Search Results

Search found 33227 results on 1330 pages for 'open stackoverflow'.

Page 389/1330 | < Previous Page | 385 386 387 388 389 390 391 392 393 394 395 396  | Next Page >

  • Python - Converting CSV to Objects - Code Design

    - by victorhooi
    Hi, I have a small script we're using to read in a CSV file containing employees, and perform some basic manipulations on that data. We read in the data (import_gd_dump), and create an Employees object, containing a list of Employee objects (maybe I should think of a better naming convention...lol). We then call clean_all_phone_numbers() on Employees, which calls clean_phone_number() on each Employee, as well as lookup_all_supervisors(), on Employees. import csv import re import sys #class CSVLoader: # """Virtual class to assist with loading in CSV files.""" # def import_gd_dump(self, input_file='Gp Directory 20100331 original.csv'): # gd_extract = csv.DictReader(open(input_file), dialect='excel') # employees = [] # for row in gd_extract: # curr_employee = Employee(row) # employees.append(curr_employee) # return employees # #self.employees = {row['dbdirid']:row for row in gd_extract} # Previously, this was inside a (virtual) class called "CSVLoader". # However, according to here (http://tomayko.com/writings/the-static-method-thing) - the idiomatic way of doing this in Python is not with a class-fucntion but with a module-level function def import_gd_dump(input_file='Gp Directory 20100331 original.csv'): """Return a list ('employee') of dict objects, taken from a Group Directory CSV file.""" gd_extract = csv.DictReader(open(input_file), dialect='excel') employees = [] for row in gd_extract: employees.append(row) return employees def write_gd_formatted(employees_dict, output_file="gd_formatted.csv"): """Read in an Employees() object, and write out each Employee() inside this to a CSV file""" gd_output_fieldnames = ('hrid', 'mail', 'givenName', 'sn', 'dbcostcenter', 'dbdirid', 'hrreportsto', 'PHFull', 'PHFull_message', 'SupervisorEmail', 'SupervisorFirstName', 'SupervisorSurname') try: gd_formatted = csv.DictWriter(open(output_file, 'w', newline=''), fieldnames=gd_output_fieldnames, extrasaction='ignore', dialect='excel') except IOError: print('Unable to open file, IO error (Is it locked?)') sys.exit(1) headers = {n:n for n in gd_output_fieldnames} gd_formatted.writerow(headers) for employee in employees_dict.employee_list: # We're using the employee object's inbuilt __dict__ attribute - hmm, is this good practice? gd_formatted.writerow(employee.__dict__) class Employee: """An Employee in the system, with employee attributes (name, email, cost-centre etc.)""" def __init__(self, employee_attributes): """We use the Employee constructor to convert a dictionary into instance attributes.""" for k, v in employee_attributes.items(): setattr(self, k, v) def clean_phone_number(self): """Perform some rudimentary checks and corrections, to make sure numbers are in the right format. Numbers should be in the form 0XYYYYYYYY, where X is the area code, and Y is the local number.""" if self.telephoneNumber is None or self.telephoneNumber == '': return '', 'Missing phone number.' else: standard_format = re.compile(r'^\+(?P<intl_prefix>\d{2})\((?P<area_code>\d)\)(?P<local_first_half>\d{4})-(?P<local_second_half>\d{4})') extra_zero = re.compile(r'^\+(?P<intl_prefix>\d{2})\(0(?P<area_code>\d)\)(?P<local_first_half>\d{4})-(?P<local_second_half>\d{4})') missing_hyphen = re.compile(r'^\+(?P<intl_prefix>\d{2})\(0(?P<area_code>\d)\)(?P<local_first_half>\d{4})(?P<local_second_half>\d{4})') if standard_format.search(self.telephoneNumber): result = standard_format.search(self.telephoneNumber) return '0' + result.group('area_code') + result.group('local_first_half') + result.group('local_second_half'), '' elif extra_zero.search(self.telephoneNumber): result = extra_zero.search(self.telephoneNumber) return '0' + result.group('area_code') + result.group('local_first_half') + result.group('local_second_half'), 'Extra zero in area code - ask user to remediate. ' elif missing_hyphen.search(self.telephoneNumber): result = missing_hyphen.search(self.telephoneNumber) return '0' + result.group('area_code') + result.group('local_first_half') + result.group('local_second_half'), 'Missing hyphen in local component - ask user to remediate. ' else: return '', "Number didn't match recognised format. Original text is: " + self.telephoneNumber class Employees: def __init__(self, import_list): self.employee_list = [] for employee in import_list: self.employee_list.append(Employee(employee)) def clean_all_phone_numbers(self): for employee in self.employee_list: #Should we just set this directly in Employee.clean_phone_number() instead? employee.PHFull, employee.PHFull_message = employee.clean_phone_number() # Hmm, the search is O(n^2) - there's probably a better way of doing this search? def lookup_all_supervisors(self): for employee in self.employee_list: if employee.hrreportsto is not None and employee.hrreportsto != '': for supervisor in self.employee_list: if supervisor.hrid == employee.hrreportsto: (employee.SupervisorEmail, employee.SupervisorFirstName, employee.SupervisorSurname) = supervisor.mail, supervisor.givenName, supervisor.sn break else: (employee.SupervisorEmail, employee.SupervisorFirstName, employee.SupervisorSurname) = ('Supervisor not found.', 'Supervisor not found.', 'Supervisor not found.') else: (employee.SupervisorEmail, employee.SupervisorFirstName, employee.SupervisorSurname) = ('Supervisor not set.', 'Supervisor not set.', 'Supervisor not set.') #Is thre a more pythonic way of doing this? def print_employees(self): for employee in self.employee_list: print(employee.__dict__) if __name__ == '__main__': db_employees = Employees(import_gd_dump()) db_employees.clean_all_phone_numbers() db_employees.lookup_all_supervisors() #db_employees.print_employees() write_gd_formatted(db_employees) Firstly, my preamble question is, can you see anything inherently wrong with the above, from either a class design or Python point-of-view? Is the logic/design sound? Anyhow, to the specifics: The Employees object has a method, clean_all_phone_numbers(), which calls clean_phone_number() on each Employee object inside it. Is this bad design? If so, why? Also, is the way I'm calling lookup_all_supervisors() bad? Originally, I wrapped the clean_phone_number() and lookup_supervisor() method in a single function, with a single for-loop inside it. clean_phone_number is O(n), I believe, lookup_supervisor is O(n^2) - is it ok splitting it into two loops like this? In clean_all_phone_numbers(), I'm looping on the Employee objects, and settings their values using return/assignment - should I be setting this inside clean_phone_number() itself? There's also a few things that I'm sorted of hacked out, not sure if they're bad practice - e.g. print_employee() and gd_formatted() both use __dict__, and the constructor for Employee uses setattr() to convert a dictionary into instance attributes. I'd value any thoughts at all. If you think the questions are too broad, let me know and I can repost as several split up (I just didn't want to pollute the boards with multiple similar questions, and the three questions are more or less fairly tightly related). Cheers, Victor

