 4.99 </Rate> </Product> </ActiveProducts> </ProductGroup> <ProductGroup> <ActiveProducts> <Product> <ProductCode> 2058 </ProductCode> <ProductName> House </ProductName> <Rate> 2.99 </Rate> </Product> <Product> <ProductCode> 2055 </ProductCode> <ProductName> House </ProductName> <Rate> 7.99 </Rate> </Product> </ActiveProducts> </ProductGroup> 200 of those with different attributes. I have the translation working, just needed to add that array and if statement somehow. Output would be this for only that simple input file:

    Read the article

  • Adapting non-iterable containers to be iterated via custom templatized iterator

    - by DAldridge
    I have some classes, which for various reasons out of scope of this discussion, I cannot modify (irrelevant implementation details omitted): class Foo { /* ... irrelevant public interface ... */ }; class Bar { public: Foo& get_foo(size_t index) { /* whatever */ } size_t size_foo() { /* whatever */ } }; (There are many similar 'Foo' and 'Bar' classes I'm dealing with, and it's all generated code from elsewhere and stuff I don't want to subclass, etc.) [Edit: clarification - although there are many similar 'Foo' and 'Bar' classes, it is guaranteed that each "outer" class will have the getter and size methods. Only the getter method name and return type will differ for each "outer", based on whatever it's "inner" contained type is. So, if I have Baz which contains Quux instances, there will be Quux& Baz::get_quux(size_t index), and size_t Baz::size_quux().] Given the design of the Bar class, you cannot easily use it in STL algorithms (e.g. for_each, find_if, etc.), and must do imperative loops rather than taking a functional approach (reasons why I prefer the latter is also out of scope for this discussion): Bar b; size_t numFoo = b.size_foo(); for (int fooIdx = 0; fooIdx < numFoo; ++fooIdx) { Foo& f = b.get_foo(fooIdx); /* ... do stuff with 'f' ... */ } So... I've never created a custom iterator, and after reading various questions/answers on S.O. about iterator_traits and the like, I came up with this (currently half-baked) "solution": First, the custom iterator mechanism (NOTE: all uses of 'function' and 'bind' are from std::tr1 in MSVC9): // Iterator mechanism... template <typename TOuter, typename TInner> class ContainerIterator : public std::iterator<std::input_iterator_tag, TInner> { public: typedef function<TInner& (size_t)> func_type; ContainerIterator(const ContainerIterator& other) : mFunc(other.mFunc), mIndex(other.mIndex) {} ContainerIterator& operator++() { ++mIndex; return *this; } bool operator==(const ContainerIterator& other) { return ((mFunc.target<TOuter>() == other.mFunc.target<TOuter>()) && (mIndex == other.mIndex)); } bool operator!=(const ContainerIterator& other) { return !(*this == other); } TInner& operator*() { return mFunc(mIndex); } private: template<typename TOuter, typename TInner> friend class ContainerProxy; ContainerIterator(func_type func, size_t index = 0) : mFunc(func), mIndex(index) {} function<TInner& (size_t)> mFunc; size_t mIndex; }; Next, the mechanism by which I get valid iterators representing begin and end of the inner container: // Proxy(?) to the outer class instance, providing a way to get begin() and end() // iterators to the inner contained instances... template <typename TOuter, typename TInner> class ContainerProxy { public: typedef function<TInner& (size_t)> access_func_type; typedef function<size_t ()> size_func_type; typedef ContainerIterator<TOuter, TInner> iter_type; ContainerProxy(access_func_type accessFunc, size_func_type sizeFunc) : mAccessFunc(accessFunc), mSizeFunc(sizeFunc) {} iter_type begin() const { size_t numItems = mSizeFunc(); if (0 == numItems) return end(); else return ContainerIterator<TOuter, TInner>(mAccessFunc, 0); } iter_type end() const { size_t numItems = mSizeFunc(); return ContainerIterator<TOuter, TInner>(mAccessFunc, numItems); } private: access_func_type mAccessFunc; size_func_type mSizeFunc; }; I can use these classes in the following manner: // Sample function object for taking action on an LMX inner class instance yielded // by iteration... template <typename TInner> class SomeTInnerFunctor { public: void operator()(const TInner& inner) { /* ... whatever ... */ } }; // Example of iterating over an outer class instance's inner container... Bar b; /* assume populated which contained items ... */ ContainerProxy<Bar, Foo> bProxy( bind(&Bar::get_foo, b, _1), bind(&Bar::size_foo, b)); for_each(bProxy.begin(), bProxy.end(), SomeTInnerFunctor<Foo>()); Empirically, this solution functions correctly (minus any copy/paste or typos I may have introduced when editing the above for brevity). So, finally, the actual question: I don't like requiring the use of bind() and _1 placeholders, etcetera by the caller. All they really care about is: outer type, inner type, outer type's method to fetch inner instances, outer type's method to fetch count inner instances. Is there any way to "hide" the bind in the body of the template classes somehow? I've been unable to find a way to separately supply template parameters for the types and inner methods separately... Thanks! David

    Read the article

  • JAVA-SQL- Data Migration - ResultSets comparing Failing JUnit test

    - by user1865053
    I CANNOT get this JUnit Test to pass for the life of me. Can somebody point out where this has gone wrong. I am doing a data migration(MSSQL SERVER 2005), but I have the sourceDBUrl and the targetDCUrl the same URL so to narrow it down to syntax errors. So that is what I have, a syntax error. I am comparing the results of a table for the query SELECT programmeapproval, resourceapproval FROM tr_timesheet WHERE timesheetid = ? and the test always fails, but passes for other junit tests I have developed. I created 3 diffemt resultSetsEqual methods and none work. Yet, some other JUnit tests I have developed have PASSED. THE QUERY: SELECT timesheetid, programmeapproval, resourceapproval FROM tr_timesheet Returns three columns timesheetid (PK,int, not null) (populated with a range of numbers 2240 - 2282) programmeapproval (smallint,not null) (populated with the number 1 in every field) resourceapproval (smallint, not null) (populated with a number 1 in every field) When I run the query that is embedded in the code it only returns one row with the programmeapproval and resourceapproval columns and both field populated with the number 1. I have all jdbc drivers correctly installed and tested for connectivity. The JUnit Test is failing at this point according to the IDE. assertTrue(helper.resultSetsEqual2(sourceVal,targetVal)); This is the code: /*THIS IS A JUNIT CLASS****? package a7.unittests.dao; import static org.junit.Assert.assertTrue; import java.sql.Connection; import java.sql.PreparedStatement; import java.sql.ResultSet; import java.sql.Types; import org.junit.Test; import artemispm.tritonalerts.TimesheetAlert; public class UnitTestTimesheetAlert { @Test public void testQUERY_CHECKALERT() throws Exception{ UnitTestHelper helper = new UnitTestHelper(); Connection con = helper.getConnection(helper.sourceDBUrl); Connection conTarget = helper.getConnection(helper.targetDBUrl); PreparedStatement stmt = con.prepareStatement("select programmeapproval, resourceapproval from tr_timesheet where timesheetid = ?"); stmt.setInt(1, 2240); ResultSet sourceVal = stmt.executeQuery(); stmt = conTarget.prepareStatement("select programmeapproval, resourceapproval from tr_timesheet where timesheetid = ?"); stmt.setInt(1,2240); ResultSet targetVal = stmt.executeQuery(); assertTrue(helper.resultSetsEqual2(sourceVal,targetVal)); }} /*END**/ /*THIS IS A REGULAR CLASS**/ package a7.unittests.dao; import java.sql.Connection; import java.sql.DriverManager; import java.sql.ResultSet; import java.sql.ResultSetMetaData; import java.sql.SQLException; public class UnitTestHelper { static String sourceDBUrl = "jdbc:sqlserver://127.0.0.1:1433;databaseName=a7itm;user=a7user;password=a7user"; static String targetDBUrl = "jdbc:sqlserver://127.0.0.1:1433;databaseName=a7itm;user=a7user;password=a7user"; public Connection getConnection(String url)throws Exception{ return DriverManager.getConnection(url); } public boolean resultSetsEqual3 (ResultSet rs1, ResultSet rs2) throws SQLException { int col = 1; //ResultSetMetaData metadata = rs1.getMetaData(); //int count = metadata.getColumnCount(); while (rs1.next() && rs2.next()) { final Object res1 = rs1.getObject(col); final Object res2 = rs2.getObject(col); // Check values if (!res1.equals(res2)) { throw new RuntimeException(String.format("%s and %s aren't equal at common position %d", res1, res2, col)); } // rs1 and rs2 must reach last row in the same iteration if ((rs1.isLast() != rs2.isLast())) { throw new RuntimeException("The two ResultSets contains different number of columns!"); } } return true; } public boolean resultSetsEqual (ResultSet source, ResultSet target) throws SQLException{ while(source.next()) { target.next(); ResultSetMetaData metadata = source.getMetaData(); int count = metadata.getColumnCount(); for (int i =1; i<=count; i++) { if(source.getObject(i) != target.getObject(i)) { return false; } } } return true; } public boolean resultSetsEqual2 (ResultSet source, ResultSet target) throws SQLException{ while(source.next()) { target.next(); ResultSetMetaData metadata = source.getMetaData(); int count = metadata.getColumnCount(); for (int i =1; i<=count; i++) { if(source.getObject(i).equals(target.getObject(i))) { return false; } } } return true; } } /END***/ /*PASTED NEW CLASS - THIS IS A JUNIT TEST CLASS*/ package a7.unittests.dao; import static org.junit.Assert.*; import java.sql.Connection; import java.sql.DriverManager; import org.junit.Test; public class TestDatabaseConnection { @Test public void testConnection() throws Exception{ UnitTestHelper helper = new UnitTestHelper(); Connection con = helper.getConnection(helper.sourceDBUrl); Connection conTarget = helper.getConnection(helper.targetDBUrl); assertTrue(con != null && conTarget != null); } } /**END***/

    Read the article

  • How to set size for divs with different parents

    - by user340524
    I want to create a div layout which is similiar to the following table result: <html> <head> <title>Basic</title> <style> table { border: 1px solid;} </style> </head> <body> <table style="border: 1px solid;"> <tr> <td> Asia</td> <td> <table> <tr> <td>South Asia</td> </td> <td><table> <tr> <td>Republic</td> <td><table> <tr><td>Singapore</td></tr> <tr><td>India</td></tr> </table></td> </tr> <tr> <td>Monarchy</td> <td><table> <tr><td>Bhutan</td></tr> <tr><td>Nepal</td></tr> </table></td> </tr> </table></td> </tr> <tr> <td>East Asia</td> <td><table> <tr> <td>Republic</td> <td><table> <tr><td>China</td></tr> <tr><td>South Corea</td></tr> </table></td> </tr> <tr> <td>Constitutional Monarchy</td> <td><table> <tr><td>something</td></tr> <tr><td>Japan</td></tr> </table></td> </tr> </table></td> </tr> </table></td> </tr> </table> </body> </html> I managed to replicate this with some effort. The problem is that I want the names of the countries to be in a column or if you will - the containers for the government types to be the same width so other containers will align. If I don't do it in nested containers (in the example - nested tables) the rows will get displaced. Currently rows are shown exactly how I want them - the text is in the vertical middle of the what they refer to. Only thing that comes up to my mind is to set the text in the same columns as class=column1, class=column2, etc. and then somehow define the width for the column classes. Problem is the data is defined dynamically and I can't say how much pixels or % of the page I can give to a column, I just need it to stretch with the text. This is my first time I ask about help here so if I am doing it wrong, tell me how do improve my inquiry.

