Search Results

Search found 10071 results on 403 pages for 'operator module'.

Page 383/403 | < Previous Page | 379 380 381 382 383 384 385 386 387 388 389 390  | Next Page >

  • what do i need to do so that mod_wsgi will find libmysqlclient.16.dylib? (osx 10.7 with apache mod_wsgi)

    - by compound eye
    I am trying to run django on osx 10.7 (lion) with apache mod_wsgi and virtualenv. My site works if I use the django testing server: (baseline)otter:hello mathew$ python manage.py runserver but it doesn't work when I run apache. The core of the error seems to be Library not loaded: libmysqlclient.16.dylib I think its to do with the path apache is using to locate libmysqlclient.16.dylib when I run otool in the lib directory it looks good otter:lib mathew$ pwd /usr/local/mysql/lib otter:lib mathew$ otool -L libmysqlclient.16.dylib libmysqlclient.16.dylib: libmysqlclient.16.dylib (compatibility version 16.0.0, current version 16.0.0) /usr/lib/libSystem.B.dylib (compatibility version 1.0.0, current version 125.0.1) but from outside it can't find it otter:lib mathew$ cd / otter:/ mathew$ otool -L libmysqlclient.16.dylib otool: can't open file: libmysqlclient.16.dylib (No such file or directory) if i manually set DYLD_LIBRARY_PATH otool works otter:lib mathew$ DYLD_LIBRARY_PATH=/usr/local/mysql/lib otter:lib mathew$ otool -L libmysqlclient.16.dylib libmysqlclient.16.dylib: libmysqlclient.16.dylib (compatibility version 16.0.0, current version 16.0.0) /usr/lib/libSystem.B.dylib (compatibility version 1.0.0, current version 125.0.1) When I run the django testing server, my .bash_profile sets up the virtualenv and the path to the mysql dynamic library export DYLD_LIBRARY_PATH=/usr/local/mysql/lib/:$DYLD_LIBRARY_PATH export PATH When i run apache it finds my virtualenv paths, but it doesn't seem to find the dynamic library path. I tried adding this path to /usr/sbin/envvars DYLD_LIBRARY_PATH="/usr/lib:/usr/local/mysql/lib:$DYLD_LIBRARY_PATH" export DYLD_LIBRARY_PATH and to /private/etc/paths.d/libmysql /usr/local/mysql/lib then restarted the machine but that has not changed the error message. Error loading MySQLdb module: dlopen(/usr/local/python_virtualenv/baseline/lib/python2.7/site-packages/_mysql.so, 2): Library not loaded: libmysqlclient.16.dylib I don't think is a permissions issue: -rwxr-xr-x 1 root wheel 3787328 4 Dec 2010 libmysqlclient.16.dylib drwxr-xr-x 39 root wheel 1394 18 Nov 21:07 / drwxr-xr-x@ 15 root wheel 510 24 Oct 22:10 /usr drwxrwxr-x 20 root admin 680 2 Nov 20:22 /usr/local drwxr-xr-x 20 mathew admin 680 9 Nov 21:58 /usr/local/python_virtualenv drwxr-xr-x 6 mathew admin 204 2 Nov 21:36 /usr/local/python_virtualenv/baseline drwxr-xr-x 4 mathew admin 136 2 Nov 21:26 /usr/local/python_virtualenv/baseline/lib drwxr-xr-x 52 mathew admin 1768 2 Nov 21:26 /usr/local/python_virtualenv/baseline/lib/python2.7 drwxr-xr-x 18 mathew admin 612 4 Nov 21:20 /usr/local/python_virtualenv/baseline/lib/python2.7/site-packages -rwxr-xr-x 1 mathew admin 66076 2 Nov 21:18 /usr/local/python_virtualenv/baseline/lib/python2.7/site-packages/_mysql.so What do i need to do so that mod_wsgi will find libmysqlclient.16.dylib? apache and mysql are both 64 bit: otter:lib mathew$ file /usr/sbin/httpd /usr/sbin/httpd: Mach-O universal binary with 2 architectures /usr/sbin/httpd (for architecture x86_64): Mach-O 64-bit executable x86_64 /usr/sbin/httpd (for architecture i386): Mach-O executable i386 otter:lib mathew$ otter:lib mathew$ file /usr/local/mysql/lib/libmysqlclient.16.dylib /usr/local/mysql/lib/libmysqlclient.16.dylib: Mach-O 64-bit dynamically linked shared library x86_64

    Read the article

  • Zend_Auth / Zend_Session error and storing objects in Auth Storage

    - by Martin
    Hi All, I have been having a bit of a problem with Zend_Auth and keep getting an error within my Acl. Within my Login Controller I setup my Zend_Auth storage as follows $auth = Zend_Auth::getInstance(); $result = $auth->authenticate($adapter); if ($result->isValid()) { $userId = $adapter->getResultRowObject(array('user_id'), null)->user_id; $user = new User_Model_User; $users = new User_Model_UserMapper; $users->find($userId, $user); $auth->getStorage()->write( $user ); } This seems to work well and I am able to use the object stored in the Zend_Auth storage within View Helpers without any problems. The problem that I seem to be having is when I try to use this within my Acl, below is a snippet from my Acl, as soon as it gets to the if($auth->hasIdentity()) { line I get the exception detailed further down. The $user->getUserLevel() is a methord within the User Model that allows me to convert the user_level_id that is stored in the database to a meaning full name. I am assuming that the auto loader sees these kind of methords and tries to load all the classes that would be required. When looking at the exception it appears to be struggling to find the class as it is stored in a module, I have the Auto Loader Name Space setup in my application.ini. Could anyone help with resolving this? class App_Controller_Plugin_Acl extends Zend_Controller_Plugin_Abstract { protected $_roleName; public function __construct() { $auth = Zend_Auth::getInstance(); if($auth->hasIdentity()) { $user = $auth->getIdentity(); $this->_roleName = strtolower($user->getUserLevel()); } else { $this->_roleName = 'guest'; } } } Fatal error: Uncaught exception 'Zend_Session_Exception' with message 'Zend_Session::start() - \Web\library\Zend\Loader.php(Line:146): Error #2 include_once() [&lt;a href='function.include'&gt;function.include&lt;/a&gt;]: Failed opening 'Menu\Model\UserLevel.php' for inclusion (include_path='\Web\application/../library;\Web\library;.;C:\php5\pear') Array' in \Web\library\Zend\Session.php:493 Stack trace: #0 \Web\library\Zend\Session\Namespace.php(143): Zend_Session::start(true) #1 \Web\library\Zend\Auth\Storage\Session.php(87): Zend_Session_Namespace-&gt;__construct('Zend_Auth') #2 \Web\library\Zend\Auth.php(91): Zend_Auth_Storage_Session-&gt;__construct() #3 \Web\library\Zend\A in \Web\library\Zend\Session.php on line 493 Thanks, Martin