    Read the article

  • Python character count

    - by user74283
    I have been going over python tutorials in this resource. Everything is pretty clear in the below code which counts number of characters. Only section that i dont understand is the section where count assigned to a list and multiplied by 120. Can anyone explain what is the purpose of this in plain english please. def display(i): if i == 10: return 'LF' if i == 13: return 'CR' if i == 32: return 'SPACE' return chr(i) infile = open('alice_in_wonderland.txt', 'r') text = infile.read() infile.close() counts = 128 * [0] for letter in text: counts[ord(letter)] += 1 outfile = open('alice_counts.dat', 'w') outfile.write("%-12s%s\n" % ("Character", "Count")) outfile.write("=================\n") for i in range(len(counts)): if counts[i]: outfile.write("%-12s%d\n" % (display(i), counts[i])) outfile.close()

    Read the article

  • IE 8 dialog windows not decompressing files

    - by Mike
    Hi, I've got a website where we have pre-compressed all of our HTML files. In general this works fine, but since IE 8 has come out some people are finding that they can not use some parts of the website. We've used the showModalDialog command to open a dialog window and pointing to one of our pre-compressed files but it displays it just show up as strange characters (ie not decompressed). Now it only happens in the dialog. I'm pretty sure our compression is all fine because the page they are viewing to open the dialog is also compressed. Has anyone else come across this or got any suggestions cuz i'm stumped??? Thanks, Mike

    Read the article

  • Create an assembly in memory

    - by Jared I
    I'd like to create an assembly in memory, using an using the classes in Reflection.Emit Currently, I can create the assembly and get it's bytes using something like AssemblyBuilder builder = AppDomain.CurrentDomain.DefineDynamicAssembly(..., AssemblyBuilderAccess.Save); ... create the assembly ... builder.Save(targetFileName); using(FileStream fs = File.Open(targetFileName, FileMode.Open)) { ... read the bytes from the file stream ... } However, it does so by creating a file on the local filesystem. I don't actually need the file, just the bytes that would be in the file. Is it possible to create the assembly without writing any files?

    Read the article

  • Cocoa AppKit - Dismissing a modal window (i.e. popup or contextual menu) and pressing the button cu

    - by hishamk
    Basically I want to create the effect of that provided in the system's menu bar. A user presses on one of the menu headings, and as he moves across the different headings, the menus open up automatically. The snag is that if I open a pop-up menu for a button, the user has to click again to dismiss it. The entire runloop is on hold as I believe the pop-up menu is modal. How do I go about being able to send a [somePopUpMenu cancelTracking] when the user moves to the next button? Cheers

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • virtual machines and cryptography

    - by Unknown
    I suspect I'm a bit offtopic with the site mission, but it seems me more fitting for the question than stackoverflow i'm in preparing to create a vm with sensible data (personal use, it will be a web+mail+... appliance of sorts), i'd like to protect the data even with cryptography; the final choice have to be cross-platform for the host basically, I have to choose between guest system-level cryptography (say, dm-crypt or similar) or host level cryptography with truecrypt. do you think that the "truecrypt-volume contained virtualized disks" approach will hit the i/o performance of the vm badly (and therefore dm-crypt like approaches into the vm would be better), or is it doable? I'd like to protect all the guest data, not only my personal data, to be able to suspend the vm freely without worrying for the swap partition, etc

    Read the article

  • SharePoint 2010 is forcing me to safe PDF when opening from doc library

    - by Tobias Funke
    I have a document library with a PDF file. Whenever I click on the PDF file, I am prompted to save the file. I do not get the option of opening the file, I am forced to save it. What I want is for the PDF file to open, either in the browser or in a separate Adobe Reader window, depending on the Adobe Reader settings. I'm pretty sure SharePoint is responsible for this behavior, because if I put the PDF on my hard drive, then create a HTML file with a link to the file, it opens in the browser when I click on it. Please note: I looked at this question and did not help. I don't care if the PDF opens in the browser or in a separate Adobe Reader window, I just want it to open.

    Read the article

  • How can I load a file into a DataBag from within a Yahoo PigLatin UDF?