    Read the article

  • Microsoft and jQuery

    - by Rick Strahl
    The jQuery JavaScript library has been steadily getting more popular and with recent developments from Microsoft, jQuery is also getting ever more exposure on the ASP.NET platform including now directly from Microsoft. jQuery is a light weight, open source DOM manipulation library for JavaScript that has changed how many developers think about JavaScript. You can download it and find more information on jQuery on www.jquery.com. For me jQuery has had a huge impact on how I develop Web applications and was probably the main reason I went from dreading to do JavaScript development to actually looking forward to implementing client side JavaScript functionality. It has also had a profound impact on my JavaScript skill level for me by seeing how the library accomplishes things (and often reviewing the terse but excellent source code). jQuery made an uncomfortable development platform (JavaScript + DOM) a joy to work on. Although jQuery is by no means the only JavaScript library out there, its ease of use, small size, huge community of plug-ins and pure usefulness has made it easily the most popular JavaScript library available today. As a long time jQuery user, I’ve been excited to see the developments from Microsoft that are bringing jQuery to more ASP.NET developers and providing more integration with jQuery for ASP.NET’s core features rather than relying on the ASP.NET AJAX library. Microsoft and jQuery – making Friends jQuery is an open source project but in the last couple of years Microsoft has really thrown its weight behind supporting this open source library as a supported component on the Microsoft platform. When I say supported I literally mean supported: Microsoft now offers actual tech support for jQuery as part of their Product Support Services (PSS) as jQuery integration has become part of several of the ASP.NET toolkits and ships in several of the default Web project templates in Visual Studio 2010. The ASP.NET MVC 3 framework (still in Beta) also uses jQuery for a variety of client side support features including client side validation and we can look forward toward more integration of client side functionality via jQuery in both MVC and WebForms in the future. In other words jQuery is becoming an optional but included component of the ASP.NET platform. PSS support means that support staff will answer jQuery related support questions as part of any support incidents related to ASP.NET which provides some piece of mind to some corporate development shops that require end to end support from Microsoft. In addition to including jQuery and supporting it, Microsoft has also been getting involved in providing development resources for extending jQuery’s functionality via plug-ins. Microsoft’s last version of the Microsoft Ajax Library – which is the successor to the native ASP.NET AJAX Library – included some really cool functionality for client templates, databinding and localization. As it turns out Microsoft has rebuilt most of that functionality using jQuery as the base API and provided jQuery plug-ins of these components. Very recently these three plug-ins were submitted and have been approved for inclusion in the official jQuery plug-in repository and been taken over by the jQuery team for further improvements and maintenance. Even more surprising: The jQuery-templates component has actually been approved for inclusion in the next major update of the jQuery core in jQuery V1.5, which means it will become a native feature that doesn’t require additional script files to be loaded. Imagine this – an open source contribution from Microsoft that has been accepted into a major open source project for a core feature improvement. Microsoft has come a long way indeed! What the Microsoft Involvement with jQuery means to you For Microsoft jQuery support is a strategic decision that affects their direction in client side development, but nothing stopped you from using jQuery in your applications prior to Microsoft’s official backing and in fact a large chunk of developers did so readily prior to Microsoft’s announcement. Official support from Microsoft brings a few benefits to developers however. jQuery support in Visual Studio 2010 means built-in support for jQuery IntelliSense, automatically added jQuery scripts in many projects types and a common base for client side functionality that actually uses what most developers are already using. If you have already been using jQuery and were worried about straying from the Microsoft line and their internal Microsoft Ajax Library – worry no more. With official support and the change in direction towards jQuery Microsoft is now following along what most in the ASP.NET community had already been doing by using jQuery, which is likely the reason for Microsoft’s shift in direction in the first place. ASP.NET AJAX and the Microsoft AJAX Library weren’t bad technology – there was tons of useful functionality buried in these libraries. However, these libraries never got off the ground, mainly because early incarnations were squarely aimed at control/component developers rather than application developers. For all the functionality that these controls provided for control developers they lacked in useful and easily usable application developer functionality that was easily accessible in day to day client side development. The result was that even though Microsoft shipped support for these tools in the box (in .NET 3.5 and 4.0), other than for the internal support in ASP.NET for things like the UpdatePanel and the ASP.NET AJAX Control Toolkit as well as some third party vendors, the Microsoft client libraries were largely ignored by the developer community opening the door for other client side solutions. Microsoft seems to be acknowledging developer choice in this case: Many more developers were going down the jQuery path rather than using the Microsoft built libraries and there seems to be little sense in continuing development of a technology that largely goes unused by the majority of developers. Kudos for Microsoft for recognizing this and gracefully changing directions. Note that even though there will be no further development in the Microsoft client libraries they will continue to be supported so if you’re using them in your applications there’s no reason to start running for the exit in a panic and start re-writing everything with jQuery. Although that might be a reasonable choice in some cases, jQuery and the Microsoft libraries work well side by side so that you can leave existing solutions untouched even as you enhance them with jQuery. The Microsoft jQuery Plug-ins – Solid Core Features One of the most interesting developments in Microsoft’s embracing of jQuery is that Microsoft has started contributing to jQuery via standard mechanism set for jQuery developers: By submitting plug-ins. Microsoft took some of the nicest new features of the unpublished Microsoft Ajax Client Library and re-wrote these components for jQuery and then submitted them as plug-ins to the jQuery plug-in repository. Accepted plug-ins get taken over by the jQuery team and that’s exactly what happened with the three plug-ins submitted by Microsoft with the templating plug-in even getting slated to be published as part of the jQuery core in the next major release (1.5). The following plug-ins are provided by Microsoft: jQuery Templates – a client side template rendering engine jQuery Data Link – a client side databinder that can synchronize changes without code jQuery Globalization – provides formatting and conversion features for dates and numbers The first two are ports of functionality that was slated for the Microsoft Ajax Library while functionality for the globalization library provides functionality that was already found in the original ASP.NET AJAX library. To me all three plug-ins address a pressing need in client side applications and provide functionality I’ve previously used in other incarnations, but with more complete implementations. Let’s take a close look at these plug-ins. jQuery Templates http://api.jquery.com/category/plugins/templates/ Client side templating is a key component for building rich JavaScript applications in the browser. Templating on the client lets you avoid from manually creating markup by creating DOM nodes and injecting them individually into the document via code. Rather you can create markup templates – similar to the way you create classic ASP server markup – and merge data into these templates to render HTML which you can then inject into the document or replace existing content with. Output from templates are rendered as a jQuery matched set and can then be easily inserted into the document as needed. Templating is key to minimize client side code and reduce repeated code for rendering logic. Instead a single template can be used in many places for updating and adding content to existing pages. Further if you build pure AJAX interfaces that rely entirely on client rendering of the initial page content, templates allow you to a use a single markup template to handle all rendering of each specific HTML section/element. I’ve used a number of different client rendering template engines with jQuery in the past including jTemplates (a PHP style templating engine) and a modified version of John Resig’s MicroTemplating engine which I built into my own set of libraries because it’s such a commonly used feature in my client side applications. jQuery templates adds a much richer templating model that allows for sub-templates and access to the data items. Like John Resig’s original Micro Template engine, the core basics of the templating engine create JavaScript code which means that templates can include JavaScript code. To give you a basic idea of how templates work imagine I have an application that downloads a set of stock quotes based on a symbol list then displays them in the document. To do this you can create an ‘item’ template that describes how each of the quotes is renderd as a template inside of the document: <script id="stockTemplate" type="text/x-jquery-tmpl"> <div id="divStockQuote" class="errordisplay" style="width: 500px;"> <div class="label">Company:</div><div><b>${Company}(${Symbol})</b></div> <div class="label">Last Price:</div><div>${LastPrice}</div> <div class="label">Net Change:</div><div> {{if NetChange > 0}} <b style="color:green" >${NetChange}</b> {{else}} <b style="color:red" >${NetChange}</b> {{/if}} </div> <div class="label">Last Update:</div><div>${LastQuoteTimeString}</div> </div> </script> The ‘template’ is little more than HTML with some markup expressions inside of it that define the template language. Notice the embedded ${} expressions which reference data from the quote objects returned from an AJAX call on the server. You can embed any JavaScript or value expression in these template expressions. There are also a number of structural commands like {{if}} and {{each}} that provide for rudimentary logic inside of your templates as well as commands ({{tmpl}} and {{wrap}}) for nesting templates. You can find more about the full set of markup expressions available in the documentation. To load up this data you can use code like the following: <script type="text/javascript"> //var Proxy = new ServiceProxy("../PageMethods/PageMethodsService.asmx/"); $(document).ready(function () { $("#btnGetQuotes").click(GetQuotes); }); function GetQuotes() { var symbols = $("#txtSymbols").val().split(","); $.ajax({ url: "../PageMethods/PageMethodsService.asmx/GetStockQuotes", data: JSON.stringify({ symbols: symbols }), // parameter map type: "POST", // data has to be POSTed contentType: "application/json", timeout: 10000, dataType: "json", success: function (result) { var quotes = result.d; var jEl = $("#stockTemplate").tmpl(quotes); $("#quoteDisplay").empty().append(jEl); }, error: function (xhr, status) { alert(status + "\r\n" + xhr.responseText); } }); }; </script> In this case an ASMX AJAX service is called to retrieve the stock quotes. The service returns an array of quote objects. The result is returned as an object with the .d property (in Microsoft service style) that returns the actual array of quotes. The template is applied with: var jEl = $("#stockTemplate").tmpl(quotes); which selects the template script tag and uses the .tmpl() function to apply the data to it. The result is a jQuery matched set of elements that can then be appended to the quote display element in the page. The template is merged against an array in this example. When the result is an array the template is automatically applied to each each array item. If you pass a single data item – like say a stock quote – the template works exactly the same way but is applied only once. Templates also have access to a $data item which provides the current data item and information about the tempalte that is currently executing. This makes it possible to keep context within the context of the template itself and also to pass context from a parent template to a child template which is very powerful. Templates can be evaluated by using the template selector and calling the .tmpl() function on the jQuery matched set as shown above or you can use the static $.tmpl() function to provide a template as a string. This allows you to dynamically create templates in code or – more likely – to load templates from the server via AJAX calls. In short there are options The above shows off some of the basics, but there’s much for functionality available in the template engine. Check the documentation link for more information and links to additional examples. The plug-in download also comes with a number of examples that demonstrate functionality. jQuery templates will become a native component in jQuery Core 1.5, so it’s definitely worthwhile checking out the engine today and get familiar with this interface. As much as I’m stoked about templating becoming part of the jQuery core because it’s such an integral part of many applications, there are also a couple shortcomings in the current incarnation: Lack of Error Handling Currently if you embed an expression that is invalid it’s simply not rendered. There’s no error rendered into the template nor do the various  template functions throw errors which leaves finding of bugs as a runtime exercise. I would like some mechanism – optional if possible – to be able to get error info of what is failing in a template when it’s rendered. No String Output Templates are always rendered into a jQuery matched set and there’s no way that I can see to directly render to a string. String output can be useful for debugging as well as opening up templating for creating non-HTML string output. Limited JavaScript Access Unlike John Resig’s original MicroTemplating Engine which was entirely based on JavaScript code generation these templates are limited to a few structured commands that can ‘execute’. There’s no code execution inside of script code which means you’re limited to calling expressions available in global objects or the data item passed in. This may or may not be a big deal depending on the complexity of your template logic. Error handling has been discussed quite a bit and it’s likely there will be some solution to that particualar issue by the time jQuery templates ship. The others are relatively minor issues but something to think about anyway. jQuery Data Link http://api.jquery.com/category/plugins/data-link/ jQuery Data Link provides the ability to do two-way data binding between input controls and an underlying object’s properties. The typical scenario is linking a textbox to a property of an object and have the object updated when the text in the textbox is changed and have the textbox change when the value in the object or the entire object changes. The plug-in also supports converter functions that can be applied to provide the conversion logic from string to some other value typically necessary for mapping things like textbox string input to say a number property and potentially applying additional formatting and calculations. In theory this sounds great, however in reality this plug-in has some serious usability issues. Using the plug-in you can do things like the following to bind data: person = { firstName: "rick", lastName: "strahl"}; $(document).ready( function() { // provide for two-way linking of inputs $("form").link(person); // bind to non-input elements explicitly $("#objFirst").link(person, { firstName: { name: "objFirst", convertBack: function (value, source, target) { $(target).text(value); } } }); $("#objLast").link(person, { lastName: { name: "objLast", convertBack: function (value, source, target) { $(target).text(value); } } }); }); This code hooks up two-way linking between a couple of textboxes on the page and the person object. The first line in the .ready() handler provides mapping of object to form field with the same field names as properties on the object. Note that .link() does NOT bind items into the textboxes when you call .link() – changes are mapped only when values change and you move out of the field. Strike one. The two following commands allow manual binding of values to specific DOM elements which is effectively a one-way bind. You specify the object and a then an explicit mapping where name is an ID in the document. The converter is required to explicitly assign the value to the element. Strike two. You can also detect changes to the underlying object and cause updates to the input elements bound. Unfortunately the syntax to do this is not very natural as you have to rely on the jQuery data object. To update an object’s properties and get change notification looks like this: function updateFirstName() { $(person).data("firstName", person.firstName + " (code updated)"); } This works fine in causing any linked fields to be updated. In the bindings above both the firstName input field and objFirst DOM element gets updated. But the syntax requires you to use a jQuery .data() call for each property change to ensure that the changes are tracked properly. Really? Sure you’re binding through multiple layers of abstraction now but how is that better than just manually assigning values? The code savings (if any) are going to be minimal. As much as I would like to have a WPF/Silverlight/Observable-like binding mechanism in client script, this plug-in doesn’t help much towards that goal in its current incarnation. While you can bind values, the ‘binder’ is too limited to be really useful. If initial values can’t be assigned from the mappings you’re going to end up duplicating work loading the data using some other mechanism. There’s no easy way to re-bind data with a different object altogether since updates trigger only through the .data members. Finally, any non-input elements have to be bound via code that’s fairly verbose and frankly may be more voluminous than what you might write by hand for manual binding and unbinding. Two way binding can be very useful but it has to be easy and most importantly natural. If it’s more work to hook up a binding than writing a couple of lines to do binding/unbinding this sort of thing helps very little in most scenarios. In talking to some of the developers the feature set for Data Link is not complete and they are still soliciting input for features and functionality. If you have ideas on how you want this feature to be more useful get involved and post your recommendations. As it stands, it looks to me like this component needs a lot of love to become useful. For this component to really provide value, bindings need to be able to be refreshed easily and work at the object level, not just the property level. It seems to me we would be much better served by a model binder object that can perform these binding/unbinding tasks in bulk rather than a tool where each link has to be mapped first. I also find the choice of creating a jQuery plug-in questionable – it seems a standalone object – albeit one that relies on the jQuery library – would provide a more intuitive interface than the current forcing of options onto a plug-in style interface. Out of the three Microsoft created components this is by far the least useful and least polished implementation at this point. jQuery Globalization http://github.com/jquery/jquery-global Globalization in JavaScript applications often gets short shrift and part of the reason for this is that natively in JavaScript there’s little support for formatting and parsing of numbers and dates. There are a number of JavaScript libraries out there that provide some support for globalization, but most are limited to a particular portion of globalization. As .NET developers we’re fairly spoiled by the richness of APIs provided in the framework and when dealing with client development one really notices the lack of these features. While you may not necessarily need to localize your application the globalization plug-in also helps with some basic tasks for non-localized applications: Dealing with formatting and parsing of dates and time values. Dates in particular are problematic in JavaScript as there are no formatters whatsoever except the .toString() method which outputs a verbose and next to useless long string. With the globalization plug-in you get a good chunk of the formatting and parsing functionality that the .NET framework provides on the server. You can write code like the following for example to format numbers and dates: var date = new Date(); var output = $.format(date, "MMM. dd, yy") + "\r\n" + $.format(date, "d") + "\r\n" + // 10/25/2010 $.format(1222.32213, "N2") + "\r\n" + $.format(1222.33, "c") + "\r\n"; alert(output); This becomes even more useful if you combine it with templates which can also include any JavaScript expressions. Assuming the globalization plug-in is loaded you can create template expressions that use the $.format function. Here’s the template I used earlier for the stock quote again with a couple of formats applied: <script id="stockTemplate" type="text/x-jquery-tmpl"> <div id="divStockQuote" class="errordisplay" style="width: 500px;"> <div class="label">Company:</div><div><b>${Company}(${Symbol})</b></div> <div class="label">Last Price:</div> <div>${$.format(LastPrice,"N2")}</div> <div class="label">Net Change:</div><div> {{if NetChange > 0}} <b style="color:green" >${NetChange}</b> {{else}} <b style="color:red" >${NetChange}</b> {{/if}} </div> <div class="label">Last Update:</div> <div>${$.format(LastQuoteTime,"MMM dd, yyyy")}</div> </div> </script> There are also parsing methods that can parse dates and numbers from strings into numbers easily: alert($.parseDate("25.10.2010")); alert($.parseInt("12.222")); // de-DE uses . for thousands separators As you can see culture specific options are taken into account when parsing. The globalization plugin provides rich support for a variety of locales: Get a list of all available cultures Query cultures for culture items (like currency symbol, separators etc.) Localized string names for all calendar related items (days of week, months) Generated off of .NET’s supported locales In short you get much of the same functionality that you already might be using in .NET on the server side. The plugin includes a huge number of locales and an Globalization.all.min.js file that contains the text defaults for each of these locales as well as small locale specific script files that define each of the locale specific settings. It’s highly recommended that you NOT use the huge globalization file that includes all locales, but rather add script references to only those languages you explicitly care about. Overall this plug-in is a welcome helper. Even if you use it with a single locale (like en-US) and do no other localization, you’ll gain solid support for number and date formatting which is a vital feature of many applications. Changes for Microsoft It’s good to see Microsoft coming out of its shell and away from the ‘not-built-here’ mentality that has been so pervasive in the past. It’s especially good to see it applied to jQuery – a technology that has stood in drastic contrast to Microsoft’s own internal efforts in terms of design, usage model and… popularity. It’s great to see that Microsoft is paying attention to what customers prefer to use and supporting the customer sentiment – even if it meant drastically changing course of policy and moving into a more open and sharing environment in the process. The additional jQuery support that has been introduced in the last two years certainly has made lives easier for many developers on the ASP.NET platform. It’s also nice to see Microsoft submitting proposals through the standard jQuery process of plug-ins and getting accepted for various very useful projects. Certainly the jQuery Templates plug-in is going to be very useful to many especially since it will be baked into the jQuery core in jQuery 1.5. I hope we see more of this type of involvement from Microsoft in the future. Kudos!© Rick Strahl, West Wind Technologies, 2005-2010Posted in jQuery  ASP.NET  