    Read the article

  • Translate Java class with static attributes and Annotation to Scala equivalent

    - by ifischer
    I'm currently trying to "translate" the following Java class to an equivalent Scala class. It's part of a JavaEE6-application and i need it to use the JPA2 MetaModel. import javax.persistence.metamodel.SingularAttribute; import javax.persistence.metamodel.StaticMetamodel; @StaticMetamodel(Person.class) public class Person_ { public static volatile SingularAttribute<Person, String> name; } A dissassembling of the compiled class file reveals the following information for the compiled file: > javap Person_.class : public class model.Person_ extends java.lang.Object{ public static volatile javax.persistence.metamodel.SingularAttribute name; public model.Person_(); } So now i need an equivalent Scala file that has the same structure, as JPA depends on it, cause it resolves the attributes by reflection to make them accessible at runtime. So the main problem i think is that the attribute is static, but the Annotation has to be on an (Java)Object (i guess) My first naive attempt to create a Scala equivalent is the following: @StaticMetamodel(classOf[Person]) class Person_ object Person_ { @volatile var name:SingularAttribute[Person, String] = _; } But the resulting classfile is far away from the Java one, so it doesn't work. When trying to access the attributes at runtime, e.g. "Person_.firstname", it resolves to null, i think JPA can't do the right reflection magic on the compiled classfile (the Java variant resolves to an instance of org.hibernate.ejb.metamodel.SingularAttributeImpl at runtime). > javap Person_.class : public class model.Person_ extends java.lang.Object implements scala.ScalaObject{ public static final void name_$eq(javax.persistence.metamodel.SingularAttribute); public static final javax.persistence.metamodel.SingularAttribute name(); public model.Person_(); } > javap Person_$.class : public final class model.Person__$ extends java.lang.Object implements scala.ScalaObject public static final model.Person__$ MODULE$; public static {}; public javax.persistence.metamodel.SingularAttribute name(); public void name_$eq(javax.persistence.metamodel.SingularAttribute); } So now what i'd like to know is if it's possible at all to create a Scala equivalent of the Java class? It seems to me that it's absolutely not, but maybe there is a workaround or something (except just using Java, but i want my app to be in Scala where possible) Any ideas, anyone? Thanks in advance!

    Read the article

  • Optimizing Haskell code

    - by Masse
    I'm trying to learn Haskell and after an article in reddit about Markov text chains, I decided to implement Markov text generation first in Python and now in Haskell. However I noticed that my python implementation is way faster than the Haskell version, even Haskell is compiled to native code. I am wondering what I should do to make the Haskell code run faster and for now I believe it's so much slower because of using Data.Map instead of hashmaps, but I'm not sure I'll post the Python code and Haskell as well. With the same data, Python takes around 3 seconds and Haskell is closer to 16 seconds. It comes without saying that I'll take any constructive criticism :). import random import re import cPickle class Markov: def __init__(self, filenames): self.filenames = filenames self.cache = self.train(self.readfiles()) picklefd = open("dump", "w") cPickle.dump(self.cache, picklefd) picklefd.close() def train(self, text): splitted = re.findall(r"(\w+|[.!?',])", text) print "Total of %d splitted words" % (len(splitted)) cache = {} for i in xrange(len(splitted)-2): pair = (splitted[i], splitted[i+1]) followup = splitted[i+2] if pair in cache: if followup not in cache[pair]: cache[pair][followup] = 1 else: cache[pair][followup] += 1 else: cache[pair] = {followup: 1} return cache def readfiles(self): data = "" for filename in self.filenames: fd = open(filename) data += fd.read() fd.close() return data def concat(self, words): sentence = "" for word in words: if word in "'\",?!:;.": sentence = sentence[0:-1] + word + " " else: sentence += word + " " return sentence def pickword(self, words): temp = [(k, words[k]) for k in words] results = [] for (word, n) in temp: results.append(word) if n > 1: for i in xrange(n-1): results.append(word) return random.choice(results) def gentext(self, words): allwords = [k for k in self.cache] (first, second) = random.choice(filter(lambda (a,b): a.istitle(), [k for k in self.cache])) sentence = [first, second] while len(sentence) < words or sentence[-1] is not ".": current = (sentence[-2], sentence[-1]) if current in self.cache: followup = self.pickword(self.cache[current]) sentence.append(followup) else: print "Wasn't able to. Breaking" break print self.concat(sentence) Markov(["76.txt"]) -- module Markov ( train , fox ) where import Debug.Trace import qualified Data.Map as M import qualified System.Random as R import qualified Data.ByteString.Char8 as B type Database = M.Map (B.ByteString, B.ByteString) (M.Map B.ByteString Int) train :: [B.ByteString] -> Database train (x:y:[]) = M.empty train (x:y:z:xs) = let l = train (y:z:xs) in M.insertWith' (\new old -> M.insertWith' (+) z 1 old) (x, y) (M.singleton z 1) `seq` l main = do contents <- B.readFile "76.txt" print $ train $ B.words contents fox="The quick brown fox jumps over the brown fox who is slow jumps over the brown fox who is dead."

    Read the article

  • How to get hibernate3-maven-plugin hbm2ddl to find JDBC driver?

    - by HDave
    I have a Java project I am building with Maven. I am now trying to get the hibernate3-maven-plugin to run the hbm2ddl tool to generate a schema.sql file I can use to create the database schema from my annotated domain classes. This is a JPA application that uses Hibernate as the provider. In my persistence.xml file I call out the mysql driver: <property name="hibernate.dialect" value="org.hibernate.dialect.MySQLDialect"/> <property name="hibernate.connection.driver_class" value="com.mysql.jdbc.Driver"/> When I run Maven, I see it processing all my classes, but when it goes to output the schema, I get the following error: ERROR org.hibernate.connection.DriverManagerConnectionProvider - JDBC Driver class not found: com.mysql.jdbc.Driver java.lang.ClassNotFoundException: com.mysql.jdbc.Driver I have the MySQL driver as a dependency of this module. However it seems like the hbm2ddl tool cannot find it. I would have guessed that the Maven plugin would have known to search the local Maven file repository for this driver. What gives? The relevant part of my pom.xml is this: <plugin> <groupId>org.codehaus.mojo</groupId> <artifactId>hibernate3-maven-plugin</artifactId> <executions> <execution> <phase>process-classes</phase> <goals> <goal>hbm2ddl</goal> </goals> </execution> </executions> <configuration> <components> <component> <name>hbm2ddl</name> <implementation>jpaconfiguration</implementation> </component> </components> <componentProperties> <persistenceunit>my-unit</persistenceunit> </componentProperties> </configuration> </plugin>

    Read the article

  • C# Generic Arrays and math operations on it

    - by msedi
    Hello, I'm currently involved in a project where I have very large image volumes. This volumes have to processed very fast (adding, subtracting, thresholding, and so on). Additionally most of the volume are so large that they event don't fit into the memory of the system. For that reason I have created an abstract volume class (VoxelVolume) that host the volume and image data and overloads the operators so that it's possible to perform the regular mathematical operations on volumes. Thereby two more questions opened up which I will put into stackoverflow into two additional threads. Here is my first question. My volume is implemented in a way that it only can contain float array data, but most of the containing data is from an UInt16 image source. Only operations on the volume can create float array images. When I started implementing such a volume the class looked like following: public abstract class VoxelVolume<T> { ... } but then I realized that overloading the operators or return values would get more complicated. An example would be: public abstract class VoxelVolume<T> { ... public static VoxelVolume<T> Import<T>(param string[] files) { } } also adding two overloading operators would be more complicated: ... public static VoxelVolume<T> operator+(VoxelVolume<T> A, VoxelVolume<T> B) { ... } Let's assume I can overcome the problems described above, nevertheless I have different types of arrays that contain the image data. Since I have fixed my type in the volumes to float the is no problem and I can do an unsafe operation when adding the contents of two image volume arrays. I have read a few threads here and had a look around the web, but found no real good explanation of what to do when I want to add two arrays of different types in a fast way. Unfortunately every math operation on generics is not possible, since C# is not able to calculate the size of the underlying data type. Of course there might by a way around this problem by using C++/CLR, but currently everything I have done so far, runs in 32bit and 64bit without having to do a thing. Switching to C++/CLR seemed to me (pleased correct me if I'm wrong) that I'm bound to a certain platform (32bit) and I have to compile two assemblies when I let the application run on another platform (64bit). Is this true? So asked shortly: How is it possible to add two arrays of two different types in a fast way. Is it true that the developers of C# haven't thought about this. Switching to a different language (C# - C++) seems not to be an option. I realize that simply performing this operation float []A = new float[]{1,2,3}; byte []B = new byte[]{1,2,3}; float []C = A+B; is not possible and unnecessary although it would be nice if it would work. My solution I was trying was following: public static class ArrayExt { public static unsafe TResult[] Add<T1, T2, TResult>(T1 []A, T2 []B) { // Assume the length of both arrays is equal TResult[] result = new TResult[A.Length]; GCHandle h1 = GCHandle.Alloc (A, Pinned); GCHandle h2 = GCHandle.Alloc (B, Pinned); GCHandle hR = GCHandle.Alloc (C, Pinned); void *ptrA = h1.ToPointer(); void *ptrB = h2.ToPointer(); void *ptrR = hR.ToPointer(); for (int i=0; i<A.Length; i++) { *((TResult *)ptrR) = (TResult *)((T1)*ptrA + (T2)*ptrB)); } h1.Free(); h2.Free(); hR.Free(); return result; } } Please excuse if the code above is not quite correct, I wrote it without using an C# editor. Is such a solution a shown above thinkable? Please feel free to ask if I made a mistake or described some things incompletely. Thanks for your help Martin

    Read the article

  • Python - wxPython What's wrong?