    - by Cervo
    I have a Pig program where I am trying to compute the minimum center between two bags. In order for it to work, I found I need to COGROUP the bags into a single dataset. The entire operation takes a long time. I want to either open one of the bags from disk within the UDF, or to be able to pass another relation into the UDF without needing to COGROUP...... Code: # **** Load files for iteration **** register myudfs.jar; wordcounts = LOAD 'input/wordcounts.txt' USING PigStorage('\t') AS (PatentNumber:chararray, word:chararray, frequency:double); centerassignments = load 'input/centerassignments/part-*' USING PigStorage('\t') AS (PatentNumber: chararray, oldCenter: chararray, newCenter: chararray); kcenters = LOAD 'input/kcenters/part-*' USING PigStorage('\t') AS (CenterID:chararray, word:chararray, frequency:double); kcentersa1 = CROSS centerassignments, kcenters; kcentersa = FOREACH kcentersa1 GENERATE centerassignments::PatentNumber as PatentNumber, kcenters::CenterID as CenterID, kcenters::word as word, kcenters::frequency as frequency; #***** Assign to nearest k-mean ******* assignpre1 = COGROUP wordcounts by PatentNumber, kcentersa by PatentNumber; assignwork2 = FOREACH assignpre1 GENERATE group as PatentNumber, myudfs.kmeans(wordcounts, kcentersa) as CenterID; basically my issue is that for each patent I need to pass the sub relations (wordcounts, kcenters). In order to do this, I do a cross and then a COGROUP by PatentNumber in order to get the set PatentNumber, {wordcounts}, {kcenters}. If I could figure a way to pass a relation or open up the centers from within the UDF, then I could just GROUP wordcounts by PatentNumber and run myudfs.kmeans(wordcount) which is hopefully much faster without the CROSS/COGROUP. This is an expensive operation. Currently this takes about 20 minutes and appears to tack the CPU/RAM. I was thinking it might be more efficient without the CROSS. I'm not sure it will be faster, so I'd like to experiment. Anyway it looks like calling the Loading functions from within Pig needs a PigContext object which I don't get from an evalfunc. And to use the hadoop file system, I need some initial objects as well, which I don't see how to get. So my question is how can I open a file from the hadoop file system from within a PIG UDF? I also run the UDF via main for debugging. So I need to load from the normal filesystem when in debug mode. Another better idea would be if there was a way to pass a relation into a UDF without needing to CROSS/COGROUP. This would be ideal, particularly if the relation resides in memory.. ie being able to do myudfs.kmeans(wordcounts, kcenters) without needing the CROSS/COGROUP with kcenters... But the basic idea is to trade IO for RAM/CPU cycles. Anyway any help will be much appreciated, the PIG UDFs aren't super well documented beyond the most simple ones, even in the UDF manual.

    Read the article

  • An unhandled exception of type 'System.StackOverflowException' occurred in mscorlib.dll

    - by Sahar
    Hello everybody i wrote a code in asp.net that read data from files and draw a graph. It worked but after awhile when i run the program, this exception arise "An unhandled exception of type 'System.StackOverflowException' occurred in mscorlib.dll" in this statement in the code: if (File.Exists(fName)) <----(here is the exception) { stream = File.Open(fName, FileMode.Open); g_day = Deserialize(stream); stream.Close(); int cn = 0; if (g_day.Values.Count != 0) cn = g_day.Values[g_day.Values.Count - 1].Value; Label1.Text = cn.ToString(); } can u help me

    Read the article

  • Upload and parse csv file with "universal newline" in python on Google App Engine

    - by greg
    Hi, I'm uploading a csv/tsv file from a form in GAE, and I try to parse the file with python csv module. Like describe here, uploaded files in GAE are strings. So I treat my uploaded string a file-like object : file = self.request.get('catalog') catalog = csv.reader(StringIO.StringIO(file),dialect=csv.excel_tab) But new lines in my files are not necessarily '\n' (thanks to excel..), and it generated an error : Error: new-line character seen in unquoted field - do you need to open the file in universal-newline mode? Does anyone know how to use StringIO.StringIO to treat strings like files open in universal-newline?