    Read the article

  • Using FiddlerCore to capture HTTP Requests with .NET

    - by Rick Strahl
    Over the last few weeks I’ve been working on my Web load testing utility West Wind WebSurge. One of the key components of a load testing tool is the ability to capture URLs effectively so that you can play them back later under load. One of the options in WebSurge for capturing URLs is to use its built-in capture tool which acts as an HTTP proxy to capture any HTTP and HTTPS traffic from most Windows HTTP clients, including Web Browsers as well as standalone Windows applications and services. To make this happen, I used Eric Lawrence’s awesome FiddlerCore library, which provides most of the functionality of his desktop Fiddler application, all rolled into an easy to use library that you can plug into your own applications. FiddlerCore makes it almost too easy to capture HTTP content! For WebSurge I needed to capture all HTTP traffic in order to capture the full HTTP request – URL, headers and any content posted by the client. The result of what I ended up creating is this semi-generic capture form: In this post I’m going to demonstrate how easy it is to use FiddlerCore to build this HTTP Capture Form.  If you want to jump right in here are the links to get Telerik’s Fiddler Core and the code for the demo provided here. FiddlerCore Download FiddlerCore on NuGet Show me the Code (WebSurge Integration code from GitHub) Download the WinForms Sample Form West Wind Web Surge (example implementation in live app) Note that FiddlerCore is bound by a license for commercial usage – see license.txt in the FiddlerCore distribution for details. Integrating FiddlerCore FiddlerCore is a library that simply plugs into your application. You can download it from the Telerik site and manually add the assemblies to your project, or you can simply install the NuGet package via:       PM> Install-Package FiddlerCore The library consists of the FiddlerCore.dll as well as a couple of support libraries (CertMaker.dll and BCMakeCert.dll) that are used for installing SSL certificates. I’ll have more on SSL captures and certificate installation later in this post. But first let’s see how easy it is to use FiddlerCore to capture HTTP content by looking at how to build the above capture form. Capturing HTTP Content Once the library is installed it’s super easy to hook up Fiddler functionality. Fiddler includes a number of static class methods on the FiddlerApplication object that can be called to hook up callback events as well as actual start monitoring HTTP URLs. In the following code directly lifted from WebSurge, I configure a few filter options on Form level object, from the user inputs shown on the form by assigning it to a capture options object. In the live application these settings are persisted configuration values, but in the demo they are one time values initialized and set on the form. Once these options are set, I hook up the AfterSessionComplete event to capture every URL that passes through the proxy after the request is completed and start up the Proxy service:void Start() { if (tbIgnoreResources.Checked) CaptureConfiguration.IgnoreResources = true; else CaptureConfiguration.IgnoreResources = false; string strProcId = txtProcessId.Text; if (strProcId.Contains('-')) strProcId = strProcId.Substring(strProcId.IndexOf('-') + 1).Trim(); strProcId = strProcId.Trim(); int procId = 0; if (!string.IsNullOrEmpty(strProcId)) { if (!int.TryParse(strProcId, out procId)) procId = 0; } CaptureConfiguration.ProcessId = procId; CaptureConfiguration.CaptureDomain = txtCaptureDomain.Text; FiddlerApplication.AfterSessionComplete += FiddlerApplication_AfterSessionComplete; FiddlerApplication.Startup(8888, true, true, true); } The key lines for FiddlerCore are just the last two lines of code that include the event hookup code as well as the Startup() method call. Here I only hook up to the AfterSessionComplete event but there are a number of other events that hook various stages of the HTTP request cycle you can also hook into. Other events include BeforeRequest, BeforeResponse, RequestHeadersAvailable, ResponseHeadersAvailable and so on. In my case I want to capture the request data and I actually have several options to capture this data. AfterSessionComplete is the last event that fires in the request sequence and it’s the most common choice to capture all request and response data. I could have used several other events, but AfterSessionComplete is one place where you can look both at the request and response data, so this will be the most common place to hook into if you’re capturing content. The implementation of AfterSessionComplete is responsible for capturing all HTTP request headers and it looks something like this:private void FiddlerApplication_AfterSessionComplete(Session sess) { // Ignore HTTPS connect requests if (sess.RequestMethod == "CONNECT") return; if (CaptureConfiguration.ProcessId > 0) { if (sess.LocalProcessID != 0 && sess.LocalProcessID != CaptureConfiguration.ProcessId) return; } if (!string.IsNullOrEmpty(CaptureConfiguration.CaptureDomain)) { if (sess.hostname.ToLower() != CaptureConfiguration.CaptureDomain.Trim().ToLower()) return; } if (CaptureConfiguration.IgnoreResources) { string url = sess.fullUrl.ToLower(); var extensions = CaptureConfiguration.ExtensionFilterExclusions; foreach (var ext in extensions) { if (url.Contains(ext)) return; } var filters = CaptureConfiguration.UrlFilterExclusions; foreach (var urlFilter in filters) { if (url.Contains(urlFilter)) return; } } if (sess == null || sess.oRequest == null || sess.oRequest.headers == null) return; string headers = sess.oRequest.headers.ToString(); var reqBody = sess.GetRequestBodyAsString(); // if you wanted to capture the response //string respHeaders = session.oResponse.headers.ToString(); //var respBody = session.GetResponseBodyAsString(); // replace the HTTP line to inject full URL string firstLine = sess.RequestMethod + " " + sess.fullUrl + " " + sess.oRequest.headers.HTTPVersion; int at = headers.IndexOf("\r\n"); if (at < 0) return; headers = firstLine + "\r\n" + headers.Substring(at + 1); string output = headers + "\r\n" + (!string.IsNullOrEmpty(reqBody) ? reqBody + "\r\n" : string.Empty) + Separator + "\r\n\r\n"; BeginInvoke(new Action<string>((text) => { txtCapture.AppendText(text); UpdateButtonStatus(); }), output); } The code starts by filtering out some requests based on the CaptureOptions I set before the capture is started. These options/filters are applied when requests actually come in. This is very useful to help narrow down the requests that are captured for playback based on options the user picked. I find it useful to limit requests to a certain domain for captures, as well as filtering out some request types like static resources – images, css, scripts etc. This is of course optional, but I think it’s a common scenario and WebSurge makes good use of this feature. AfterSessionComplete like other FiddlerCore events, provides a Session object parameter which contains all the request and response details. There are oRequest and oResponse objects to hold their respective data. In my case I’m interested in the raw request headers and body only, as you can see in the commented code you can also retrieve the response headers and body. Here the code captures the request headers and body and simply appends the output to the textbox on the screen. Note that the Fiddler events are asynchronous, so in order to display the content in the UI they have to be marshaled back the UI thread with BeginInvoke, which here simply takes the generated headers and appends it to the existing textbox test on the form. As each request is processed, the headers are captured and appended to the bottom of the textbox resulting in a Session HTTP capture in the format that Web Surge internally supports, which is basically raw request headers with a customized 1st HTTP Header line that includes the full URL rather than a server relative URL. When the capture is done the user can either copy the raw HTTP session to the clipboard, or directly save it to file. This raw capture format is the same format WebSurge and also Fiddler use to import/export request data. While this code is application specific, it demonstrates the kind of logic that you can easily apply to the request capture process, which is one of the reasonsof why FiddlerCore is so powerful. You get to choose what content you want to look up as part of your own application logic and you can then decide how to capture or use that data as part of your application. The actual captured data in this case is only a string. The user can edit the data by hand or in the the case of WebSurge, save it to disk and automatically open the captured session as a new load test. Stopping the FiddlerCore Proxy Finally to stop capturing requests you simply disconnect the event handler and call the FiddlerApplication.ShutDown() method:void Stop() { FiddlerApplication.AfterSessionComplete -= FiddlerApplication_AfterSessionComplete; if (FiddlerApplication.IsStarted()) FiddlerApplication.Shutdown(); } As you can see, adding HTTP capture functionality to an application is very straight forward. FiddlerCore offers tons of features I’m not even touching on here – I suspect basic captures are the most common scenario, but a lot of different things can be done with FiddlerCore’s simple API interface. Sky’s the limit! The source code for this sample capture form (WinForms) is provided as part of this article. Adding Fiddler Certificates with FiddlerCore One of the sticking points in West Wind WebSurge has been that if you wanted to capture HTTPS/SSL traffic, you needed to have the full version of Fiddler and have HTTPS decryption enabled. Essentially you had to use Fiddler to configure HTTPS decryption and the associated installation of the Fiddler local client certificate that is used for local decryption of incoming SSL traffic. While this works just fine, requiring to have Fiddler installed and then using a separate application to configure the SSL functionality isn’t ideal. Fortunately FiddlerCore actually includes the tools to register the Fiddler Certificate directly using FiddlerCore. Why does Fiddler need a Certificate in the first Place? Fiddler and FiddlerCore are essentially HTTP proxies which means they inject themselves into the HTTP conversation by re-routing HTTP traffic to a special HTTP port (8888 by default for Fiddler) and then forward the HTTP data to the original client. Fiddler injects itself as the system proxy in using the WinInet Windows settings  which are the same settings that Internet Explorer uses and that are configured in the Windows and Internet Explorer Internet Settings dialog. Most HTTP clients running on Windows pick up and apply these system level Proxy settings before establishing new HTTP connections and that’s why most clients automatically work once Fiddler – or FiddlerCore/WebSurge are running. For plain HTTP requests this just works – Fiddler intercepts the HTTP requests on the proxy port and then forwards them to the original port (80 for HTTP and 443 for SSL typically but it could be any port). For SSL however, this is not quite as simple – Fiddler can easily act as an HTTPS/SSL client to capture inbound requests from the server, but when it forwards the request to the client it has to also act as an SSL server and provide a certificate that the client trusts. This won’t be the original certificate from the remote site, but rather a custom local certificate that effectively simulates an SSL connection between the proxy and the client. If there is no custom certificate configured for Fiddler the SSL request fails with a certificate validation error. The key for this to work is that a custom certificate has to be installed that the HTTPS client trusts on the local machine. For a much more detailed description of the process you can check out Eric Lawrence’s blog post on Certificates. If you’re using the desktop version of Fiddler you can install a local certificate into the Windows certificate store. Fiddler proper does this from the Options menu: This operation does several things: It installs the Fiddler Root Certificate It sets trust to this Root Certificate A new client certificate is generated for each HTTPS site monitored Certificate Installation with FiddlerCore You can also provide this same functionality using FiddlerCore which includes a CertMaker class. Using CertMaker is straight forward to use and it provides an easy way to create some simple helpers that can install and uninstall a Fiddler Root certificate:public static bool InstallCertificate() { if (!CertMaker.rootCertExists()) { if (!CertMaker.createRootCert()) return false; if (!CertMaker.trustRootCert()) return false; } return true; } public static bool UninstallCertificate() { if (CertMaker.rootCertExists()) { if (!CertMaker.removeFiddlerGeneratedCerts(true)) return false; } return true; } InstallCertificate() works by first checking whether the root certificate is already installed and if it isn’t goes ahead and creates a new one. The process of creating the certificate is a two step process – first the actual certificate is created and then it’s moved into the certificate store to become trusted. I’m not sure why you’d ever split these operations up since a cert created without trust isn’t going to be of much value, but there are two distinct steps. When you trigger the trustRootCert() method, a message box will pop up on the desktop that lets you know that you’re about to trust a local private certificate. This is a security feature to ensure that you really want to trust the Fiddler root since you are essentially installing a man in the middle certificate. It’s quite safe to use this generated root certificate, because it’s been specifically generated for your machine and thus is not usable from external sources, the only way to use this certificate in a trusted way is from the local machine. IOW, unless somebody has physical access to your machine, there’s no useful way to hijack this certificate and use it for nefarious purposes (see Eric’s post for more details). Once the Root certificate has been installed, FiddlerCore/Fiddler create new certificates for each site that is connected to with HTTPS. You can end up with quite a few temporary certificates in your certificate store. To uninstall you can either use Fiddler and simply uncheck the Decrypt HTTPS traffic option followed by the remove Fiddler certificates button, or you can use FiddlerCore’s CertMaker.removeFiddlerGeneratedCerts() which removes the root cert and any of the intermediary certificates Fiddler created. Keep in mind that when you uninstall you uninstall the certificate for both FiddlerCore and Fiddler, so use UninstallCertificate() with care and realize that you might affect the Fiddler application’s operation by doing so as well. When to check for an installed Certificate Note that the check to see if the root certificate exists is pretty fast, while the actual process of installing the certificate is a relatively slow operation that even on a fast machine takes a few seconds. Further the trust operation pops up a message box so you probably don’t want to install the certificate repeatedly. Since the check for the root certificate is fast, you can easily put a call to InstallCertificate() in any capture startup code – in which case the certificate installation only triggers when a certificate is in fact not installed. Personally I like to make certificate installation explicit – just like Fiddler does, so in WebSurge I use a small drop down option on the menu to install or uninstall the SSL certificate:   This code calls the InstallCertificate and UnInstallCertificate functions respectively – the experience with this is similar to what you get in Fiddler with the extra dialog box popping up to prompt confirmation for installation of the root certificate. Once the cert is installed you can then capture SSL requests. There’s a gotcha however… Gotcha: FiddlerCore Certificates don’t stick by Default When I originally tried to use the Fiddler certificate installation I ran into an odd problem. I was able to install the certificate and immediately after installation was able to capture HTTPS requests. Then I would exit the application and come back in and try the same HTTPS capture again and it would fail due to a missing certificate. CertMaker.rootCertExists() would return false after every restart and if re-installed the certificate a new certificate would get added to the certificate store resulting in a bunch of duplicated root certificates with different keys. What the heck? CertMaker and BcMakeCert create non-sticky CertificatesI turns out that FiddlerCore by default uses different components from what the full version of Fiddler uses. Fiddler uses a Windows utility called MakeCert.exe to create the Fiddler Root certificate. FiddlerCore however installs the CertMaker.dll and BCMakeCert.dll assemblies, which use a different crypto library (Bouncy Castle) for certificate creation than MakeCert.exe which uses the Windows Crypto API. The assemblies provide support for non-windows operation for Fiddler under Mono, as well as support for some non-Windows certificate platforms like iOS and Android for decryption. The bottom line is that the FiddlerCore provided bouncy castle assemblies are not sticky by default as the certificates created with them are not cached as they are in Fiddler proper. To get certificates to ‘stick’ you have to explicitly cache the certificates in Fiddler’s internal preferences. A cache aware version of InstallCertificate looks something like this:public static bool InstallCertificate() { if (!CertMaker.rootCertExists()) { if (!CertMaker.createRootCert()) return false; if (!CertMaker.trustRootCert()) return false; App.Configuration.UrlCapture.Cert = FiddlerApplication.Prefs.GetStringPref("fiddler.certmaker.bc.cert", null); App.Configuration.UrlCapture.Key = FiddlerApplication.Prefs.GetStringPref("fiddler.certmaker.bc.key", null); } return true; } public static bool UninstallCertificate() { if (CertMaker.rootCertExists()) { if (!CertMaker.removeFiddlerGeneratedCerts(true)) return false; } App.Configuration.UrlCapture.Cert = null; App.Configuration.UrlCapture.Key = null; return true; } In this code I store the Fiddler cert and private key in an application configuration settings that’s stored with the application settings (App.Configuration.UrlCapture object). These settings automatically persist when WebSurge is shut down. The values are read out of Fiddler’s internal preferences store which is set after a new certificate has been created. Likewise I clear out the configuration settings when the certificate is uninstalled. In order for these setting to be used you have to also load the configuration settings into the Fiddler preferences *before* a call to rootCertExists() is made. I do this in the capture form’s constructor:public FiddlerCapture(StressTestForm form) { InitializeComponent(); CaptureConfiguration = App.Configuration.UrlCapture; MainForm = form; if (!string.IsNullOrEmpty(App.Configuration.UrlCapture.Cert)) { FiddlerApplication.Prefs.SetStringPref("fiddler.certmaker.bc.key", App.Configuration.UrlCapture.Key); FiddlerApplication.Prefs.SetStringPref("fiddler.certmaker.bc.cert", App.Configuration.UrlCapture.Cert); }} This is kind of a drag to do and not documented anywhere that I could find, so hopefully this will save you some grief if you want to work with the stock certificate logic that installs with FiddlerCore. MakeCert provides sticky Certificates and the same functionality as Fiddler But there’s actually an easier way. If you want to skip the above Fiddler preference configuration code in your application you can choose to distribute MakeCert.exe instead of certmaker.dll and bcmakecert.dll. When you use MakeCert.exe, the certificates settings are stored in Windows so they are available without any custom configuration inside of your application. It’s easier to integrate and as long as you run on Windows and you don’t need to support iOS or Android devices is simply easier to deal with. To integrate into your project, you can remove the reference to CertMaker.dll (and the BcMakeCert.dll assembly) from your project. Instead copy MakeCert.exe into your output folder. To make sure MakeCert.exe gets pushed out, include MakeCert.exe in your project and set the Build Action to None, and Copy to Output Directory to Copy if newer. Note that the CertMaker.dll reference in the project has been removed and on disk the files for Certmaker.dll, as well as the BCMakeCert.dll files on disk. Keep in mind that these DLLs are resources of the FiddlerCore NuGet package, so updating the package may end up pushing those files back into your project. Once MakeCert.exe is distributed FiddlerCore checks for it first before using the assemblies so as long as MakeCert.exe exists it’ll be used for certificate creation (at least on Windows). Summary FiddlerCore is a pretty sweet tool, and it’s absolutely awesome that we get to plug in most of the functionality of Fiddler right into our own applications. A few years back I tried to build this sort of functionality myself for an app and ended up giving up because it’s a big job to get HTTP right – especially if you need to support SSL. FiddlerCore now provides that functionality as a turnkey solution that can be plugged into your own apps easily. The only downside is FiddlerCore’s documentation for more advanced features like certificate installation which is pretty sketchy. While for the most part FiddlerCore’s feature set is easy to work with without any documentation, advanced features are often not intuitive to gleam by just using Intellisense or the FiddlerCore help file reference (which is not terribly useful). While Eric Lawrence is very responsive on his forum and on Twitter, there simply isn’t much useful documentation on Fiddler/FiddlerCore available online. If you run into trouble the forum is probably the first place to look and then ask a question if you can’t find the answer. The best documentation you can find is Eric’s Fiddler Book which covers a ton of functionality of Fiddler and FiddlerCore. The book is a great reference to Fiddler’s feature set as well as providing great insights into the HTTP protocol. The second half of the book that gets into the innards of HTTP is an excellent read for anybody who wants to know more about some of the more arcane aspects and special behaviors of HTTP – it’s well worth the read. While the book has tons of information in a very readable format, it’s unfortunately not a great reference as it’s hard to find things in the book and because it’s not available online you can’t electronically search for the great content in it. But it’s hard to complain about any of this given the obvious effort and love that’s gone into this awesome product for all of these years. A mighty big thanks to Eric Lawrence  for having created this useful tool that so many of us use all the time, and also to Telerik for picking up Fiddler/FiddlerCore and providing Eric the resources to support and improve this wonderful tool full time and keeping it free for all. Kudos! Resources FiddlerCore Download FiddlerCore NuGet Fiddler Capture Sample Form Fiddler Capture Form in West Wind WebSurge (GitHub) Eric Lawrence’s Fiddler Book© Rick Strahl, West Wind Technologies, 2005-2014Posted in .NET  HTTP   Tweet !function(d,s,id){var js,fjs=d.getElementsByTagName(s)[0];if(!d.getElementById(id)){js=d.createElement(s);js.id=id;js.src="//platform.twitter.com/widgets.js";fjs.parentNode.insertBefore(js,fjs);}}(document,"script","twitter-wjs"); (function() { var po = document.createElement('script'); po.type = 'text/javascript'; po.async = true; po.src = 'https://apis.google.com/js/plusone.js'; var s = document.getElementsByTagName('script')[0]; s.parentNode.insertBefore(po, s); })();