    - by Wallter
    I am trying to write a simple custom button in wx.Python. My code is as follows,(As a side note: I am relatively new to python having come from C++ and C# any help on syntax and function of the code would be great! - knowing that, it could be a simple error. thanks!) Error Traceback (most recent call last): File "D:\Documents\Python2\Button\src\Custom_Button.py", line 10, in <module> class Custom_Button(wx.PyControl): File "D:\Documents\Python2\Button\src\Custom_Button.py", line 13, in Custom_Button Mouse_over_bmp = wx.Bitmap(0) # When the mouse is over File "C:\Python26\lib\site-packages\wx-2.8-msw-unicode\wx\_gdi.py", line 561, in __init__ _gdi_.Bitmap_swiginit(self,_gdi_.new_Bitmap(*args, **kwargs)) TypeError: String or Unicode type required Main.py class MyFrame(wx.Frame): def __init__(self, parent, ID, title): wxFrame.__init__(self, parent, ID, title, wxDefaultPosition, wxSize(400, 400)) self.CreateStatusBar() self.SetStatusText("Program testing custom button overlays") menu = wxMenu() menu.Append(ID_ABOUT, "&About", "More information about this program") menu.AppendSeparator() menu.Append(ID_EXIT, "E&xit", "Terminate the program") menuBar = wxMenuBar() menuBar.Append(menu, "&File"); self.SetMenuBar(menuBar) self.Button1 = Custom_Button(self, parent, -1, "D:/Documents/Python/Normal.bmp", "D:/Documents/Python/Clicked.bmp", "D:/Documents/Python/Over.bmp", "None", wx.Point(200,200), wx.Size(300,100)) EVT_MENU(self, ID_ABOUT, self.OnAbout) EVT_MENU(self, ID_EXIT, self.TimeToQuit) def OnAbout(self, event): dlg = wxMessageDialog(self, "Testing the functions of custom " "buttons using pyDev and wxPython", "About", wxOK | wxICON_INFORMATION) dlg.ShowModal() dlg.Destroy() def TimeToQuit(self, event): self.Close(true) class MyApp(wx.App): def OnInit(self): frame = MyFrame(NULL, -1, "wxPython | Buttons") frame.Show(true) self.SetTopWindow(frame) return true app = MyApp(0) app.MainLoop() Custom Button import wx from wxPython.wx import * class Custom_Button(wx.PyControl): ############################################ ##THE ERROR IS BEING THROWN SOME WHERE IN HERE ## ############################################ # The BMP's Mouse_over_bmp = wx.Bitmap(0) # When the mouse is over Norm_bmp = wx.Bitmap(0) # The normal BMP Push_bmp = wx.Bitmap(0) # The down BMP Pos_bmp = wx.Point(0,0) # The posisition of the button def __init__(self, parent, NORM_BMP, PUSH_BMP, MOUSE_OVER_BMP, pos, size, text="", id=-1, **kwargs): wx.PyControl.__init__(self,parent, id, **kwargs) # Set the BMP's to the ones given in the constructor self.Mouse_over_bmp = wx.Bitmap(MOUSE_OVER_BMP) self.Norm_bmp = wx.Bitmap(NORM_BMP) self.Push_bmp = wx.Bitmap(PUSH_BMP) self.Pos_bmp = pos ############################################ ##THE ERROR IS BEING THROWN SOME WHERE IN HERE ## ############################################ self.Bind(wx.EVT_LEFT_DOWN, self._onMouseDown) self.Bind(wx.EVT_LEFT_UP, self._onMouseUp) self.Bind(wx.EVT_LEAVE_WINDOW, self._onMouseLeave) self.Bind(wx.EVT_ENTER_WINDOW, self._onMouseEnter) self.Bind(wx.EVT_ERASE_BACKGROUND,self._onEraseBackground) self.Bind(wx.EVT_PAINT,self._onPaint) self._mouseIn = self._mouseDown = False def _onMouseEnter(self, event): self._mouseIn = True def _onMouseLeave(self, event): self._mouseIn = False def _onMouseDown(self, event): self._mouseDown = True def _onMouseUp(self, event): self._mouseDown = False self.sendButtonEvent() def sendButtonEvent(self): event = wx.CommandEvent(wx.wxEVT_COMMAND_BUTTON_CLICKED, self.GetId()) event.SetInt(0) event.SetEventObject(self) self.GetEventHandler().ProcessEvent(event) def _onEraseBackground(self,event): # reduce flicker pass def _onPaint(self, event): dc = wx.BufferedPaintDC(self) dc.SetFont(self.GetFont()) dc.SetBackground(wx.Brush(self.GetBackgroundColour())) dc.Clear() dc.DrawBitmap(self.Norm_bmp) # draw whatever you want to draw # draw glossy bitmaps e.g. dc.DrawBitmap if self._mouseIn: # If the Mouse is over the button dc.DrawBitmap(self, self.Mouse_over_bmp, self.Pos_bmp, useMask=False) if self._mouseDown: # If the Mouse clicks the button dc.DrawBitmap(self, self.Push_bmp, self.Pos_bmp, useMask=False)

    Read the article

  • A continued saga of C# interoprability with unmanaged C++

    - by Gilad
    After a day of banging my head against the wall both literally and metaphorically, I plead for help: I have an unmanaged C++ project, which is compiled as a DLL. Let's call it CPP Project. It currently works in an unmanaged environment. In addition, I have created a WPF project, that shall be called WPF Project. This project is a simple and currently almost empty project. It contains a single window and I want it to use code from Project 1. For that, I have created a CLR C++ project, which shall be called Interop Project and is also compiled as a DLL. For simplicity I will attach some basic testing code I have boiled down to the basics. CPP Project has the following two testing files: tester.h #pragma once extern "C" class __declspec(dllexport) NativeTester { public: void NativeTest(); }; tester.cpp #include "tester.h" void NativeTester::NativeTest() { int i = 0; } Interop Project has the following file: InteropLib.h #pragma once #include <tester.h> using namespace System; namespace InteropLib { public ref class InteropProject { public: static void Test() { NativeTester nativeTester; nativeTester.NativeTest(); } }; } Lastly, WPF Project has a single window refrencing Interop Project: MainWindow.xaml.cs using System; using System.Windows; using InteropLib; namespace AppGUI { public partial class MainWindow : Window { public MainWindow() { InitializeComponent(); InteropProject.Test(); } } } And the XAML itself has an empty window (default created). Once I am trying to run the WPF project, I get the following error: System.Windows.Markup.XamlParseException: 'The invocation of the constructor on type 'AppGUI.MainWindow' that matches the specified binding constraints threw an exception.' Line number '3' and line position '9'. --- System.IO.FileNotFoundException: Could not load file or assembly 'InteropLib.dll' or one of its dependencies. The specified module could not be found. at AppGUI.MainWindow..ctor() Interestingly enough, if I do not export the class from CPP Project, I do not get this error. Say, if i change tester.h to: #pragma once class NativeTester { public: void NativeTest() { int i = 0; } }; However, in this case I cannot use my more complex classes. If I move my implementation to a cpp file like before, I get unresolved linkage errors due to my not exporting my code. The C++ code I want to actually use is large and has many classes and is object oriented, so I can't just move all my implementation to the h files. Please help me understand this horrific error I've been trying resolve without success. Thanks.