    Read the article

  • Cloud services, Public IPs and SIP

    - by Guido N
    I'm trying to run a custom SIP software (which uses JAIN SIP 1.2) on a cloud box. What I'd really like is to have a real public IP aka which is listed by "ifconfig -a" command. This is because atm I don't want to write additional SIP code / add a SIP proxy in order to manage private IP addresses / address translation. I gave Amazon EC2 a go, but as reported here http://stackoverflow.com/questions/10013549/sip-and-ec2-elastic-ips it's not fit for purpose (they do a 1:1 NAT translation between the private IP of the box and its Elastic IP). Does anyone know of a cloud service that provides real static public IP addresses?

    Read the article

  • Posting an action works... but no image

    - by Brian Rice
    I'm able to post an open graph action to facebook using the following url: https://graph.facebook.com/me/video.watches with the following post data: video=http://eqnetwork.com/home/video.html?f=8e7b4f27-8cbd-4430-84df-d9ccb46da45f.mp4 It seems to be getting the title from the open graph metatags at the "video" object. But, it's not getting the image (even though one is specified in the metatag "og:image"). Also, if I add this to the post data: picture=http://eqnetwork.com/icons/mgen/overplayThumbnail.ms?drid=14282&subType=ljpg&w=120&h=120&o=1&thumbnail= still no image. Any thoughts? Brian

    Read the article

  • post data to a thickbox using ajax

    - by sqlchild
    I need to post data to a thickbox using ajax and open it immediately and display the posted data. The user would click on a link/button and the data i.e. value of the selected checkboxes would be posted to "my_thickbox.php" and the thickbox (url : my_thickbox.php) would open with checkbox values displayed. <div id="showthickbox" ><a href="my_thickbox.php" class="thickbox"></div> $('#showthickbox').click(function() { var data = $('input:checkbox:checked').map(function() { return this.value; }).get(); $.ajax({ type: 'POST', url: 'my_thickbox.php', data: data, success: success, dataType: dataType }); });

    Read the article

  • Access Denied Java FileWriter / FileInputStream

    - by Matt
    My program downloads a websites source code, modifies it, creates the file, and then reuploads it through the FTP. However, I receive the following error when trying to open the created file: java.io.FileNotFoundException: misc.html (Access is denied) at java.io.FileInputStream.open(Native Method) at java.io.FileInputStream.<init>(Unknown Source) at Manipulator.uploadSource(Manipulator.java:63) at Start.addPicture(Start.java:130) at Start$2.actionPerformed(Start.java:83) at javax.swing.AbstractButton.fireActionPerformed(Unknown Source) at javax.swing.AbstractButton$Handler.actionPerformed(Unknown Source) at javax.swing.DefaultButtonModel.fireActionPerformed(Unknown Source) at javax.swing.DefaultButtonModel.setPressed(Unknown Source) at javax.swing.plaf.basic.BasicButtonListener.mouseReleased(Unknown Source) at java.awt.Component.processMouseEvent(Unknown Source) at javax.swing.JComponent.processMouseEvent(Unknown Source) at java.awt.Component.processEvent(Unknown Source) at java.awt.Container.processEvent(Unknown Source) at java.awt.Component.dispatchEventImpl(Unknown Source) at java.awt.Container.dispatchEventImpl(Unknown Source) at java.awt.Component.dispatchEvent(Unknown Source) at java.awt.LightweightDispatcher.retargetMouseEvent(Unknown Source) at java.awt.LightweightDispatcher.processMouseEvent(Unknown Source) at java.awt.LightweightDispatcher.dispatchEvent(Unknown Source) at java.awt.Container.dispatchEventImpl(Unknown Source) at java.awt.Window.dispatchEventImpl(Unknown Source) at java.awt.Component.dispatchEvent(Unknown Source) at java.awt.EventQueue.dispatchEvent(Unknown Source) at java.awt.EventDispatchThread.pumpOneEventForFilters(Unknown Source) at java.awt.EventDispatchThread.pumpEventsForFilter(Unknown Source) at java.awt.EventDispatchThread.pumpEventsForHierarchy(Unknown Source) at java.awt.EventDispatchThread.pumpEvents(Unknown Source) at java.awt.EventDispatchThread.pumpEvents(Unknown Source) at java.awt.EventDispatchThread.run(Unknown Source) When I navigate to the folder directory and attempt to open "misc.html" with Notepad I receive Access is Denied. My code is fairly simple: File f = new File(page.sourceFileName); try { FileWriter out = new FileWriter(f); out.write(page.source); out.close(); } catch (IOException e) { e.printStackTrace(); } InputStream input = new FileInputStream(f); This is the vital excerpt from my program. I have copied this into a different test program and it works fine, I create a misc.html file and reopen it with both FileInputStream and manually. I would be worried about Administrator rights but the Test program works fine when I run it RIGHT after the problem program. I also have checked if the file exists and is a file with File methods and it is as well. Is this a result of me not closing a previous Input/Output properly? I've tried to check everything and I am fairly positive I close all streams as soon as they finish... Help! :)