    Read the article

  • .NET HTML Sanitation for rich HTML Input

    - by Rick Strahl
    Recently I was working on updating a legacy application to MVC 4 that included free form text input. When I set up the new site my initial approach was to not allow any rich HTML input, only simple text formatting that would respect a few simple HTML commands for bold, lists etc. and automatically handles line break processing for new lines and paragraphs. This is typical for what I do with most multi-line text input in my apps and it works very well with very little development effort involved. Then the client sprung another note: Oh by the way we have a bunch of customers (real estate agents) who need to post complete HTML documents. Oh uh! There goes the simple theory. After some discussion and pleading on my part (<snicker>) to try and avoid this type of raw HTML input because of potential XSS issues, the client decided to go ahead and allow raw HTML input anyway. There has been lots of discussions on this subject on StackOverFlow (and here and here) but to after reading through some of the solutions I didn't really find anything that would work even closely for what I needed. Specifically we need to be able to allow just about any HTML markup, with the exception of script code. Remote CSS and Images need to be loaded, links need to work and so. While the 'legit' HTML posted by these agents is basic in nature it does span most of the full gamut of HTML (4). Most of the solutions XSS prevention/sanitizer solutions I found were way to aggressive and rendered the posted output unusable mostly because they tend to strip any externally loaded content. In short I needed a custom solution. I thought the best solution to this would be to use an HTML parser - in this case the Html Agility Pack - and then to run through all the HTML markup provided and remove any of the blacklisted tags and a number of attributes that are prone to JavaScript injection. There's much discussion on whether to use blacklists vs. whitelists in the discussions mentioned above, but I found that whitelists can make sense in simple scenarios where you might allow manual HTML input, but when you need to allow a larger array of HTML functionality a blacklist is probably easier to manage as the vast majority of elements and attributes could be allowed. Also white listing gets a bit more complex with HTML5 and the new proliferation of new HTML tags and most new tags generally don't affect XSS issues directly. Pure whitelisting based on elements and attributes also doesn't capture many edge cases (see some of the XSS cheat sheets listed below) so even with a white list, custom logic is still required to handle many of those edge cases. The Microsoft Web Protection Library (AntiXSS) My first thought was to check out the Microsoft AntiXSS library. Microsoft has an HTML Encoding and Sanitation library in the Microsoft Web Protection Library (formerly AntiXSS Library) on CodePlex, which provides stricter functions for whitelist encoding and sanitation. Initially I thought the Sanitation class and its static members would do the trick for me,but I found that this library is way too restrictive for my needs. Specifically the Sanitation class strips out images and links which rendered the full HTML from our real estate clients completely useless. I didn't spend much time with it, but apparently I'm not alone if feeling this library is not really useful without some way to configure operation. To give you an example of what didn't work for me with the library here's a small and simple HTML fragment that includes script, img and anchor tags. I would expect the script to be stripped and everything else to be left intact. Here's the original HTML:var value = "<b>Here</b> <script>alert('hello')</script> we go. Visit the " + "<a href='http://west-wind.com'>West Wind</a> site. " + "<img src='http://west-wind.com/images/new.gif' /> " ; and the code to sanitize it with the AntiXSS Sanitize class:@Html.Raw(Microsoft.Security.Application.Sanitizer.GetSafeHtmlFragment(value)) This produced a not so useful sanitized string: Here we go. Visit the <a>West Wind</a> site. While it removed the <script> tag (good) it also removed the href from the link and the image tag altogether (bad). In some situations this might be useful, but for most tasks I doubt this is the desired behavior. While links can contain javascript: references and images can 'broadcast' information to a server, without configuration to tell the library what to restrict this becomes useless to me. I couldn't find any way to customize the white list, nor is there code available in this 'open source' library on CodePlex. Using Html Agility Pack for HTML Parsing The WPL library wasn't going to cut it. After doing a bit of research I decided the best approach for a custom solution would be to use an HTML parser and inspect the HTML fragment/document I'm trying to import. I've used the HTML Agility Pack before for a number of apps where I needed an HTML parser without requiring an instance of a full browser like the Internet Explorer Application object which is inadequate in Web apps. In case you haven't checked out the Html Agility Pack before, it's a powerful HTML parser library that you can use from your .NET code. It provides a simple, parsable HTML DOM model to full HTML documents or HTML fragments that let you walk through each of the elements in your document. If you've used the HTML or XML DOM in a browser before you'll feel right at home with the Agility Pack. Blacklist based HTML Parsing to strip XSS Code For my purposes of HTML sanitation, the process involved is to walk the HTML document one element at a time and then check each element and attribute against a blacklist. There's quite a bit of argument of what's better: A whitelist of allowed items or a blacklist of denied items. While whitelists tend to be more secure, they also require a lot more configuration. In the case of HTML5 a whitelist could be very extensive. For what I need, I only want to ensure that no JavaScript is executed, so a blacklist includes the obvious <script> tag plus any tag that allows loading of external content including <iframe>, <object>, <embed> and <link> etc. <form>  is also excluded to avoid posting content to a different location. I also disallow <head> and <meta> tags in particular for my case, since I'm only allowing posting of HTML fragments. There is also some internal logic to exclude some attributes or attributes that include references to JavaScript or CSS expressions. The default tag blacklist reflects my use case, but is customizable and can be added to. Here's my HtmlSanitizer implementation:using System.Collections.Generic; using System.IO; using System.Xml; using HtmlAgilityPack; namespace Westwind.Web.Utilities { public class HtmlSanitizer { public HashSet<string> BlackList = new HashSet<string>() { { "script" }, { "iframe" }, { "form" }, { "object" }, { "embed" }, { "link" }, { "head" }, { "meta" } }; /// <summary> /// Cleans up an HTML string and removes HTML tags in blacklist /// </summary> /// <param name="html"></param> /// <returns></returns> public static string SanitizeHtml(string html, params string[] blackList) { var sanitizer = new HtmlSanitizer(); if (blackList != null && blackList.Length > 0) { sanitizer.BlackList.Clear(); foreach (string item in blackList) sanitizer.BlackList.Add(item); } return sanitizer.Sanitize(html); } /// <summary> /// Cleans up an HTML string by removing elements /// on the blacklist and all elements that start /// with onXXX . /// </summary> /// <param name="html"></param> /// <returns></returns> public string Sanitize(string html) { var doc = new HtmlDocument(); doc.LoadHtml(html); SanitizeHtmlNode(doc.DocumentNode); //return doc.DocumentNode.WriteTo(); string output = null; // Use an XmlTextWriter to create self-closing tags using (StringWriter sw = new StringWriter()) { XmlWriter writer = new XmlTextWriter(sw); doc.DocumentNode.WriteTo(writer); output = sw.ToString(); // strip off XML doc header if (!string.IsNullOrEmpty(output)) { int at = output.IndexOf("?>"); output = output.Substring(at + 2); } writer.Close(); } doc = null; return output; } private void SanitizeHtmlNode(HtmlNode node) { if (node.NodeType == HtmlNodeType.Element) { // check for blacklist items and remove if (BlackList.Contains(node.Name)) { node.Remove(); return; } // remove CSS Expressions and embedded script links if (node.Name == "style") { if (string.IsNullOrEmpty(node.InnerText)) { if (node.InnerHtml.Contains("expression") || node.InnerHtml.Contains("javascript:")) node.ParentNode.RemoveChild(node); } } // remove script attributes if (node.HasAttributes) { for (int i = node.Attributes.Count - 1; i >= 0; i--) { HtmlAttribute currentAttribute = node.Attributes[i]; var attr = currentAttribute.Name.ToLower(); var val = currentAttribute.Value.ToLower(); span style="background: white; color: green">// remove event handlers if (attr.StartsWith("on")) node.Attributes.Remove(currentAttribute); // remove script links else if ( //(attr == "href" || attr== "src" || attr == "dynsrc" || attr == "lowsrc") && val != null && val.Contains("javascript:")) node.Attributes.Remove(currentAttribute); // Remove CSS Expressions else if (attr == "style" && val != null && val.Contains("expression") || val.Contains("javascript:") || val.Contains("vbscript:")) node.Attributes.Remove(currentAttribute); } } } // Look through child nodes recursively if (node.HasChildNodes) { for (int i = node.ChildNodes.Count - 1; i >= 0; i--) { SanitizeHtmlNode(node.ChildNodes[i]); } } } } } Please note: Use this as a starting point only for your own parsing and review the code for your specific use case! If your needs are less lenient than mine were you can you can make this much stricter by not allowing src and href attributes or CSS links if your HTML doesn't allow it. You can also check links for external URLs and disallow those - lots of options.  The code is simple enough to make it easy to extend to fit your use cases more specifically. It's also quite easy to make this code work using a WhiteList approach if you want to go that route. The code above is semi-generic for allowing full featured HTML fragments that only disallow script related content. The Sanitize method walks through each node of the document and then recursively drills into all of its children until the entire document has been traversed. Note that the code here uses an XmlTextWriter to write output - this is done to preserve XHTML style self-closing tags which are otherwise left as non-self-closing tags. The sanitizer code scans for blacklist elements and removes those elements not allowed. Note that the blacklist is configurable either in the instance class as a property or in the static method via the string parameter list. Additionally the code goes through each element's attributes and looks for a host of rules gleaned from some of the XSS cheat sheets listed at the end of the post. Clearly there are a lot more XSS vulnerabilities, but a lot of them apply to ancient browsers (IE6 and versions of Netscape) - many of these glaring holes (like CSS expressions - WTF IE?) have been removed in modern browsers. What a Pain To be honest this is NOT a piece of code that I wanted to write. I think building anything related to XSS is better left to people who have far more knowledge of the topic than I do. Unfortunately, I was unable to find a tool that worked even closely for me, or even provided a working base. For the project I was working on I had no choice and I'm sharing the code here merely as a base line to start with and potentially expand on for specific needs. It's sad that Microsoft Web Protection Library is currently such a train wreck - this is really something that should come from Microsoft as the systems vendor or possibly a third party that provides security tools. Luckily for my application we are dealing with a authenticated and validated users so the user base is fairly well known, and relatively small - this is not a wide open Internet application that's directly public facing. As I mentioned earlier in the post, if I had my way I would simply not allow this type of raw HTML input in the first place, and instead rely on a more controlled HTML input mechanism like MarkDown or even a good HTML Edit control that can provide some limits on what types of input are allowed. Alas in this case I was overridden and we had to go forward and allow *any* raw HTML posted. Sometimes I really feel sad that it's come this far - how many good applications and tools have been thwarted by fear of XSS (or worse) attacks? So many things that could be done *if* we had a more secure browser experience and didn't have to deal with every little script twerp trying to hack into Web pages and obscure browser bugs. So much time wasted building secure apps, so much time wasted by others trying to hack apps… We're a funny species - no other species manages to waste as much time, effort and resources as we humans do :-) Resources Code on GitHub Html Agility Pack XSS Cheat Sheet XSS Prevention Cheat Sheet Microsoft Web Protection Library (AntiXss) StackOverflow Links: http://stackoverflow.com/questions/341872/html-sanitizer-for-net http://blog.stackoverflow.com/2008/06/safe-html-and-xss/ http://code.google.com/p/subsonicforums/source/browse/trunk/SubSonic.Forums.Data/HtmlScrubber.cs?r=61© Rick Strahl, West Wind Technologies, 2005-2012Posted in Security  HTML  ASP.NET  JavaScript   Tweet !function(d,s,id){var js,fjs=d.getElementsByTagName(s)[0];if(!d.getElementById(id)){js=d.createElement(s);js.id=id;js.src="//platform.twitter.com/widgets.js";fjs.parentNode.insertBefore(js,fjs);}}(document,"script","twitter-wjs"); (function() { var po = document.createElement('script'); po.type = 'text/javascript'; po.async = true; po.src = 'https://apis.google.com/js/plusone.js'; var s = document.getElementsByTagName('script')[0]; s.parentNode.insertBefore(po, s); })();