    Read the article

  • Drupal 7: File field causes error with Dependable Dropdowns

    - by LoneWolfPR
    I'm building a Form in a module using the Form API. I've had a couple of dependent dropdowns that have been working just fine. The code is as follows: $types = db_query('SELECT * FROM {touchpoints_metric_types}') -> fetchAllKeyed(0, 1); $types = array('0' => '- Select -') + $types; $selectedType = isset($form_state['values']['metrictype']) ? $form_state['values']['metrictype'] : 0; $methods = _get_methods($selectedType); $selectedMethod = isset($form_state['values']['measurementmethod']) ? $form_state['values']['measurementmethod'] : 0; $form['metrictype'] = array( '#type' => 'select', '#title' => t('Metric Type'), '#options' => $types, '#default_value' => $selectedType, '#ajax' => array( 'event' => 'change', 'wrapper' => 'method-wrapper', 'callback' => 'touchpoints_method_callback' ) ); $form['measurementmethod'] = array( '#type' => 'select', '#title' => t('Measurement Method'), '#prefix' => '<div id="method-wrapper">', '#suffix' => '</div>', '#options' => $methods, '#default_value' => $selectedMethod, ); Here are the _get_methods and touchpoints_method_callback functions: function _get_methods($selected) { if ($selected) { $methods = db_query("SELECT * FROM {touchpoints_m_methods} WHERE mt_id=$selected") -> fetchAllKeyed(0, 2); } else { $methods = array(); } $methods = array('0' => "- Select -") + $methods; return $methods; } function touchpoints_method_callback($form, &$form_state) { return $form['measurementmethod']; } This all worked fine until I added a file field to the form. Here is the code I used for that: $form['metricfile'] = array( '#type' => 'file', '#title' => 'Attach a File', ); Now that the file is added if I change the first dropdown it hangs with the 'Please wait' message next to it without ever loading the contents of the second dropdown. I also get the following error in my JavaScript console: "Uncaught TypeError: Object function (a,b){return new p.fn.init(a,b,c)} has no method 'handleError'" What am I doing wrong here?

    Read the article

  • What's the best way to do base36 arithmetic in perl?

    - by DVK
    What's the best way to do base36 arithmetic in Perl? To be more specific, I need to be able to do the following: Operate on positive N-digit numbers in base 36 (e.g. digits are 0-9 A-Z) N is finite, say 9 Provide basic arithmetic, at the very least the following 3: Addition (A+B) Subtraction (A-B) Whole division, e.g. floor(A/B). Strictly speaking, I don't really need a base10 conversion ability - the numbers will 100% of time be in base36. So I'm quite OK if the solution does NOT implement conversion from base36 back to base10 and vice versa. I don't much care whether the solution is brute-force "convert to base 10 and back" or converting to binary, or some more elegant approach "natively" performing baseN operations (as stated above, to/from base10 conversion is not a requirement). My only 3 considerations are: It fits the minimum specifications above It's "standard". Currently we're using and old homegrown module based on base10 conversion done by hand that is buggy and sucks. I'd much rather replace that with some commonly used CPAN solution instead of re-writing my own bicycle from scratch, but I'm perfectly capable of building it if no better standard possibility exists. It must be fast-ish (though not lightning fast). Something that takes 1 second to sum up 2 9-digit base36 numbers is worse than anything I can roll on my own :) P.S. Just to provide some context in case people decide to solve my XY problem for me in addition to answering the technical question above :) We have a fairly large tree (stored in DB as a bunch of edges), and we need to superimpose order on a subset of that tree. The tree dimentions are big both depth- and breadth- wise. The tree is VERY actively updated (inserts and deletes and branch moves). This is currently done by having a second table with 3 columns: parent_vertex, child_vertex, local_order, where local_order is an 9-character string built of A-Z0-9 (e.g. base 36 number). Additional considerations: It is required that the local order is unique per child (and obviously unique per parent), Any complete re-ordering of a parent is somewhat expensive, and thus the implementation is to try and assign - for a parent with X children - the orders which are somewhat evenly distributed between 0 and 36**10-1, so that almost no tree inserts result in a full re-ordering.

    Read the article

  • Where is the method call in the EXE file?

    - by Victor Hurdugaci
    Introduction After watching this video from LIDNUG, about .NET code protection http://secureteam.net/lidnug_recording/Untitled.swf (especially from 46:30 to 57:30), I would to locate the call to a MessageBox.Show in an EXE I created. The only logic in my "TrialApp.exe" is: public partial class Form1 : Form { public Form1() { InitializeComponent(); } private void Form1_Load(object sender, EventArgs e) { MessageBox.Show("This is trial app"); } } Compiled on the Release configuration: http://rapidshare.com/files/392503054/TrialApp.exe.html What I do to locate the call Run the application in WinDBG and break after the message box appears. Get the CLR stack with !clrstack: 0040e840 5e21350b [InlinedCallFrame: 0040e840] System.Windows.Forms.SafeNativeMethods.MessageBox(System.Runtime.InteropServices.HandleRef, System.String, System.String, Int32) 0040e894 5e21350b System.Windows.Forms.MessageBox.ShowCore(System.Windows.Forms.IWin32Window, System.String, System.String, System.Windows.Forms.MessageBoxButtons, System.Windows.Forms.MessageBoxIcon, System.Windows.Forms.MessageBoxDefaultButton, System.Windows.Forms.MessageBoxOptions, Boolean) 0040e898 002701f0 [InlinedCallFrame: 0040e898] 0040e934 002701f0 TrialApp.Form1.Form1_Load(System.Object, System.EventArgs) Get the MethodDesc structure (using the address of Form1_Load) !ip2md 002701f0 MethodDesc: 001762f8 Method Name: TrialApp.Form1.Form1_Load(System.Object, System.EventArgs) Class: 00171678 MethodTable: 00176354 mdToken: 06000005 Module: 00172e9c IsJitted: yes CodeAddr: 002701d0 Transparency: Critical Source file: D:\temp\TrialApp\TrialApp\Form1.cs @ 22 Dump the IL of this method (by MethodDesc) !dumpil 001762f8 IL_0000: ldstr "This is trial app" IL_0005: call System.Windows.Forms.MessageBox::Show IL_000a: pop IL_000b: ret So, as the video mentioned, the call to to Show is 5 bytes from the beginning of the method implementation. Now I open CFFExplorer (just like in the video) and get the RVA of the Form1_Load method: 00002083. After this, I go to Address Converter (again in CFF Explorer) and navigate to offset 00002083. There we have: 32 72 01 00 00 70 28 16 00 00 0A 26 2A 7A 03 2C 13 02 7B 02 00 00 04 2C 0B 02 7B 02 00 00 04 6F 17 00 00 0A 02 03 28 18 00 00 0A 2A 00 03 30 04 00 67 00 00 00 00 00 00 00 02 28 19 00 00 0A 02 In the video is mentioned that the first 12 bytes are for the method header so I skip them 2A 7A 03 2C 13 02 7B 02 00 00 04 2C 0B 02 7B 02 00 00 04 6F 17 00 00 0A 02 03 28 18 00 00 0A 2A 00 03 30 04 00 67 00 00 00 00 00 00 00 02 28 19 00 00 0A 02 5 bytes from the beginning of the implementation should be the opcode for method call (28). Unfortunately, is not there. 02 7B 02 00 00 04 2C 0B 02 7B 02 00 00 04 6F 17 00 00 0A 02 03 28 18 00 00 0A 2A 00 03 30 04 00 67 00 00 00 00 00 00 00 02 28 19 00 00 0A 02 Questions: What am I doing wrong? Why there is no method call at that position in the file? Or maybe the video is missing some information... Why the guy in that video replaces the call with 9 zeros?