    Read the article

  • Problem extracting text from RSS feeds

    - by Gautam
    Hi, I am new to the world of Ruby and Rails. I have seen rails cast 190 and I just started playing with it. I used selector gadget to find out the CSS and XPath I have the following code.. require 'rubygems' require 'nokogiri' require 'open-uri' url = "http://www.telegraph.co.uk/sport/football/rss" doc = Nokogiri::HTML(open(url)) doc.xpath('//a').each do |paragraph| puts paragraph.text end When I extracted text from a normal HTML page with css, I could get the extracted text on the console. But when I try to do the same either with CSS or XPath for the RSS Feed for the following URL mentioned in the code above, I dont get any output. How do you extract text from RSS feeds?? I also have another silly question. Is there a way to extract text from 2 different feeds and display it on the console something like url1 = "http://www.telegraph.co.uk/sport/football/rss" url2 = "http://www.telegraph.co.uk/sport/cricket/rss" Looking forward for your help and suggestions Thank You Gautam

    Read the article

  • What's wrong with this SQL Server query ?

    - by ClixNCash
    What's wrong this T-SQL query : Protected Sub Button1_Click(ByVal sender As Object, ByVal e As System.EventArgs) Handles Button1.Click Dim SQLData As New System.Data.SqlClient.SqlConnection("Data Source=.\SQLEXPRESS;AttachDbFilename=|DataDirectory|\Database.mdf;Integrated Security=True;User Instance=True") Dim cmdSelect As New System.Data.SqlClient.SqlCommand("SELECT COUNT(*) FROM Table1 WHERE Name ='" + TextBox1.Text + "'", SQLData) SQLData.Open() If cmdSelect.ExecuteScalar > 0 Then Label1.Text = "You have already voted this service" Return End If Dim con As New SqlConnection Dim cmd As New SqlCommand con.Open() cmd.Connection = con cmd.CommandText = "INSERT INTO Tabel1 (Name) VALUES('" & Trim(Label1.Text) & "')" cmd.ExecuteNonQuery() Label1.Text = "Thank You !" SQLData.Close() End Sub

    Read the article

  • Reading a file with a supplied name in C++

    - by Cosmina
    I must read a file with a given name (it's caled "hamlet.txt"). The class used to read the file is defined like this #ifndef READWORDS_H #define READWORDS_H /** * ReadWords class. Provides mechanisms to read a text file, and return * capitalized words from that file. */ using namespace std; #include <string> #include <fstream> class ReadWords { public: /** * Constructor. Opens the file with the default name "text.txt". * Program exits with an error message if the file does not exist. */ ReadWords(); /** * Constructor. Opens the file with the given filename. * Program exits with an error message if the file does not exist. * @param filename - a C string naming the file to read. */ ReadWords(char *filename); My definition of the members of the classis this: #include<string> #include<fstream> #include<iostream> #include "ReadWords.h" using namespace std; ReadWords::ReadWords() { wordfile.open("text.txt"); if( !wordfile ) { cout<<"Errors while opening the file!"<<endl; } } ReadWords::ReadWords(char *filename) { wordfile.open(filename); if ( !wordfile ) { cout<<"Errors while opening the file!"<<endl; } wordfile>>nextword; } And the main to test it. using namespace std; #include #include #include "ReadWords.h" int main() { char name[30]; cout<<"Please input a name for the file that you wish to open"; cin>>name; ReadWords x( name[] ); } When I complie it gives me the error: main.cpp:14: error: expected primary-expression before ']' token I know it's got something to do with the function ReadWords( char *filename), but I do not know what. Any help please?