    Read the article

  • Tools and Utilities for the .NET Developer

    - by mbcrump
    Tweet this list! Add a link to my site to your bookmarks to quickly find this page again! Add me to twitter! This is a list of the tools/utilities that I use to do my job/hobby. I wanted this page to load fast and contain information that only you care about. If I have missed a tool that you like, feel free to contact me and I will add it to the list. Also, this list took a lot of time to complete. Please do not steal my work, if you like the page then please link back to my site. I will keep the links/information updated as new tools/utilities are created.  Windows/.NET Development – This is a list of tools that any Windows/.NET developer should have in his bag. I have used at some point in my career everything listed on this page and below is the tools worth keeping. Name Description License AnkhSVN Subversion support for Visual Studio. It also works with VS2010. Free Aurora XAML Designer One of the best XAML creation tools available. Has a ton of built in templates that you can copy/paste into VS2010. COST/Trial BeyondCompare Beyond Compare 3 is the ideal tool for comparing files and folders on your Windows or Linux system. Visualize changes in your code and carefully reconcile them. COST/Trial BuildIT Automated Task Tool Its main purpose is to automate tasks, whether it is the final packaging of a product, an automated daily build, maybe sending out a mailing list, even backing-up files. Free C Sharper for VB Convert VB to C#. COST CLRProfiler Analyze and improve the behavior of your .NET app. Free CodeRush Direct competitor to ReSharper, contains similar feature. This is one of those decide for yourself. COST/Trial Disk2VHD Disk2vhd is a utility that creates VHD (Virtual Hard Disk - Microsoft's Virtual Machine disk format) versions of physical disks for use in Microsoft Virtual PC or Microsoft Hyper-V virtual machines (VMs). Free Eazfuscator.NET Is a free obfuscator for .NET. The main purpose is to protect intellectual property of software. Free EQATEC Profiler Make your .NET app run faster. No source code changes are needed. Just point the profiler to your app, run the modified code, and get a visual report. COST Expression Studio 3/4 Comes with Web, Blend, Sketch Flow and more. You can create websites, produce beautiful XAML and more. COST/Trial Expresso The award-winning Expresso editor is equally suitable as a teaching tool for the beginning user of regular expressions or as a full-featured development environment for the experienced programmer or web designer with an extensive knowledge of regular expressions. Free Fiddler Fiddler is a web debugging proxy which logs all HTTP(s) traffic between your computer and the internet. Free Firebug Powerful Web development tool. If you build websites, you will need this. Free FxCop FxCop is an application that analyzes managed code assemblies (code that targets the .NET Framework common language runtime) and reports information about the assemblies, such as possible design, localization, performance, and security improvements. Free GAC Browser and Remover Easy way to remove multiple assemblies from the GAC. Assemblies registered by programs like Install Shield can also be removed. Free GAC Util The Global Assembly Cache tool allows you to view and manipulate the contents of the global assembly cache and download cache. Free HelpScribble Help Scribble is a full-featured, easy-to-use help authoring tool for creating help files from start to finish. You can create Win Help (.hlp) files, HTML Help (.chm) files, a printed manual and online documentation (on a web site) all from the same Help Scribble project. COST/Trial IETester IETester is a free Web Browser that allows you to have the rendering and JavaScript engines of IE9 preview, IE8, IE7 IE 6 and IE5.5 on Windows 7, Vista and XP, as well as the installed IE in the same process. Free iTextSharp iText# (iTextSharp) is a port of the iText open source java library for PDF generation written entirely in C# for the .NET platform. Use the iText mailing list to get support. Free Kaxaml Kaxaml is a lightweight XAML editor that gives you a "split view" so you can see both your XAML and your rendered content. Free LINQPad LinqPad lets you interactively query databases in a LINQ. Free Linquer Many programmers are familiar with SQL and will need a help in the transition to LINQ. Sometimes there are complicated queries to be written and Linqer can help by converting SQL scripts to LINQ. COST/Trial LiquidXML Liquid XML Studio 2010 is an advanced XML developers toolkit and IDE, containing all the tools needed for designing and developing XML schema and applications. COST/Trial Log4Net log4net is a tool to help the programmer output log statements to a variety of output targets. log4net is a port of the excellent log4j framework to the .NET runtime. We have kept the framework similar in spirit to the original log4j while taking advantage of new features in the .NET runtime. For more information on log4net see the features document. Free Microsoft Web Platform Installer The Microsoft Web Platform Installer 2.0 (Web PI) is a free tool that makes getting the latest components of the Microsoft Web Platform, including Internet Information Services (IIS), SQL Server Express, .NET Framework and Visual Web Developer easy. Free Mono Development Don't have Visual Studio - no problem! This is an open Source C# and .NET development environment for Linux, Windows, and Mac OS X Free Net Mass Downloader While it’s great that Microsoft has released the .NET Reference Source Code, you can only get it one file at a time while you’re debugging. If you’d like to batch download it for reading or to populate the cache, you’d have to write a program that instantiated and called each method in the Framework Class Library. Fortunately, .NET Mass Downloader comes to the rescue! Free nMap Nmap ("Network Mapper") is a free and open source (license) utility for network exploration or security auditing. Many systems and network administrators also find it useful for tasks such as network inventory, managing service upgrade schedules, and monitoring host or service uptime. Free NoScript (Firefox add-in) The NoScript Firefox extension provides extra protection for Firefox, Flock, Seamonkey and other Mozilla-based browsers: this free, open source add-on allows JavaScript, Java and Flash and other plug-ins to be executed only by trusted web sites of your choice (e.g. your online bank), and provides the most powerful Anti-XSS protection available in a browser. Free NotePad 2 Notepad2, a fast and light-weight Notepad-like text editor with syntax highlighting. This program can be run out of the box without installation, and does not touch your system's registry. Free PageSpy PageSpy is a small add-on for Internet Explorer that allows you to select any element within a webpage, select an option in the context menu, and view detailed information about both the coding behind the page and the element you selected. Free Phrase Express PhraseExpress manages your frequently used text snippets in customizable categories for quick access. Free PowerGui PowerGui is a free community for PowerGUI, a graphical user interface and script editor for Microsoft Windows PowerShell! Free Powershell Comes with Win7, but you can automate tasks by using the .NET Framework. Great for network admins. Free Process Explorer Ever wondered which program has a particular file or directory open? Now you can find out. Process Explorer shows you information about which handles and DLLs processes have opened or loaded. Also, included in the SysInterals Suite. Free Process Monitor Process Monitor is an advanced monitoring tool for Windows that shows real-time file system, Registry and process/thread activity. Free Reflector Explore and analyze compiled .NET assemblies, viewing them in C#, Visual Basic, and IL. This is an Essential for any .NET developer. Free Regular Expression Library Stuck on a Regular Expression but you think someone has already figured it out? Chances are they have. Free Regulator Regulator makes Regular Expressions easy. This is a must have for a .NET Developer. Free RenameMaestro RenameMaestro is probably the easiest batch file renamer you'll find to instantly rename multiple files COST ReSharper The one program that I cannot live without. Supports VS2010 and offers simple refactoring, code analysis/assistance/cleanup/templates. One of the few applications that is worth the $$$. COST/Trial ScrewTurn Wiki ScrewTurn Wiki allows you to create, manage and share wikis. A wiki is a collaboratively-edited, information-centered website: the most famous is Wikipedia. Free SharpDevelop What is #develop? SharpDevelop is a free IDE for C# and VB.NET projects on Microsoft's .NET platform. Free Show Me The Template Show Me The Template is a tool for exploring the templates, be their data, control or items panel, that comes with the controls built into WPF for all 6 themes. Free SnippetCompiler Compiles code snippets without opening Visual Studio. It does not support .NET 4. Free SQL Prompt SQL Prompt is a plug-in that increases how fast you can work with SQL. It provides code-completion for SQL server, reformatting, db schema information and snippets. Awesome! COST/Trial SQLinForm SQLinForm is an automatic SQL code formatter for all major databases  including ORACLE, SQL Server, DB2, UDB, Sybase, Informix, PostgreSQL, Teradata, MySQL, MS Access etc. with over 70 formatting options. COST/OnlineFree SSMS Tools SSMS Tools Pack is an add-in for Microsoft SQL Server Management Studio (SSMS) including SSMS Express. Free Storm STORM is a free and open source tool for testing web services. Free Telerik Code Convertor Convert code from VB to C Sharp and Vice Versa. Free TurtoiseSVN TortoiseSVN is a really easy to use Revision control / version control / source control software for Windows.Since it's not an integration for a specific IDE you can use it with whatever development tools you like. Free UltraEdit UltraEdit is the ideal text, HTML and hex editor, and an advanced PHP, Perl, Java and JavaScript editor for programmers. UltraEdit is also an XML editor including a tree-style XML parser. An industry-award winner, UltraEdit supports disk-based 64-bit file handling (standard) on 32-bit Windows platforms (Windows 2000 and later). COST/Trial Virtual Windows XP Comes with some W7 version and allows you to run WinXP along side W7. Free VirtualBox Virtualization by Sun Microsystems. You can virtualize Windows, Linux and more. Free Visual Log Parser SQL queries against a variety of log files and other system data sources. Free WinMerge WinMerge is an Open Source differencing and merging tool for Windows. WinMerge can compare both folders and files, presenting differences in a visual text format that is easy to understand and handle. Free Wireshark Wireshark is one of the best network protocol analyzer's for Unix and windows. This has been used several times to get me out of a bind. Free XML Notepad 07 Old, but still one of my favorite XML viewers. Free Productivity Tools – This is the list of tools that I use to save time or quickly navigate around Windows. Name Description License AutoHotKey Automate almost anything by sending keystrokes and mouse clicks. You can write a mouse or keyboard macro by hand or use the macro recorder. Free CLCL CLCL is clipboard caching utility. Free Ditto Ditto is an extension to the standard windows clipboard. It saves each item placed on the clipboard allowing you access to any of those items at a later time. Ditto allows you to save any type of information that can be put on the clipboard, text, images, html, custom formats, ..... Free Evernote Remember everything from notes to photos. It will synch between computers/devices. Free InfoRapid Inforapid is a search tool that will display all you search results in a html like browser. If you click on a word in that browser, it will start another search to the word you clicked on. Handy if you want to trackback something to it's true origin. The word you looked for will be highlighted in red. Clicking on the red word will open the containing file in a text based viewer. Clicking on any word in the opened document will start another search on that word. Free KatMouse The prime purpose of the KatMouse utility is to enhance the functionality of mice with a scroll wheel, offering 'universal' scrolling: moving the mouse wheel will scroll the window directly beneath the mouse cursor (not the one with the keyboard focus, which is default on Windows OSes). This is a major increase in the usefulness of the mouse wheel. Free ScreenR Instant Screencast with nothing to download. Works with Mac or PC and free. Free Start++ Start++ is an enhancement for the Start Menu in Windows Vista. It also extends the Run box and the command-line with customizable commands.  For example, typing "w Windows Vista" will take you to the Windows Vista page on Wikipedia! Free Synergy Synergy lets you easily share a single mouse and keyboard between multiple computers with different operating systems, each with its own display, without special hardware. It's intended for users with multiple computers on their desk since each system uses its own monitor(s). Free Texter Texter lets you define text substitution hot strings that, when triggered, will replace hotstring with a larger piece of text. By entering your most commonly-typed snippets of text into Texter, you can save countless keystrokes in the course of the day. Free Total Commander File handling, FTP, Archive handling and much more. Even works with Win3.11. COST/Trial Available Wizmouse WizMouse is a mouse enhancement utility that makes your mouse wheel work on the window currently under the mouse pointer, instead of the currently focused window. This means you no longer have to click on a window before being able to scroll it with the mouse wheel. This is a far more comfortable and practical way to make use of the mouse wheel. Free Xmarks Bookmark sync and search between computers. Free General Utilities – This is a list for power user users or anyone that wants more out of Windows. I usually install a majority of these whenever I get a new system. Name Description License µTorrent µTorrent is a lightweight and efficient BitTorrent client for Windows or Mac with many features. I use this for downloading LEGAL media. Free Audacity Audacity® is free, open source software for recording and editing sounds. It is available for Mac OS X, Microsoft Windows, GNU/Linux, and other operating systems. Learn more about Audacity... Also check our Wiki and Forum for more information. Free AVast Free FREE Antivirus. Free CD Burner XP Pro CDBurnerXP is a free application to burn CDs and DVDs, including Blu-Ray and HD-DVDs. It also includes the feature to burn and create ISOs, as well as a multilanguage interface. Free CDEX You can extract digital audio CDs into mp3/wav. Free Combofix Combofix is a freeware (a legitimate spyware remover created by sUBs), Combofix was designed to scan a computer for known malware, spyware (SurfSideKick, QooLogic, and Look2Me as well as any other combination of the mentioned spyware applications) and remove them. Free Cpu-Z Provides information about some of the main devices of your system. Free Cropper Cropper is a screen capture utility written in C#. It makes it fast and easy to grab parts of your screen. Use it to easily crop out sections of vector graphic files such as Fireworks without having to flatten the files or open in a new editor. Use it to easily capture parts of a web site, including text and images. It's also great for writing documentation that needs images of your application or web site. Free DropBox Drag and Drop files to sync between computers. Free DVD-Fab Converts/Copies DVDs/Blu-Ray to different formats. (like mp4, mkv, avi) COST/Trial Available FastStone Capture FastStone Capture is a powerful, lightweight, yet full-featured screen capture tool that allows you to easily capture and annotate anything on the screen including windows, objects, menus, full screen, rectangular/freehand regions and even scrolling windows/web pages. Free ffdshow FFDShow is a DirectShow decoding filter for decompressing DivX, XviD, H.264, FLV1, WMV, MPEG-1 and MPEG-2, MPEG-4 movies. Free Filezilla FileZilla Client is a fast and reliable cross-platform FTP, FTPS and SFTP client with lots of useful features and an intuitive graphical user interface. You can also download a server version. Free FireFox Web Browser, do you really need an explanation? Free FireGestures A customizable mouse gestures extension which enables you to execute various commands and user scripts with five types of gestures. Free FoxIt Reader Light weight PDF viewer. You should install this with the advanced setting or it will install a toolbar and setup some shortcuts. Free gSynchIt Synch Gmail and Outlook. Even supports Outlook 2010 32/64 bit COST/Trial Available Hulu Desktop At home or in a hotel, this has replaced my cable/satellite subscription. Free ImgBurn ImgBurn is a lightweight CD / DVD / HD DVD / Blu-ray burning application that everyone should have in their toolkit! Free Infrarecorder InfraRecorder is a free CD/DVD burning solution for Microsoft Windows. It offers a wide range of powerful features; all through an easy to use application interface and Windows Explorer integration. Free KeePass KeePass is a free open source password manager, which helps you to manage your passwords in a secure way. Free LastPass Another password management, synchronize between browsers, automatic form filling and more. Free Live Essentials One download and lots of programs including Mail, Live Writer, Movie Maker and more! Free Monitores MonitorES is a small windows utility that helps you to turnoff monitor display when you lock down your machine.Also when you lock your machine, it will pause all your running media programs & set your IM status message to "Away" / Custom message(via options) and restore it back to normal when you back. Free mRemote mRemote is a full-featured, multi-tab remote connections manager. Free Open Office OpenOffice.org 3 is the leading open-source office software suite for word processing, spreadsheets, presentations, graphics, databases and more. It is available in many languages and works on all common computers. It stores all your data in an international open standard format and can also read and write files from other common office software packages. It can be downloaded and used completely free of charge for any purpose. Free Paint.NET Simple, intuitive, and innovative user interface for editing photos. Free Picasa Picasa is free photo editing software from Google that makes your pictures look great. Free Pidgin Pidgin is an easy to use and free chat client used by millions. Connect to AIM, MSN, Yahoo, and more chat networks all at once. Free PING PING is a live Linux ISO, based on the excellent Linux From Scratch (LFS) documentation. It can be burnt on a CD and booted, or integrated into a PXE / RIS environment. Free Putty PuTTY is an SSH and telnet client, developed originally by Simon Tatham for the Windows platform. Free Revo Uninstaller Revo Uninstaller Pro helps you to uninstall software and remove unwanted programs installed on your computer easily! Even if you have problems uninstalling and cannot uninstall them from "Windows Add or Remove Programs" control panel applet.Revo Uninstaller is a much faster and more powerful alternative to "Windows Add or Remove Programs" applet! It has very powerful features to uninstall and remove programs. Free Security Essentials Microsoft Security Essentials is a new, free consumer anti-malware solution for your computer. Free SetupVirtualCloneDrive Virtual CloneDrive works and behaves just like a physical CD/DVD drive, however it exists only virtually. Point to the .ISO file and it appears in Windows Explorer as a Drive. Free Shark 007 Codec Pack Play just about any file format with this download. Also includes my W7 Media Playlist Generator. Free Snagit 9 Screen Capture on steroids. Add arrows, captions, etc to any screenshot. COST/Trial Available SysinternalsSuite Go ahead and download the entire sys internals suite. I have mentioned multiple programs in this suite already. Free TeraCopy TeraCopy is a compact program designed to copy and move files at the maximum possible speed, providing the user with a lot of features. Free for Home TrueCrypt Free open-source disk encryption software for Windows 7/Vista/XP, Mac OS X, and Linux Free TweetDeck Fully featured Twitter client. Free UltraVNC UltraVNC is a powerful, easy to use and free software that can display the screen of another computer (via internet or network) on your own screen. The program allows you to use your mouse and keyboard to control the other PC remotely. It means that you can work on a remote computer, as if you were sitting in front of it, right from your current location. Free Unlocker Unlocks locked files. Pretty simple right? Free VLC Media Player VLC media player is a highly portable multimedia player and multimedia framework capable of reading most audio and video formats Free Windows 7 Media Playlist This program is special to my heart because I wrote it. It has been mentioned on podcast and various websites. It allows you to quickly create wvx video playlist for Windows Media Center. Free WinRAR WinRAR is a powerful archive manager. It can backup your data and reduce the size of email attachments, decompress RAR, ZIP and other files downloaded from Internet and create new archives in RAR and ZIP file format. COST/Trial Available Blogging – I use the following for my blog. Name Description License Insert Code for Windows Live Writer Insert Code for Windows Live Writer will format a snippet of text in a number of programming languages such as C#, HTML, MSH, JavaScript, Visual Basic and TSQL. Free LiveWriter Included in Live Essentials, but the ultimate in Windows Blogging Free PasteAsVSCode Plug-in for Windows Live Writer that pastes clipboard content as Visual Studio code. Preserves syntax highlighting, indentation and background color. Converts RTF, outputted by Visual Studio, into HTML. Free Desktop Management – The list below represent the best in Windows Desktop Management. Name Description License 7 Stacks Allows users to have "stacks" of icons in their taskbar. Free Executor Executor is a multi purpose launcher and a more advanced and customizable version of windows run. Free Fences Fences is a program that helps you organize your desktop and can hide your icons when they are not in use. Free RocketDock Rocket Dock is a smoothly animated, alpha blended application launcher. It provides a nice clean interface to drop shortcuts on for easy access and organization. With each item completely customizable there is no end to what you can add and launch from the dock. Free WindowsTab Tabbing is an essential feature of modern web browsers. Window Tabs brings the productivity of tabbed window management to all of your desktop applications. Free