    Read the article

  • Searching a set of data with multiple terms using Linq

    - by Cj Anderson
    I'm in the process of moving from ADO.NET to Linq. The application is a directory search program to look people up. The users are allowed to type the search criteria into a single textbox. They can separate each term with a space, or wrap a phrase in quotes such as "park place" to indicate that it is one term. Behind the scenes the data comes from a XML file that has about 90,000 records in it and is about 65 megs. I load the data into a DataTable and then use the .Select method with a SQL query to perform the searches. The query I pass is built from the search terms the user passed. I split the string from the textbox into an array using a regular expression that will split everything into a separate element that has a space in it. However if there are quotes around a phrase, that becomes it's own element in the array. I then end up with a single dimension array with x number of elements, which I iterate over to build a long query. I then build the search expression below: query = query & _ "((userid LIKE '" & tempstr & "%') OR " & _ "(nickname LIKE '" & tempstr & "%') OR " & _ "(lastname LIKE '" & tempstr & "%') OR " & _ "(firstname LIKE '" & tempstr & "%') OR " & _ "(department LIKE '" & tempstr & "%') OR " & _ "(telephoneNumber LIKE '" & tempstr & "%') OR " & _ "(email LIKE '" & tempstr & "%') OR " & _ "(Office LIKE '" & tempstr & "%'))" Each term will have a set of the above query. If there is more than one term, I put an AND in between, and build another query like above with the next term. I'm not sure how to do this in Linq. So far, I've got the XML file loading correctly. I'm able to search it with specific criteria, but I'm not sure how to best implement the search over multiple terms. 'this works but far too simple to get the job done Dim results = From c In m_DataSet...<Users> _ Where c.<userid>.Value = "XXXX" _ Select c The above code also doesn't use the LIKE operator either. So partial matches don't work. It looks like what I'd want to use is the .Startswith but that appears to be only in Linq2SQL. Any guidance would be appreciated. I'm new to Linq, so I might be missing a simple way to do this. The XML file looks like so: <?xml version="1.0" standalone="yes"?> <theusers> <Users> <userid>person1</userid> <nickname></nickname> <lastname></lastname> <firstname></firstname> <department></department> <telephoneNumber></telephoneNumber> <email></email> </Users> <Users> <userid>person2</userid> <nickname></nickname> <lastname></lastname> <firstname></firstname> <department></department> <telephoneNumber></telephoneNumber> <email></email> </Users>

    Read the article

  • Using a boost::fusion::map in boost::spirit::karma

    - by user1097105
    I am using boost spirit to parse some text files into a data structure and now I am beginning to generate text from this data structure (using spirit karma). One attempt at a data structure is a boost::fusion::map (as suggested in an answer to this question). But although I can use boost::spirit::qi::parse() and get data in it easily, when I tried to generate text from it using karma, I failed. Below is my attempt (look especially at the "map_data" type). After some reading and playing around with other fusion types, I found boost::fusion::vector and BOOST_FUSION_DEFINE_ASSOC_STRUCT. I succeeded to generate output with both of them, but they don't seem ideal: in vector you cannot access a member using a name (it is like a tuple) -- and in the other solution, I don't think I need both ways (member name and key type) to access the members. #include <iostream> #include <string> #include <boost/spirit/include/karma.hpp> #include <boost/fusion/include/map.hpp> #include <boost/fusion/include/make_map.hpp> #include <boost/fusion/include/vector.hpp> #include <boost/fusion/include/as_vector.hpp> #include <boost/fusion/include/transform.hpp> struct sb_key; struct id_key; using boost::fusion::pair; typedef boost::fusion::map < pair<sb_key, int> , pair<id_key, unsigned long> > map_data; typedef boost::fusion::vector < int, unsigned long > vector_data; #include <boost/fusion/include/define_assoc_struct.hpp> BOOST_FUSION_DEFINE_ASSOC_STRUCT( (), assocstruct_data, (int, a, sb_key) (unsigned long, b, id_key)) namespace karma = boost::spirit::karma; template <typename X> std::string to_string ( const X& data ) { std::string generated; std::back_insert_iterator<std::string> sink(generated); karma::generate_delimited ( sink, karma::int_ << karma::ulong_, karma::space, data ); return generated; } int main() { map_data d1(boost::fusion::make_map<sb_key, id_key>(234, 35314988526ul)); vector_data d2(boost::fusion::make_vector(234, 35314988526ul)); assocstruct_data d3(234,35314988526ul); std::cout << "map_data as_vector: " << boost::fusion::as_vector(d1) << std::endl; //std::cout << "map_data to_string: " << to_string(d1) << std::endl; //*FAIL No 1* std::cout << "at_key (sb_key): " << boost::fusion::at_key<sb_key>(d1) << boost::fusion::at_c<0>(d1) << std::endl << std::endl; std::cout << "vector_data: " << d2 << std::endl; std::cout << "vector_data to_string: " << to_string(d2) << std::endl << std::endl; std::cout << "assoc_struct as_vector: " << boost::fusion::as_vector(d3) << std::endl; std::cout << "assoc_struct to_string: " << to_string(d3) << std::endl; std::cout << "at_key (sb_key): " << boost::fusion::at_key<sb_key>(d3) << d3.a << boost::fusion::at_c<0>(d3) << std::endl; return 0; } Including the commented line gives lots of pages of compilation errors, among which notably something like: no known conversion for argument 1 from ‘boost::fusion::pair’ to ‘double’ no known conversion for argument 1 from ‘boost::fusion::pair’ to ‘float’ Might it be that to_string needs the values of the map_data, and not the pairs? Though I am not good with templates, I tried to get a vector from a map using transform in the following way template <typename P> struct take_second { typename P::second_type operator() (P p) { return p.second; } }; // ... inside main() pair <char, int> ff(32); std::cout << "take_second (expect 32): " << take_second<pair<char,int>>()(ff) << std::endl; std::cout << "transform map_data and to_string: " << to_string(boost::fusion::transform(d1, take_second<>())); //*FAIL No 2* But I don't know what types am I supposed to give when instantiating take_second and anyway I think there must be an easier way to get (iterate over) the values of a map (is there?) If you answer this question, please also give your opinion on whether using an ASSOC_STRUCT or a map is better.

    Read the article

  • SWIG & Java Use of carrays.i and array_functions for C Array of Strings

    - by c12
    I have the below configuration where I'm trying to create a test C function that returns a pointer to an Array of Strings and then wrap that using SWIG's carrays.i and array_functions so that I can access the Array elements in Java. Uncertainties: %array_functions(char, SWIGArrayUtility); - not sure if char is correct inline char *getCharArray() - not sure if C function signature is correct String result = getCharArray(); - String return seems odd, but that's what is generated by SWIG SWIG.i: %module Test %{ #include "test.h" %} %include <carrays.i> %array_functions(char, SWIGArrayUtility); %include "test.h" %pragma(java) modulecode=%{ public static char[] getCharArrayImpl() { final int num = numFoo(); char ret[] = new char[num]; String result = getCharArray(); for (int i = 0; i < num; ++i) { ret[i] = SWIGArrayUtility_getitem(result, i); } return ret; } %} Inline Header C Function: #ifndef TEST_H #define TEST_H inline static unsigned short numFoo() { return 3; } inline char *getCharArray(){ static char* foo[3]; foo[0]="ABC"; foo[1]="5CDE"; foo[2]="EEE6"; return foo; } #endif Java Main Tester: public class TestMain { public static void main(String[] args) { System.loadLibrary("TestJni"); char[] test = Test.getCharArrayImpl(); System.out.println("length=" + test.length); for(int i=0; i < test.length; i++){ System.out.println(test[i]); } } } Java Main Tester Output: length=3 ? ? , SWIG Generated Java APIs: public class Test { public static String new_SWIGArrayUtility(int nelements) { return TestJNI.new_SWIGArrayUtility(nelements); } public static void delete_SWIGArrayUtility(String ary) { TestJNI.delete_SWIGArrayUtility(ary); } public static char SWIGArrayUtility_getitem(String ary, int index) { return TestJNI.SWIGArrayUtility_getitem(ary, index); } public static void SWIGArrayUtility_setitem(String ary, int index, char value) { TestJNI.SWIGArrayUtility_setitem(ary, index, value); } public static int numFoo() { return TestJNI.numFoo(); } public static String getCharArray() { return TestJNI.getCharArray(); } public static char[] getCharArrayImpl() { final int num = numFoo(); char ret[] = new char[num]; String result = getCharArray(); System.out.println("result=" + result); for (int i = 0; i < num; ++i) { ret[i] = SWIGArrayUtility_getitem(result, i); System.out.println("ret[" + i + "]=" + ret[i]); } return ret; } }

    Read the article

  • Python4Delphi: Returning a python object in a function. (DelphiWrapper)

    - by Gabriel Fonseca
    I am using python4delphi. ow can I return an object from a wrapped Delphi class function? Code Snippet: I have a simple Delphi Class that i wrapped to Python Script, right? TSimple = Class Private function getvar1:string; Public Published property var1:string read getVar1; function getObj:TSimple; end; ... function TSimple.getVar1:string; begin result:='hello'; end; function TSimple.getObj:TSimple; begin result:=self; end; I made the TPySimple like the demo32 to give class access to the python code. My python module name is test. TPyDado = class(TPyDelphiPersistent) // Constructors & Destructors constructor Create( APythonType : TPythonType ); override; constructor CreateWith( PythonType : TPythonType; args : PPyObject ); override; // Basic services function Repr : PPyObject; override; class function DelphiObjectClass : TClass; override; end; ... { TPyDado } constructor TPyDado.Create(APythonType: TPythonType); begin inherited; // we need to set DelphiObject property DelphiObject := TDado.Create; with TDado(DelphiObject) do begin end; Owned := True; // We own the objects we create end; constructor TPyDado.CreateWith(PythonType: TPythonType; args: PPyObject); begin inherited; with GetPythonEngine, DelphiObject as TDado do begin if PyArg_ParseTuple( args, ':CreateDado' ) = 0 then Exit; end; end; class function TPyDado.DelphiObjectClass: TClass; begin Result := TDado; end; function TPyDado.Repr: PPyObject; begin with GetPythonEngine, DelphiObject as TDado do Result := VariantAsPyObject(Format('',[])); // or Result := PyString_FromString( PAnsiChar(Format('(%d, %d)',[x, y])) ); end; And now the python code: import test a = test.Simple() # try access the property var1 and everything is right print a.var1 # work's, but.. b = a.getObj(); # raise a exception that not find any attributes named getObj. # if the function returns a string for example, it's work.

    Read the article

  • How to get a html elements with python lxml

    - by Damiano
    Hello! I have this html code: <table> <tr> <td class="test"><b><a href="">aaa</a></b></td> <td class="test">bbb</td> <td class="test">ccc</td> <td class="test"><small>ddd</small></td> </tr> <tr> <td class="test"><b><a href="">eee</a></b></td> <td class="test">fff</td> <td class="test">ggg</td> <td class="test"><small>hhh</small></td> </tr> </table> I use this Python code to extract all <td class="test"> with lxml module. import urllib2 import lxml.html code = urllib.urlopen("http://www.example.com/page.html").read() html = lxml.html.fromstring(code) result = html.xpath('//td[@class="test"][position() = 1 or position() = 4]') It works good! The result is: <td class="test"><b><a href="">aaa</a></b></td> <td class="test"><small>ddd</small></td> <td class="test"><b><a href="">eee</a></b></td> <td class="test"><small>hhh</small></td> (so the first and the fourth column of each <tr>) Now, I have to extract: aaa (the title of the link) ddd (text between <small> tag) eee (the title of the link) hhh (text between <small> tag) How could I extract these values? (the problem is that I have to remove <b> tag and get the title of the anchor on the first column and remove <small> tag on the forth column) Thank you!

    Read the article

  • Injecting jQuery into a page fails when using Google AJAX Libraries API

    - by jakemcgraw
    I'd like to inject jQuery into a page using the Google AJAX Libraries API, I've come up with the following solution: http://my-domain.com/inject-jquery.js: ;((function(){ // Call this function once jQuery is available var func = function() { jQuery("body").prepend('<div>jQuery Rocks!</div>'); }; // Detect if page is already using jQuery if (!window.jQuery) { var done = false; var head = document.getElementsByTagName('head')[0]; var script = document.createElement("script"); script.src = "http://www.google.com/jsapi"; script.onload = script.onreadystatechange = function(){ // Once Google AJAX Libraries API is loaded ... if (!done && (!this.readyState || this.readyState == "loaded" || this.readyState == "complete")) { done = true; // ... load jQuery ... window.google.load("jquery", "1", {callback:function(){ jQuery.noConflict(); // ... jQuery available, fire function. func(); }}); // Prevent IE memory leaking script.onload = script.onreadystatechange = null; head.removeChild(script); } } // Load Google AJAX Libraries API head.appendChild(script); // Page already using jQuery, fire function } else { func(); } })()); The script would then be included in a page on a separate domain: http://some-other-domain.com/page.html: <html> <head> <title>This is my page</title> </head> <body> <h1>This is my page.</h1> <script src="http://my-domain.com/inject-jquery.js"></script> </body> </html> In Firefox 3 I get the following error: Module: 'jquery' must be loaded before DOM onLoad! jsapi (line 16) The error appears to be specific to the Google AJAX Libraries API, as I've seen others use a jQuery bookmarklet to inject jQuery into the current page. My question: Is there a method for injecting the Google AJAX Libraries API / jQuery into a page regardless of the onload/onready state?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • C++ destructor seems to be called 'early'

    - by suicideducky
    Please see the "edit" section for the updated information. Sorry for yet another C++ dtor question... However I can't seem to find one exactly like mine as all the others are assigning to STL containers (that will delete objects itself) whereas mine is to an array of pointers. So I have the following code fragment #include<iostream> class Block{ public: int x, y, z; int type; Block(){ x=1; y=2; z=3; type=-1; } }; template <class T> class Octree{ T* children[8]; public: ~Octree(){ for( int i=0; i<8; i++){ std::cout << "del:" << i << std::endl; delete children[i]; } } Octree(){ for( int i=0; i<8; i++ ) children[i] = new T; } // place newchild in array at [i] void set_child(int i, T* newchild){ children[i] = newchild; } // return child at [i] T* get_child(int i){ return children[i]; } // place newchild at [i] and return the old [i] T* swap_child(int i, T* newchild){ T* p = children[i]; children[i] = newchild; return p; } }; int main(){ Octree< Octree<Block> > here; std::cout << "nothing seems to have broken" << std::endl; } Looking through the output I notice that the destructor is being called many times before I think it should (as Octree is still in scope), the end of the output also shows: del:0 del:0 del:1 del:2 del:3 Process returned -1073741819 (0xC0000005) execution time : 1.685 s Press any key to continue. For some reason the destructor is going through the same point in the loop twice (0) and then dying. All of this occures before the "nothing seems to have gone wrong" line which I expected before any dtor was called. Thanks in advance :) EDIT The code I posted has some things removed that I thought were unnecessary but after copying and compiling the code I pasted I no longer get the error. What I removed was other integer attributes of the code. Here is the origional: #include<iostream> class Block{ public: int x, y, z; int type; Block(){ x=1; y=2; z=3; type=-1; } Block(int xx, int yy, int zz, int ty){ x=xx; y=yy; z=zz; type=ty; } Block(int xx, int yy, int zz){ x=xx; y=yy; z=zz; type=0; } }; template <class T> class Octree{ int x, y, z; int size; T* children[8]; public: ~Octree(){ for( int i=0; i<8; i++){ std::cout << "del:" << i << std::endl; delete children[i]; } } Octree(int xx, int yy, int zz, int size){ x=xx; y=yy; z=zz; size=size; for( int i=0; i<8; i++ ) children[i] = new T; } Octree(){ Octree(0, 0, 0, 10); } // place newchild in array at [i] void set_child(int i, T* newchild){ children[i] = newchild; } // return child at [i] T* get_child(int i){ return children[i]; } // place newchild at [i] and return the old [i] T* swap_child(int i, T* newchild){ T* p = children[i]; children[i] = newchild; return p; } }; int main(){ Octree< Octree<Block> > here; std::cout << "nothing seems to have broken" << std::endl; } Also, as for the problems with set_child, get_child and swap_child leading to possible memory leaks this will be solved as a wrapper class will either use get before set or use swap to get the old child and write this out to disk before freeing the memory itself. I am glad that it is not my memory management failing but rather another error. I have not made a copy and/or assignment operator yet as I was just testing the block tree out, I will almost certainly make them all private very soon. This version spits out -1073741819. Thank you all for your suggestions and I apologise for highjacking my own thread :$