    Read the article

  • CodePlex Daily Summary for Wednesday, February 17, 2010

    CodePlex Daily Summary for Wednesday, February 17, 2010New ProjectsAcademic Success Accounting System: The system is intended to use by school teacher to set marks to students and estimate their academic success and possibilities. The client applicat...Access.PowerTools: Access PowerTools is currently a sample MS Access add-in project to try & test features of Add-in Express™ 2009 for Microsoft® Office and .net (ht...AntoonCms: AntoonCms makes it easy to maintain a simple website with it's builtin administration pages. It's developed in C# on target Framework 2.0 The CMS...ASP.NET MVC Mehr Lib: Mehr Lib makes it easier for ASP.NET MVC developers to do develop projects. It's developed in C#. This version currently include Ajax master detail...BCryptTool: Developer tool that calculates BCrypt hash codes for strings. BCrypt is an implementation of the Blowfish cipher and a computationally-expensive ha...Coronasoft Cryostasis scripting engine: A scripting engine that allows you to dynamically load plugins from just about any supported .NET language. Its written in C#. Languages supported ...Critical Point Search: Critical Point Searchcritical points: critical pointsFont Family Name Retrieval: This library helps developer to retrieve the font family name from the TTF, OTF and TTC font files, so that developer can display the font without ...jQuery Form Input Hints Plugin: Automatically display hints on input textboxes in your forms using this jQuery plugin. I wrote this code to be as simple and as easy to use as pos...Kojax: kojax projectKronRetro: KronRetro! Making a Habbo Retro just got easier! Powered by PHP & MySQL you can make a Habbo Retro site fast!MVVM Wrapper Kit: MVVM Wrapper Kit makes it easier for View Model programmers to wrap their business objects and collections while preserving change notification and...ObjectCartographer: ObjectCartographer is an object to object mapper and object factory. It's developed in C#.PE-file Reader Writer API (PERWAPI): PERWAPI is a reader writer module for .NET program executables. It has been used as back-end for progamming language compilers such as Gardens Poi...Pinger: A simple Pinger, pings an address until you press a buttonQPV: 0.1: QPV aka Que pelicula es una aplicacion que consiste crear una base de datos potente de peliculas, criticas e informacion para poder filtrar pelicul...SIMD Detector: This SIMD class helps developers to detect the types of SIMD instruction available on users' processor. It supports Intel and AMD CPUs. It is writt...StackOverflow Test Project: Following Andrew Siemer's StackOverflow Knowledge Exchange Project.WeBlog: A blogging platform built on the MVC framework The project will showcase current technologies such as MVC 2, Silverlight 4 and jQuery 1.4. Data pro...Webmedia: this is my webmedia projectWindows Azure RSS Reader: This is and online RSS reader based on the Windows Azure platformWordEditor. A Word Editor for Windows, and an extended RichTextBox control.: This is a word editor that can be used as a stand alone word processor, or added to an existing project.Домашняя Бухгалтерия: Программа для ведения домашнего бухгалтерского учета финансов. New ReleasesAccess.PowerTools: Access PowerTools Add-In Community Edition v.0.0.1: Access PowerTools Add-In Community Edition v.0.0.1 is a sample MS Access add-in project to try & test Add-in Express™ 2009 for Microsoft® Office an...Active CSS: ActiveCSS-0.1.1: revision for version 0.1ASP.NET: Microsoft Ajax Minifier 4.0: The Microsoft Ajax Minifier enables you to improve the performance of your Ajax applications by reducing the size of your Cascading Style Sheet and...ASP.NET MVC Mehr Lib: V1.0: Mehr Lib V1.0 This version currently include ajax master detail combo facilities.ASP.net Ribbon: Version 1.2: New controls : Expandable gallery Color Picker Multi color File Menu Some JS modifications. Some CSS modifications. Includes some functionna...ASP.NET Web Forms Model-View-Presenter (MVP) Contrib: WebForms MVP Contrib CTP6: This is a release of the WebForms MVP Contrib project for WebForms MVP CTP6. Release includes: WebForms MVP Contrib framework Ninject IoC containerAwesomiumDotNet: AwesomiumDotNet 1.2.1: - Added Awesomium 1.5 features: URL filtering, header rewrite rules, SetOpensExternalLinksInCallingFrame. - Numerous fixes and improvements.BCryptTool: BCryptTool v0.1: The Microsoft .NET Framework 3.5 (SP1) is needed to run this program.Buzz Dot Net: Buzz Dot Net v.1.10216: Features Parse Google Buzz feed to Objects Partial MVVM Implementation Partial OptimizationsCanvas VSDOC Intellisense: v1.0.0.0a: canvas-vsdoc.js and canvas-utils.js JavaScript intellisense for HTML5 Canvas element.CheckHeader: CheckHeader v0.8.5: The Microsoft .NET Framework 3.5 (SP1) is needed to run this program.Claymore MVP: Claymore 1.0.2.0: Changelog Added ASP.NET WebForm support via ClaymoreHttpModule class. Added xsd schema for Visual Studio Intellisense within App.config and Web....Dam Gd - URL Shortner: Dam.gd Version 1.1: This is the latest instalment in our URL shortner. It uses The Easy API http://theeasyapi.com to access data that is used for the back-end analyti...D-AMPS: D-AMPS 0.9.1: Initial version.easySMS: easySMS 1.0 Source code: easySMS 1.0 Source codeFont Family Name Retrieval: 1st Release: Version 1.0.0Free Silverlight & WPF Chart Control - Visifire: Visifire Now Supports DataBinding: Hi, Today we are releasing the much awaited DataBinding feature in Visifire 3.0.3 beta 3. Now you can Bind any DataSource at the Series level so t...GenerateTypedBamApi: Version 2.0: Changes in this release: NEW: Export functionality no longer requires Excel to be installed (uses OLE DB vs. Excel Automation; also enables usage i...Gmail Notifier 2: GmailNotifier2 1.2.1: Fixes issues #9652, #9653iTuner - The iTunes Companion: iTuner 1.1.3699: This includes the first pass of the iTuner Librarian including management of dead tracks, duplicates, and empty directories... While I promised a ...jQuery Form Input Hints Plugin: jQuery.InputHints v1.0: jQuery.InputHints v1.0 Includes Standard & minified source Demo HTML file VS2008 SolutionLibWowArmory: LibWowArmory 0.2.3 beta: LibWowArmory 0.2.3 betaThis release of the LibWowArmory source code matches the WoW Armory as of version 3.3.2. Changes since version 0.2.2:Update...Managed Extensibility Framework: MEF Preview 9: We have merged the .net 3.5 and Silverlight 3 into a single zip. The bin folder contains the binaries for .net 3.5 whereas bin\SL contains the bina...MDX Parser,Builder,DOM and OLAP visual controls with Writeback for Silverlight: Ranet.UILibrary.Olap-1.3.3.0-6571.msi: February 16, 2010 * MdxDesigner: Fix for the issue where when an element is clicked, the mouse wheel stops working until the cursor leaves and r...MEFGeneric: MEFGeneric Preview 9: MEFGeneric Preview 9 release.Mesopotamia Experiment: Mesopotamia 1.2.26: Bug Fixes - mud map - progress window - recycle app domains on robotics engine crashes( in command prompt and visual, major work) - fixed rooomba h...Microsoft Solution Framework for Business Intelligence in Media: Release 1.0: This is the public release of the Microsoft Solution Framework for Business Intelligence in Media (Release 1.0).MVVM Wrapper Kit: MVVM Wrapper Beta: A simple test project is included to get you up and running, and wrapping those business objects.nBayes - Bayesian Filtering in C#: nBayes v0.2: nBayes' indexing system is factored in such a way that you can easily replace the index with a custom implementation. This release introduces an ad...NetSqlAzMan - .NET SQL Authorization Manager: 3.6.0.5: 3.6.0.5 16-February-2010 - Fix: SqlAzManSid Class. "Equals" matches object signiture instead of IAzManSid signiture. When a real null object is pas...ObjectCartographer: ObjectCartographer Code 1.0: This is the first release and contains code to help with object to object mapping (including mapping from one object to multiple objects), object f...Office Apps: 0.8.6: Bug fix's, added Calendar.OI - Open Internet: OI HTML and .XAP files (OI offline): this is the HTML code and the XAP file. please right-click the app at http://bit.ly/openinternet and select "install openinternet application to th...PE-file Reader Writer API (PERWAPI): PERWAPI-1.1.3: Perwapi version 1.1.3 is the complete distribution package. It contains Binary files, pdb files and xml files for the PERWAPI and SymbolRW compone...Pinger: Pinger 1.0.0.0 Binary: The Latest BinaryRNA Comparative Analysis Software Tools: RNA Comparative Analysis Software Tools 2.0: RNA Comparative Analysis Software Tools Version 2.0 Note: The RNA Comparative Analysis Software Tools are provided as is, without any warranty. No...SAL- Self Artificial Learning: Artificial Learning working proof of concept: This is a working proof of concept. It includes the Dev version (in .zip format) and the consumer version (in .exe format)SharePoint Management PowerShell scripts: SharePoint 2010 PowerShell Scripts: All the SharePoint 2010 PowerShell Scripts The first file is an Excel 2010 file allowing to find quiclky and easily the new cmdlets available wi...SIMD Detector: 1st Release: Version 1.3 Supports MMX/MMX, SSE, SSE2, SSE3, SSSE3, SSE4.1, SSE4.2, SSE4a, SSE5, 3DNow.Terminals: Terminals 1.9 Beta Release: This is a beta release so the new features being added to terminals can be tested properly. The major change in this release is that Terminals has...Text Designer Outline Text Library: 9th minor release: Added the ability to select brush, such as gradient brush or texture brush for the text body. Added CSharp library, TextDesignerCSLibrary. Manage...VivoSocial: VivoSocial 7.0.2: This release has several updated modules. See the Support Forums for more details. Since we update modules very often, we will be changing how we d...WatchersNET CKEditor™ Provider for DotNetNuke: CKEditor Provider 1.6.00: changes CKEditor Upgrade to Version 3.2 SVN 5132 File Browser: After File Upload, File will be Auto Selected File Browser: Icons are corrected ...WordEditor. A Word Editor for Windows, and an extended RichTextBox control.: WordEditor Source Code: This contains the latest solution file, with all project files included.Домашняя Бухгалтерия: Alapha Realease: Принимаются ваши предложения по дизайну и функциональности программы.Most Popular ProjectsRawrWBFS ManagerAJAX Control ToolkitMicrosoft SQL Server Product Samples: DatabaseSilverlight ToolkitWindows Presentation Foundation (WPF)Image Resizer Powertoy Clone for WindowsMicrosoft SQL Server Community & SamplesASP.NETLiveUpload to FacebookMost Active ProjectsDinnerNow.netRawrBlogEngine.NETSimple SavantNB_Store - Free DotNetNuke Ecommerce Catalog Modulepatterns & practices – Enterprise LibraryPHPExcelSharpyjQuery Library for SharePoint Web ServicesFluent Validation for .NET

    Read the article

  • VS 2010 SP1 and SQL CE

    - by ScottGu
    Last month we released the Beta of VS 2010 Service Pack 1 (SP1).  You can learn more about the VS 2010 SP1 Beta from Jason Zander’s two blog posts about it, and from Scott Hanselman’s blog post that covers some of the new capabilities enabled with it.   You can download and install the VS 2010 SP1 Beta here. Last week I blogged about the new Visual Studio support for IIS Express that we are adding with VS 2010 SP1. In today’s post I’m going to talk about the new VS 2010 SP1 tooling support for SQL CE, and walkthrough some of the cool scenarios it enables.  SQL CE – What is it and why should you care? SQL CE is a free, embedded, database engine that enables easy database storage. No Database Installation Required SQL CE does not require you to run a setup or install a database server in order to use it.  You can simply copy the SQL CE binaries into the \bin directory of your ASP.NET application, and then your web application can use it as a database engine.  No setup or extra security permissions are required for it to run. You do not need to have an administrator account on the machine. Just copy your web application onto any server and it will work. This is true even of medium-trust applications running in a web hosting environment. SQL CE runs in-memory within your ASP.NET application and will start-up when you first access a SQL CE database, and will automatically shutdown when your application is unloaded.  SQL CE databases are stored as files that live within the \App_Data folder of your ASP.NET Applications. Works with Existing Data APIs SQL CE 4 works with existing .NET-based data APIs, and supports a SQL Server compatible query syntax.  This means you can use existing data APIs like ADO.NET, as well as use higher-level ORMs like Entity Framework and NHibernate with SQL CE.  This enables you to use the same data programming skills and data APIs you know today. Supports Development, Testing and Production Scenarios SQL CE can be used for development scenarios, testing scenarios, and light production usage scenarios.  With the SQL CE 4 release we’ve done the engineering work to ensure that SQL CE won’t crash or deadlock when used in a multi-threaded server scenario (like ASP.NET).  This is a big change from previous releases of SQL CE – which were designed for client-only scenarios and which explicitly blocked running in web-server environments.  Starting with SQL CE 4 you can use it in a web-server as well. There are no license restrictions with SQL CE.  It is also totally free. Easy Migration to SQL Server SQL CE is an embedded database – which makes it ideal for development, testing, and light-usage scenarios.  For high-volume sites and applications you’ll probably want to migrate your database to use SQL Server Express (which is free), SQL Server or SQL Azure.  These servers enable much better scalability, more development features (including features like Stored Procedures – which aren’t supported with SQL CE), as well as more advanced data management capabilities. We’ll ship migration tools that enable you to optionally take SQL CE databases and easily upgrade them to use SQL Server Express, SQL Server, or SQL Azure.  You will not need to change your code when upgrading a SQL CE database to SQL Server or SQL Azure.  Our goal is to enable you to be able to simply change the database connection string in your web.config file and have your application just work. New Tooling Support for SQL CE in VS 2010 SP1 VS 2010 SP1 includes much improved tooling support for SQL CE, and adds support for using SQL CE within ASP.NET projects for the first time.  With VS 2010 SP1 you can now: Create new SQL CE Databases Edit and Modify SQL CE Database Schema and Indexes Populate SQL CE Databases within Data Use the Entity Framework (EF) designer to create model layers against SQL CE databases Use EF Code First to define model layers in code, then create a SQL CE database from them, and optionally edit the DB with VS Deploy SQL CE databases to remote servers using Web Deploy and optionally convert them to full SQL Server databases You can take advantage of all of the above features from within both ASP.NET Web Forms and ASP.NET MVC based projects. Download You can enable SQL CE tooling support within VS 2010 by first installing VS 2010 SP1 (beta). Once SP1 is installed, you’ll also then need to install the SQL CE Tools for Visual Studio download.  This is a separate download that enables the SQL CE tooling support for VS 2010 SP1. Walkthrough of Two Scenarios In this blog post I’m going to walkthrough how you can take advantage of SQL CE and VS 2010 SP1 using both an ASP.NET Web Forms and an ASP.NET MVC based application. Specifically, we’ll walkthrough: How to create a SQL CE database using VS 2010 SP1, then use the EF4 visual designers in Visual Studio to construct a model layer from it, and then display and edit the data using an ASP.NET GridView control. How to use an EF Code First approach to define a model layer using POCO classes and then have EF Code-First “auto-create” a SQL CE database for us based on our model classes.  We’ll then look at how we can use the new VS 2010 SP1 support for SQL CE to inspect the database that was created, populate it with data, and later make schema changes to it.  We’ll do all this within the context of an ASP.NET MVC based application. You can follow the two walkthroughs below on your own machine by installing VS 2010 SP1 (beta) and then installing the SQL CE Tools for Visual Studio download (which is a separate download that enables SQL CE tooling support for VS 2010 SP1). Walkthrough 1: Create a SQL CE Database, Create EF Model Classes, Edit the Data with a GridView This first walkthrough will demonstrate how to create and define a SQL CE database within an ASP.NET Web Form application.  We’ll then build an EF model layer for it and use that model layer to enable data editing scenarios with an <asp:GridView> control. Step 1: Create a new ASP.NET Web Forms Project We’ll begin by using the File->New Project menu command within Visual Studio to create a new ASP.NET Web Forms project.  We’ll use the “ASP.NET Web Application” project template option so that it has a default UI skin implemented: Step 2: Create a SQL CE Database Right click on the “App_Data” folder within the created project and choose the “Add->New Item” menu command: This will bring up the “Add Item” dialog box.  Select the “SQL Server Compact 4.0 Local Database” item (new in VS 2010 SP1) and name the database file to create “Store.sdf”: Note that SQL CE database files have a .sdf filename extension. Place them within the /App_Data folder of your ASP.NET application to enable easy deployment. When we clicked the “Add” button above a Store.sdf file was added to our project: Step 3: Adding a “Products” Table Double-clicking the “Store.sdf” database file will open it up within the Server Explorer tab.  Since it is a new database there are no tables within it: Right click on the “Tables” icon and choose the “Create Table” menu command to create a new database table.  We’ll name the new table “Products” and add 4 columns to it.  We’ll mark the first column as a primary key (and make it an identify column so that its value will automatically increment with each new row): When we click “ok” our new Products table will be created in the SQL CE database. Step 4: Populate with Data Once our Products table is created it will show up within the Server Explorer.  We can right-click it and choose the “Show Table Data” menu command to edit its data: Let’s add a few sample rows of data to it: Step 5: Create an EF Model Layer We have a SQL CE database with some data in it – let’s now create an EF Model Layer that will provide a way for us to easily query and update data within it. Let’s right-click on our project and choose the “Add->New Item” menu command.  This will bring up the “Add New Item” dialog – select the “ADO.NET Entity Data Model” item within it and name it “Store.edmx” This will add a new Store.edmx item to our solution explorer and launch a wizard that allows us to quickly create an EF model: Select the “Generate From Database” option above and click next.  Choose to use the Store.sdf SQL CE database we just created and then click next again.  The wizard will then ask you what database objects you want to import into your model.  Let’s choose to import the “Products” table we created earlier: When we click the “Finish” button Visual Studio will open up the EF designer.  It will have a Product entity already on it that maps to the “Products” table within our SQL CE database: The VS 2010 SP1 EF designer works exactly the same with SQL CE as it does already with SQL Server and SQL Express.  The Product entity above will be persisted as a class (called “Product”) that we can programmatically work against within our ASP.NET application. Step 6: Compile the Project Before using your model layer you’ll need to build your project.  Do a Ctrl+Shift+B to compile the project, or use the Build->Build Solution menu command. Step 7: Create a Page that Uses our EF Model Layer Let’s now create a simple ASP.NET Web Form that contains a GridView control that we can use to display and edit the our Products data (via the EF Model Layer we just created). Right-click on the project and choose the Add->New Item command.  Select the “Web Form from Master Page” item template, and name the page you create “Products.aspx”.  Base the master page on the “Site.Master” template that is in the root of the project. Add an <h2>Products</h2> heading the new Page, and add an <asp:gridview> control within it: Then click the “Design” tab to switch into design-view. Select the GridView control, and then click the top-right corner to display the GridView’s “Smart Tasks” UI: Choose the “New data source…” drop down option above.  This will bring up the below dialog which allows you to pick your Data Source type: Select the “Entity” data source option – which will allow us to easily connect our GridView to the EF model layer we created earlier.  This will bring up another dialog that allows us to pick our model layer: Select the “StoreEntities” option in the dropdown – which is the EF model layer we created earlier.  Then click next – which will allow us to pick which entity within it we want to bind to: Select the “Products” entity in the above dialog – which indicates that we want to bind against the “Product” entity class we defined earlier.  Then click the “Enable automatic updates” checkbox to ensure that we can both query and update Products.  When you click “Finish” VS will wire-up an <asp:EntityDataSource> to your <asp:GridView> control: The last two steps we’ll do will be to click the “Enable Editing” checkbox on the Grid (which will cause the Grid to display an “Edit” link on each row) and (optionally) use the Auto Format dialog to pick a UI template for the Grid. Step 8: Run the Application Let’s now run our application and browse to the /Products.aspx page that contains our GridView.  When we do so we’ll see a Grid UI of the Products within our SQL CE database. Clicking the “Edit” link for any of the rows will allow us to edit their values: When we click “Update” the GridView will post back the values, persist them through our EF Model Layer, and ultimately save them within our SQL CE database. Learn More about using EF with ASP.NET Web Forms Read this tutorial series on the http://asp.net site to learn more about how to use EF with ASP.NET Web Forms.  The tutorial series uses SQL Express as the database – but the nice thing is that all of the same steps/concepts can also now also be done with SQL CE.   Walkthrough 2: Using EF Code-First with SQL CE and ASP.NET MVC 3 We used a database-first approach with the sample above – where we first created the database, and then used the EF designer to create model classes from the database.  In addition to supporting a designer-based development workflow, EF also enables a more code-centric option which we call “code first development”.  Code-First Development enables a pretty sweet development workflow.  It enables you to: Define your model objects by simply writing “plain old classes” with no base classes or visual designer required Use a “convention over configuration” approach that enables database persistence without explicitly configuring anything Optionally override the convention-based persistence and use a fluent code API to fully customize the persistence mapping Optionally auto-create a database based on the model classes you define – allowing you to start from code first I’ve done several blog posts about EF Code First in the past – I really think it is great.  The good news is that it also works very well with SQL CE. The combination of SQL CE, EF Code First, and the new VS tooling support for SQL CE, enables a pretty nice workflow.  Below is a simple example of how you can use them to build a simple ASP.NET MVC 3 application. Step 1: Create a new ASP.NET MVC 3 Project We’ll begin by using the File->New Project menu command within Visual Studio to create a new ASP.NET MVC 3 project.  We’ll use the “Internet Project” template so that it has a default UI skin implemented: Step 2: Use NuGet to Install EFCodeFirst Next we’ll use the NuGet package manager (automatically installed by ASP.NET MVC 3) to add the EFCodeFirst library to our project.  We’ll use the Package Manager command shell to do this.  Bring up the package manager console within Visual Studio by selecting the View->Other Windows->Package Manager Console menu command.  Then type: install-package EFCodeFirst within the package manager console to download the EFCodeFirst library and have it be added to our project: When we enter the above command, the EFCodeFirst library will be downloaded and added to our application: Step 3: Build Some Model Classes Using a “code first” based development workflow, we will create our model classes first (even before we have a database).  We create these model classes by writing code. For this sample, we will right click on the “Models” folder of our project and add the below three classes to our project: The “Dinner” and “RSVP” model classes above are “plain old CLR objects” (aka POCO).  They do not need to derive from any base classes or implement any interfaces, and the properties they expose are standard .NET data-types.  No data persistence attributes or data code has been added to them.   The “NerdDinners” class derives from the DbContext class (which is supplied by EFCodeFirst) and handles the retrieval/persistence of our Dinner and RSVP instances from a database. Step 4: Listing Dinners We’ve written all of the code necessary to implement our model layer for this simple project.  Let’s now expose and implement the URL: /Dinners/Upcoming within our project.  We’ll use it to list upcoming dinners that happen in the future. We’ll do this by right-clicking on our “Controllers” folder and select the “Add->Controller” menu command.  We’ll name the Controller we want to create “DinnersController”.  We’ll then implement an “Upcoming” action method within it that lists upcoming dinners using our model layer above.  We will use a LINQ query to retrieve the data and pass it to a View to render with the code below: We’ll then right-click within our Upcoming method and choose the “Add-View” menu command to create an “Upcoming” view template that displays our dinners.  We’ll use the “empty” template option within the “Add View” dialog and write the below view template using Razor: Step 4: Configure our Project to use a SQL CE Database We have finished writing all of our code – our last step will be to configure a database connection-string to use. We will point our NerdDinners model class to a SQL CE database by adding the below <connectionString> to the web.config file at the top of our project: EF Code First uses a default convention where context classes will look for a connection-string that matches the DbContext class name.  Because we created a “NerdDinners” class earlier, we’ve also named our connectionstring “NerdDinners”.  Above we are configuring our connection-string to use SQL CE as the database, and telling it that our SQL CE database file will live within the \App_Data directory of our ASP.NET project. Step 5: Running our Application Now that we’ve built our application, let’s run it! We’ll browse to the /Dinners/Upcoming URL – doing so will display an empty list of upcoming dinners: You might ask – but where did it query to get the dinners from? We didn’t explicitly create a database?!? One of the cool features that EF Code-First supports is the ability to automatically create a database (based on the schema of our model classes) when the database we point it at doesn’t exist.  Above we configured  EF Code-First to point at a SQL CE database in the \App_Data\ directory of our project.  When we ran our application, EF Code-First saw that the SQL CE database didn’t exist and automatically created it for us. Step 6: Using VS 2010 SP1 to Explore our newly created SQL CE Database Click the “Show all Files” icon within the Solution Explorer and you’ll see the “NerdDinners.sdf” SQL CE database file that was automatically created for us by EF code-first within the \App_Data\ folder: We can optionally right-click on the file and “Include in Project" to add it to our solution: We can also double-click the file (regardless of whether it is added to the project) and VS 2010 SP1 will open it as a database we can edit within the “Server Explorer” tab of the IDE. Below is the view we get when we double-click our NerdDinners.sdf SQL CE file.  We can drill in to see the schema of the Dinners and RSVPs tables in the tree explorer.  Notice how two tables - Dinners and RSVPs – were automatically created for us within our SQL CE database.  This was done by EF Code First when we accessed the NerdDinners class by running our application above: We can right-click on a Table and use the “Show Table Data” command to enter some upcoming dinners in our database: We’ll use the built-in editor that VS 2010 SP1 supports to populate our table data below: And now when we hit “refresh” on the /Dinners/Upcoming URL within our browser we’ll see some upcoming dinners show up: Step 7: Changing our Model and Database Schema Let’s now modify the schema of our model layer and database, and walkthrough one way that the new VS 2010 SP1 Tooling support for SQL CE can make this easier.  With EF Code-First you typically start making database changes by modifying the model classes.  For example, let’s add an additional string property called “UrlLink” to our “Dinner” class.  We’ll use this to point to a link for more information about the event: Now when we re-run our project, and visit the /Dinners/Upcoming URL we’ll see an error thrown: We are seeing this error because EF Code-First automatically created our database, and by default when it does this it adds a table that helps tracks whether the schema of our database is in sync with our model classes.  EF Code-First helpfully throws an error when they become out of sync – making it easier to track down issues at development time that you might otherwise only find (via obscure errors) at runtime.  Note that if you do not want this feature you can turn it off by changing the default conventions of your DbContext class (in this case our NerdDinners class) to not track the schema version. Our model classes and database schema are out of sync in the above example – so how do we fix this?  There are two approaches you can use today: Delete the database and have EF Code First automatically re-create the database based on the new model class schema (losing the data within the existing DB) Modify the schema of the existing database to make it in sync with the model classes (keeping/migrating the data within the existing DB) There are a couple of ways you can do the second approach above.  Below I’m going to show how you can take advantage of the new VS 2010 SP1 Tooling support for SQL CE to use a database schema tool to modify our database structure.  We are also going to be supporting a “migrations” feature with EF in the future that will allow you to automate/script database schema migrations programmatically. Step 8: Modify our SQL CE Database Schema using VS 2010 SP1 The new SQL CE Tooling support within VS 2010 SP1 makes it easy to modify the schema of our existing SQL CE database.  To do this we’ll right-click on our “Dinners” table and choose the “Edit Table Schema” command: This will bring up the below “Edit Table” dialog.  We can rename, change or delete any of the existing columns in our table, or click at the bottom of the column listing and type to add a new column.  Below I’ve added a new “UrlLink” column of type “nvarchar” (since our property is a string): When we click ok our database will be updated to have the new column and our schema will now match our model classes. Because we are manually modifying our database schema, there is one additional step we need to take to let EF Code-First know that the database schema is in sync with our model classes.  As i mentioned earlier, when a database is automatically created by EF Code-First it adds a “EdmMetadata” table to the database to track schema versions (and hash our model classes against them to detect mismatches between our model classes and the database schema): Since we are manually updating and maintaining our database schema, we don’t need this table – and can just delete it: This will leave us with just the two tables that correspond to our model classes: And now when we re-run our /Dinners/Upcoming URL it will display the dinners correctly: One last touch we could do would be to update our view to check for the new UrlLink property and render a <a> link to it if an event has one: And now when we refresh our /Dinners/Upcoming we will see hyperlinks for the events that have a UrlLink stored in the database: Summary SQL CE provides a free, embedded, database engine that you can use to easily enable database storage.  With SQL CE 4 you can now take advantage of it within ASP.NET projects and applications (both Web Forms and MVC). VS 2010 SP1 provides tooling support that enables you to easily create, edit and modify SQL CE databases – as well as use the standard EF designer against them.  This allows you to re-use your existing skills and data knowledge while taking advantage of an embedded database option.  This is useful both for small applications (where you don’t need the scalability of a full SQL Server), as well as for development and testing scenarios – where you want to be able to rapidly develop/test your application without having a full database instance.  SQL CE makes it easy to later migrate your data to a full SQL Server or SQL Azure instance if you want to – without having to change any code in your application.  All we would need to change in the above two scenarios is the <connectionString> value within the web.config file in order to have our code run against a full SQL Server.  This provides the flexibility to scale up your application starting from a small embedded database solution as needed. Hope this helps, Scott P.S. In addition to blogging, I am also now using Twitter for quick updates and to share links. Follow me at: twitter.com/scottgu