    Read the article

  • Zend database query result converts column values to null

    - by David Zapata
    Hi again. I am using the next instructions to get some registers from my Database. Create the needed models (from the params module): $obj_paramtype_model = new Params_Model_DbTable_Paramtype(); $obj_param_model = new Params_Model_DbTable_Param(); Getting the available locales from the database // This returns a Zend_Db_Table_Row_Abstract class object $obj_paramtype = $obj_paramtype_model->getParamtypeByValue('available_locales'); // This is a query used to add conditions to the next sentence. This is executed from the Params_Model_DbTable_Param instance class, that depends from Params_Model_DbTable_Paramtype class (reference map and dependentTables arrays are fine in both classes) $obj_select = $this->select()->where('deleted_at IS NULL')->order('name'); // Execute the next query, applying the select restrictions. This returns a Zend_Db_Table_Rowset_Abstract class object. This means "Find Params by Paramtype" $obj_params_rowset = $obj_paramtype->findDependentRowset('Params_Model_DbTable_Param', 'Paramtype', $obj_paramtype); // Here the firebug log displays the queries.... Zend_Registry::get('log')->debug($obj_params_rowset); I have a profiler for all my DB executions from Zend. At this point the log and profiler objects (that includes Firebug writers), shows the executed SQL Queries, and the last line displays the resulting Zend_Db_Table_Rowset_Abstract class object. If I execute the SQL Queries in some MySQL Client, the results are as expected. But the Zend Firebug log writer displays as NULL the column values with latin characters (ñ). In other words, the external SQL client shows es_CO | Español de Colombia and en_US | English of United States but the Query results from Zend displays (and returns) es_CO | null and en_US | English of United States. I've deleted the ñ character from Español de Colombia and the query results are just fine in my Zend Log Firebug screen, and in the final Zend Form element. The MySQL database, tables and columns are in UTF-8 - utf8_unicode_ci collation. All my zend framework pages are in UTF-8 charset. I'm using XAMPP 1.7.1 (PHP 5.2.9, Apache at port 90 and MySQL 5.1.33-community) running on Windows 7 Ultimate; Zend Framework 1.10.1. I'm sorry if there is so much information, but I don't really know why could that happen, so I tryed to provide as much related information as I could to help to find some answer.

    Read the article

  • Optimizing tasks to reduce CPU in a trading application

    - by Joel
    Hello, I have designed a trading application that handles customers stocks investment portfolio. I am using two datastore kinds: Stocks - Contains unique stock name and its daily percent change. UserTransactions - Contains information regarding a specific purchase of a stock made by a user : the value of the purchase along with a reference to Stock for the current purchase. db.Model python modules: class Stocks (db.Model): stockname = db.StringProperty(multiline=True) dailyPercentChange=db.FloatProperty(default=1.0) class UserTransactions (db.Model): buyer = db.UserProperty() value=db.FloatProperty() stockref = db.ReferenceProperty(Stocks) Once an hour I need to update the database: update the daily percent change in Stocks and then update the value of all entities in UserTransactions that refer to that stock. The following python module iterates over all the stocks, update the dailyPercentChange property, and invoke a task to go over all UserTransactions entities which refer to the stock and update their value: Stocks.py # Iterate over all stocks in datastore for stock in Stocks.all(): # update daily percent change in datastore db.run_in_transaction(updateStockTxn, stock.key()) # create a task to update all user transactions entities referring to this stock taskqueue.add(url='/task', params={'stock_key': str(stock.key(), 'value' : self.request.get ('some_val_for_stock') }) def updateStockTxn(stock_key): #fetch the stock again - necessary to avoid concurrency updates stock = db.get(stock_key) stock.dailyPercentChange= data.get('some_val_for_stock') # I get this value from outside ... some more calculations here ... stock.put() Task.py (/task) # Amount of transaction per task amountPerCall=10 stock=db.get(self.request.get("stock_key")) # Get all user transactions which point to current stock user_transaction_query=stock.usertransactions_set cursor=self.request.get("cursor") if cursor: user_transaction_query.with_cursor(cursor) # Spawn another task if more than 10 transactions are in datastore transactions = user_transaction_query.fetch(amountPerCall) if len(transactions)==amountPerCall: taskqueue.add(url='/task', params={'stock_key': str(stock.key(), 'value' : self.request.get ('some_val_for_stock'), 'cursor': user_transaction_query.cursor() }) # Iterate over all transaction pointing to stock and update their value for transaction in transactions: db.run_in_transaction(updateUserTransactionTxn, transaction.key()) def updateUserTransactionTxn(transaction_key): #fetch the transaction again - necessary to avoid concurrency updates transaction = db.get(transaction_key) transaction.value= transaction.value* self.request.get ('some_val_for_stock') db.put(transaction) The problem: Currently the system works great, but the problem is that it is not scaling well… I have around 100 Stocks with 300 User Transactions, and I run the update every hour. In the dashboard, I see that the task.py takes around 65% of the CPU (Stock.py takes around 20%-30%) and I am using almost all of the 6.5 free CPU hours given to me by app engine. I have no problem to enable billing and pay for additional CPU, but the problem is the scaling of the system… Using 6.5 CPU hours for 100 stocks is very poor. I was wondering, given the requirements of the system as mentioned above, if there is a better and more efficient implementation (or just a small change that can help with the current implemntation) than the one presented here. Thanks!! Joel

    Read the article

  • How to solve Python memory leak when using urrlib2?