    Read the article

  • CodePlex Daily Summary for Saturday, March 13, 2010

    CodePlex Daily Summary for Saturday, March 13, 2010New Projects[Experiment] vczh DBUI: EXPERIMENT. Auto UI adaptor for a specified data base[SAMPLE PROJECT] Branch and Patch with GIT: I'll paste more here later...BlogPress: This web application provides a content management system. Coot: Facebook Photos Screensaver.DotNetNuke® JDMenu: dnnJDMenu makes it easy to use the open source JDMenu component in your DotNetNuke skin.DotNetNuke® RadRotator: dnnRadRotator makes it easy to add telerik RadRotator functionality to your site or custom module. Licensing permits anyone to use the components ...DotNetNuke® RadTabStrip: DNNRadTabStrip makes it easy to add telerik RadTabStrip functionality to your module or skin. Licensing permits anyone to use the components (incl...DotNetNuke® RadTreeView: DNNRadTreeView makes it easy to add telerik RadTreeView functionality to your module or skin. Licensing permits anyone to use the components (incl...DotNetNuke® Skin Garden: A DotNetNuke Design Challenge skin package submitted to the "Out of the box" category by Mark Allan of DnnGarden. Concise and semantic HTML 5 stru...ElmasFC: Elmas Facebook CheckerFront Callback Protocol: Front Callback Protocol make it easier for developers to create a network application in the .Net Language. It provide the flexibility of using TCP...Glass UI: A Windows Forms Control Library built specifically for Aero Glass. This will consist of existing controls, modified to render on glass, as well as ...Guitarist Tools: Some tools for guitarists.HomeUX: HomeUX is home control software featuring a Silverlight-based touch screen user interface.Homework Helper: Homework Helper help students to train simpler homework like "What's the name of the capital of France?" - Question - Answear based. It's made i...IGNOU Mini Project Allocation: A mini project allocation system.Images Compiler: Images Compiler is pretty small wpf application for users who want to resize, rename, disable colors... for too much images in very short time. It...InstitutionManagementSystem: Institution Management System prototypeManagedCv: ManagedCv is the library for C#/VB/ to use the OpenCV librarymanagement joint ownership: Application pour la gestion des actions réalisées au sein d’une copropriété. Application for management actions within a joint ownershipMapWindow6: MapWindow 6.0 is an open source geographic information system (GIS) and library of geospatial software development tools for .NET, written in C#. T...Morris Auto: Morris Auto is a social application build templateMouse control with finger detection: The aim of this project is to design an application for recognition of the movement of a finger through a webcam and then control the mouse. The pr...ORAYLIS BI.Quality: ORAYLIS BI.Quality makes it easier to develop BI Solutions in an agile environment. It adapts Unit Tests to BI Development. Propositional Framework: Different sales propositions are presented to the user using data collected from marketing intelligence, browser history or user behaviour as they ...ServStop: ServStop is a .NET application that makes it easy to stop several system services at once. Now you don't have to change startup types or stop them ...shatkotha web portal: source code of web portal shatkothaSurvey and Registration tools: Two Silverlight tools for add Survey and Registration in your websiteTable Storage Backup & Restore for Windows Azure: Allows various backup & restore options for Windows Azure Table Storage accounts: - Backup from one storage account to another - Backup a storag...Topsy Lib: This project provides wrapper methods to call Topsy's web services from C#.twNowplaying: twNowplaying is a small and handy utility that allows you to tweet your currently playing track from Spotify to Twitter. Followed by the #twNowplay...XOM: XOM: Xml Object Mapper Automatically populate your objects with data from XML via an XML map. Never do this again: if(e.GetElementsByTagName("us...YS Utils: The library contains set of useful classes which may solve common tasks for different applications.ZabViewer: CS ProjectNew ReleasesAppFabric Caching Admin Tool: AppFabric Caching Admin Tool (0.8): System Requirements:.NET 4.0 RC AppFabric Caching Beta2 Test On:Win 7 (64x)ASP.Net Routing Configuration: mal.Web.Routing v0.9.2.0: mal.Web.Routing v0.9.2.0DotNetNuke IM Module of Facebook Like Messenger: DNN IM Module of Facebook Like Messenger: Empower DNN Website with a 1-to-1 Chat Solution named Free Facebook Messenger Style Web Chat Bar of 123 Web Messenger. 1. If you need to use the c...DotNetNuke® Form and List (formerly User Defined Table): 05.01.02: Form and List 05.01.02 (Release Candidate 2)5.1.2 will be the next stabilzation release. Major Highlights fixed Cancel action in a form, it don't ...DotNetNuke® JDMenu: DNN jdMenu 1.0.0: dnnJDMenu makes it easy to use the open source JDMenu component in your DotNetNuke skin. Many thanks to Jonathan Sharp of Outwest Media for creati...DotNetNuke® RadTabStrip: DNNRadTabstrip 1.0.0: DNNRadTabStrip makes it easy to add telerik RadTabStrip functionality to your module or skin. Licensing permits anyone to use the components (inclu...DotNetNuke® RadTreeView: DNNRadTreeView 1.0.0: DNNRadTreeView makes it easy to create skins which use the Telerik RadTreeview functionality. Licensing permits anyone (including designers) to use...DotNetNuke® Skin Garden: Garden Package 1.0.0: A DotNetNuke Design Challenge skin package submitted to the "Out of the box" category by Mark Allan of DnnGarden. Concise and semantic HTML 5 struc...ElmasFC: Elmas FC: This porgram is checking your facebook account automaticly.Free DotNetNuke IM of 123 Web Messenger -- Web-based Friend List: Free Download DNN IM Module and Source Code: 123 Web Messenger offers free DotNetNuke Instant Messaging to help you embed a IM Software into DNN Website by integrating 123 Web Messenger with D...Free Silverlight & WPF Chart Control - Visifire: Visifire SL and WPF Charts 3.0.4 Released: Hi, Today we have released the final version of Visifire v3.0.4 which contains the following major features: * Zooming * Step Line chart ...Home Access Plus+: v3.1.0.0: Version 3.1.0.0 Release Problem with this release, get Version 3.1.1.1 Change Log: Fixed ampersand issue Added Unzip Features Added Help Desk ...Home Access Plus+: v3.1.1.1: Version 3.1.1.1 Release Change Log: Fixed the Help Desk File Changes: ~/App_Data/Tickets.xml ~/bin/CHS Extranet.dll ~/bin/CHS Extranet.pdbHomework Helper: Homework Helper 1.0: The first release of Homework Helper. It got basic functionality. Check the Documentation or press F1 while using the program.Homework Helper: Homework Helper v1.0: This is the latest version of Homework Helper. Just a few updates since the latest one (a couple of minutes ago). Now it saves your settings! Instr...IBCSharp: IBCSharp 1.02: What IBCSharp 1.02.zip unzips to: http://i39.tinypic.com/28hz8m1.png Note: The above solution has MSTest, Typemock Isolator, and Microsoft CHESS c...InfoService: InfoService v1.5 RC 1: InfoService Release Canidate Please note this is a RC. It should be stable, but i can't guarantee that! So use it on your own risk. Please read Pl...IntX: IntX 0.9.3.3: Fixed issue #7100IronRuby: 1.0 RC3: The IronRuby team is pleased to announce version 1.0 RC3! As IronRuby approaches the final 1.0, these RCs will contain crucial bug fixes and enhanc...MAISGestão: LayerDiagram (pdf): This is the final version of the layer diagramMapWindow6: MapWindow 6.0 msi (March 12): After some significant trouble with svn, this site represents a test of using Mercurial for our version control. Hopefully the choice of this new ...MSBuild Mercurial Tasks: 0.2.0 Beta: This release realises the Scenario 2 and provides two MSBuild tasks: HgCommit and HgPush. This task allows to create a new changeset in the current...NLog - Advanced .NET Logging: NLog 2.0 preview 1: This is very experimental first build of NLog from 2.0 branch is available for download. It’s not alpha, beta or even gamma, just a preview of upco...Open NFe: Fonte DANFE v1.9.5: Código-fonte para a versão 1.9.5 do DANFEOpiConsole (XNA): OpiConsole 0.3: OpiConsole 0.3 OpiConsole includes: * PC & Xbox support. * Default commands (cvar, quit etc.) * Ability to add custom commands. *...ORAYLIS BI.Quality: Release 1.0.0: Release 1.0.0Pcap.Net: Pcap.Net 0.5.0 (38141): Pcap.Net - March 2010 Release Pcap.Net is a .NET wrapper for WinPcap written in C++/CLI and C#. It Features almost all WinPcap features and include...PhysX.Net: PhysX.Net 0.12.0.0 Beta 1: This is beta release of 0.12.0.0 for people to test and provide feedback on. It targets 2.8.3.21 of PhysXPólya: Pólya 2010 03 13 alpha: Pólya is a collection of generic data structures; as generic as C#/.Net allows them to be. In this first release the focus has been on some fundam...Prolog.NET: Prolog.NET 1.0 Beta 1.3: Installer includes: primary Prolog.NET assembly Prolog.NET Workbench Prolog.NET Scheduler sample application PrologTest console applicatio...Propositional Framework: USP: The initial code drop was based on the Autocomplete demo and the neural network approach used by Jeff Heaton (@ http://www.heatonresearch.com/) - e...Protocol Transition with BizTalk: Source: Stable buildRoTwee: RoTwee (7.1.0.0): Now picture of your friend is shown in RoTwee. Place mouse cursor to the tweet !ServStop: 0.5.0.0: Initial Release Contents of ServStop0500.zip ServStop.exe 0.5.0.0 Initial Release. 32,768 bytes. Other files None. Source code available on "...SkeinLibManaged: Release 1.0.0.0 (Beta): This is the compiled DLL with XML documentation, so there should be plenty of context sensitive help and Intellisense. This is the Release version...sPWadmin: pwAdmin v0.9a: Added: LiveChat Plugin Shows the latest 150 chat messages from "/Your PW Server/logservice/logs/world2.chat" Refresh chat every 5 seconds Allow...sPWadmin: pwAdmin v0.9b: Some minor fixes to style, layout & different browser support Merged the forms in server configuration tab to a single form that can now save mul...Topsy Lib: Initial release: Initial Debug and Release versions.twNowplaying: twNowplaying: Press the Twitter icon to get started, don't forget to submit bugs to the issue tracker. What's new This release has some minor UI fixes.twNowplaying: twNowplaying Alpha 1.0: Press the Twitter icon to get started, don't forget to submit bugs to the issue tracker. Thank you , and enjoy! =)VCC: Latest build, v2.1.30312.0: Automatic drop of latest buildWPF Dialogs: Version 0.1.3: The FolderBrowseDialog / FolderBrowseDialog - Deutsch was improved and extended.XOM: XOM 0.1A: Just a release of the code I have so far. In order to get your objects to work, you need to create an XML file to define your objects. Here is a ...Xpress - ASP.NET MVC 个人博客程序: xpress2.1.1.0312.beta: 最新beta版,注意:此版本和2.1.0不兼容 更改内容: 将主题文件发放在 Views 文件夹下 主题文件支持强类型Model 主题资源文件放在Resouces目录下YS Utils: V 1.0.0.0: This is first release. The YSUtils library contains first set of classes. ZIP files contains documentation.Most Popular ProjectsMetaSharpWBFS ManagerRawrAJAX Control ToolkitMicrosoft SQL Server Product Samples: DatabaseSilverlight ToolkitWindows Presentation Foundation (WPF)ASP.NET Ajax LibraryASP.NETMicrosoft SQL Server Community & SamplesMost Active ProjectsRawrN2 CMSBlogEngine.NETFasterflect - A Fast and Simple Reflection APIpatterns & practices – Enterprise LibraryFarseer Physics EngineSharePoint Team-MailerCaliburn: An Application Framework for WPF and SilverlightCalcium: A modular application toolset leveraging PrismjQuery Library for SharePoint Web Services

    Read the article

< Previous Page | 375 376 377 378 379 380 381 382 383 384 385 386  | Next Page >