    - by b_m
    Hi, I'm trying to write a simple Python script for my mobile phone to periodically load a web page using urrlib2. In fact I don't really care about the server response, I'd only like to pass some values in the URL to the PHP. The problem is that Python for S60 uses the old 2.5.4 Python core, which seems to have a memory leak in the urrlib2 module. As I read there's seems to be such problems in every type of network communications as well. This bug have been reported here a couple of years ago, while some workarounds were posted as well. I've tried everything I could find on that page, and with the help of Google, but my phone still runs out of memory after ~70 page loads. Strangely the Garbege Collector does not seem to make any difference either, except making my script much slower. It is said that, that the newer (3.1) core solves this issue, but unfortunately I can't wait a year (or more) for the S60 port to come. here's how my script looks after adding every little trick I've found: import urrlib2, httplib, gc while(true): url = "http://something.com/foo.php?parameter=" + value f = urllib2.urlopen(url) f.read(1) f.fp._sock.recv=None # hacky avoidance f.close() del f gc.collect() Any suggestions, how to make it work forever without getting the "cannot allocate memory" error? Thanks for advance, cheers, b_m update: I've managed to connect 92 times before it ran out of memory, but It's still not good enough. update2: Tried the socket method as suggested earlier, this is the second best (wrong) solution so far: class UpdateSocketThread(threading.Thread): def run(self): global data while 1: url = "/foo.php?parameter=%d"%data s = socket.socket(socket.AF_INET, socket.SOCK_STREAM) s.connect(('something.com', 80)) s.send('GET '+url+' HTTP/1.0\r\n\r\n') s.close() sleep(1) I tried the little tricks, from above too. The thread closes after ~50 uploads (the phone has 50MB of memory left, obviously the Python shell has not.) UPDATE: I think I'm getting closer to the solution! I tried sending multiple data without closing and reopening the socket. This may be the key since this method will only leave one open file descriptor. The problem is: import socket s=socket.socket(socket.AF_INET, socket.SOCK_STREAM) socket.connect(("something.com", 80)) socket.send("test") #returns 4 (sent bytes, which is cool) socket.send("test") #4 socket.send("test") #4 socket.send("GET /foo.php?parameter=bar HTTP/1.0\r\n\r\n") #returns the number of sent bytes, ok socket.send("GET /foo.php?parameter=bar HTTP/1.0\r\n\r\n") #returns 0 on the phone, error on Windows7* socket.send("GET /foo.php?parameter=bar HTTP/1.0\r\n\r\n") #returns 0 on the phone, error on Windows7* socket.send("test") #returns 0, strange... *: error message: 10053, software caused connection abort Why can't I send multiple messages??

    Read the article

  • Getting Started with Maven + Jaxb project + IntellijIdea

    - by Em Ae
    I am complete new to IntellijIdea and i am looking for some step-by-step process to set up a basic project. My project depends on Maven + Jaxb classes so i need a Maven project so that when i compile this project, the JAXB Objects are generated by Maven plugins. Now i started like this I created a blank project say MaJa project Added Maven Module to it Added following settings in POM.XML <?xml version="1.0" encoding="UTF-8"?> <project xmlns="http://maven.apache.org/POM/4.0.0" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://maven.apache.org/POM/4.0.0 http://maven.apache.org/xsd/maven-4.0.0.xsd"> <modelVersion>4.0.0</modelVersion> <groupId>MaJa</groupId> <artifactId>MaJa</artifactId> <version>1.0</version> <dependencies> <dependency> <groupId>javax.xml.bind</groupId> <artifactId>jaxb-api</artifactId> </dependency> <dependency> <groupId>com.sun.xml.bind</groupId> <artifactId>jaxb-impl</artifactId> <version>2.1</version> </dependency> </dependencies> <build> <plugins> <plugin> <groupId>org.codehaus.mojo</groupId> <artifactId>jaxb2-maven-plugin</artifactId> <executions> <execution> <goals> <goal>xjc</goal> </goals> </execution> </executions> <configuration> <schemaDirectory>${basedir}/src/main/resource/api/MaJa</schemaDirectory> <packageName>com.rimt.shopping.api.web.ws.v1.model</packageName> <outputDirectory>${build.directory}</outputDirectory> </configuration> </plugin> </plugins> </build> </project> First of all, is it right settings ? I tried clicking on Make/Compile 'MaJa' from Project Right Click Menu and it didn't do anything. I will be looking forward to yoru replies.

    Read the article

  • Fleunt NHibernate not working outside of nunit test fixtures

    - by thorkia
    Okay, here is my problem... I created a Data Layer using the RTM Fluent Nhibernate. My create session code looks like this: _session = Fluently.Configure(). Database(SQLiteConfiguration.Standard.UsingFile("Data.s3db")) .Mappings( m => { m.FluentMappings.AddFromAssemblyOf<ProductMap>(); m.FluentMappings.AddFromAssemblyOf<ProductLogMap>(); }) .ExposeConfiguration(BuildSchema) .BuildSessionFactory(); When I reference the module in a test project, then create a test fixture that looks something like this: [Test] public void CanAddProduct() { var product = new Product {Code = "9", Name = "Test 9"}; IProductRepository repository = new ProductRepository(); repository.AddProduct(product); using (ISession session = OrmHelper.OpenSession()) { var fromDb = session.Get<Product>(product.Id); Assert.IsNotNull(fromDb); Assert.AreNotSame(fromDb, product); Assert.AreEqual(fromDb.Id, product.Id); } My tests pass. When I open up the created SQLite DB, the new Product with Code 9 is in it. the tables for Product and ProductLog are there. Now, when I create a new console application, and reference the same library, do something like this: Product product = new Product() {Code = "10", Name = "Hello"}; IProductRepository repository = new ProductRepository(); repository.AddProduct(product); Console.WriteLine(product.Id); Console.ReadLine(); It doesn't work. I actually get pretty nasty exception chain. To save you lots of head aches, here is the summary: Top Level exception: An invalid or incomplete configuration was used while creating a SessionFactory. Check PotentialReasons collection, and InnerException for more detail.\r\n\r\n The PotentialReasons collection is empty The Inner exception: The IDbCommand and IDbConnection implementation in the assembly System.Data.SQLite could not be found. Ensure that the assembly System.Data.SQLite is located in the application directory or in the Global Assembly Cache. If the assembly is in the GAC, use element in the application configuration file to specify the full name of the assembly. Both the unit test library and the console application reference the exact same version of System.Data.SQLite. Both projects have the exact same DLLs in the debug folder. I even tried copying SQLite DB the unit test library created into the debug directory of the console app, and removed the build schema lines and it still fails If anyone can help me figure out why this won't work outside of my unit tests it would be greatly appreciated. This crazy bug has me at a stand still.

    Read the article

  • Speeding up templates in GAE-Py by aggregating RPC calls

    - by Sudhir Jonathan
    Here's my problem: class City(Model): name = StringProperty() class Author(Model): name = StringProperty() city = ReferenceProperty(City) class Post(Model): author = ReferenceProperty(Author) content = StringProperty() The code isn't important... its this django template: {% for post in posts %} <div>{{post.content}}</div> <div>by {{post.author.name}} from {{post.author.city.name}}</div> {% endfor %} Now lets say I get the first 100 posts using Post.all().fetch(limit=100), and pass this list to the template - what happens? It makes 200 more datastore gets - 100 to get each author, 100 to get each author's city. This is perfectly understandable, actually, since the post only has a reference to the author, and the author only has a reference to the city. The __get__ accessor on the post.author and author.city objects transparently do a get and pull the data back (See this question). Some ways around this are Use Post.author.get_value_for_datastore(post) to collect the author keys (see the link above), and then do a batch get to get them all - the trouble here is that we need to re-construct a template data object... something which needs extra code and maintenance for each model and handler. Write an accessor, say cached_author, that checks memcache for the author first and returns that - the problem here is that post.cached_author is going to be called 100 times, which could probably mean 100 memcache calls. Hold a static key to object map (and refresh it maybe once in five minutes) if the data doesn't have to be very up to date. The cached_author accessor can then just refer to this map. All these ideas need extra code and maintenance, and they're not very transparent. What if we could do @prefetch def render_template(path, data) template.render(path, data) Turns out we can... hooks and Guido's instrumentation module both prove it. If the @prefetch method wraps a template render by capturing which keys are requested we can (atleast to one level of depth) capture which keys are being requested, return mock objects, and do a batch get on them. This could be repeated for all depth levels, till no new keys are being requested. The final render could intercept the gets and return the objects from a map. This would change a total of 200 gets into 3, transparently and without any extra code. Not to mention greatly cut down the need for memcache and help in situations where memcache can't be used. Trouble is I don't know how to do it (yet). Before I start trying, has anyone else done this? Or does anyone want to help? Or do you see a massive flaw in the plan?

    Read the article

< Previous Page | 379 380 381 382 383 384 385 386 387 388 389 390  | Next Page >