    Read the article

  • Jqm is not a function

    - by kris
    Hi all, I'm having some trouble with Jquery and JqModal, and I hope you are able to help, since I've been struggling for hours.. Having a single button element with an onclick action running my method "test" (shown below): $('#picture_form').jqm({ajax: '/test.php'}); $('#picture_form').jqmShow(); This will load the ajax content of test.php into my div element picture_form, shown using JqModal as its supposed to! Though when I close this window, and re-clicks the button I'm getting the error: $("#picture_form").jqm is not a function. As a solution I've tried to use the JqModal trigger function, and this leaves me able to open and close the JqModal windows as many times as I want to. Sadly I can only call the 'trigger' using test environment, in my production code I have to open the JqModal window using a function.. Does anyone have a clue why this 'bug' appears when calling the opening when using a function? Thanks in advance

    Read the article

  • VB6 ADODB Fails with SQL Compact: Multipe-Step operation generated errors

    - by Belliez
    Hi, I am converting an old application to use SQL Compact database (it works ok with SQ Server 2005 and 2008) and using the following code gives an error when attempting to execute a simple select command: Private Const mSqlProvider As String = "Provider=Microsoft.SQLSERVER.CE.OLEDB.3.5;" Private Const mSqlHost As String = "Data Source=C:\database.sdf;" Private mCmd As ADODB.Command ' For executing SQL' Private mDbConnection As ADODB.Connection Private Sub Command1_Click() Dim DbConnectionString As String DbConnectionString = mSqlProvider & _ mSqlHost Set mDbConnection = New ADODB.Connection mDbConnection.CursorLocation = adUseClient Call mDbConnection.Open(DbConnectionString) If mDbConnection.State = adStateOpen Then Debug.Print (" Database is open") ' Initialise the command object' Set mCmd = New ADODB.Command mCmd.ActiveConnection = mDbConnection End If mCmd.CommandText = "select * from myTable" mCmd.CommandType = adCmdText mCmd.Execute ' FAILS HERE! ' End Sub I have referenced Microsoft ActiveX Data Access Object 6.0 Library in the project. The error I get is: Run-Time error -2147217887 (80040e21) Multipe-Step operation generated errors. Check each status value Just wondering if anyone has any suggestions? Thanks

    Read the article

  • Algorithmic trading software safety guards

    - by Adal
    I'm working on an automatic trading system. What sorts of safe-guards should I have in place? The main idea I have is to have multiple pieces checking each other. I will have a second independent little process which will also connect to the same trading account and monitor simple things, like ensuring the total net position does not go over a certain limit, or that there are no more than N orders in 10 minutes for example, or more than M positions open simultaneously. You can also check that the actual open positions correspond to what the strategy process thinks it actually holds. As a bonus I could run this checker process on a different machine/network provider. Besides the checks in the main strategy, this will ensure that whatever weird bug occurs, nothing really bad can happen. Any other things I should monitor and be aware of?

    Read the article

  • Web service reference location?

    - by Damien Dennehy
    I have a Visual Studio 2008 solution that's currently consisting of three projects: A DataFactory project for Business Logic/Data Access. A Web project consisting of the actual user interface, pages, controls, etc. A Web.Core project consisting of utility classes, etc. The application requires consuming a web service. Normally I'd add the service reference to the Web project, but I'm not sure if this is best practice or not. The following options are open to me: Add the reference to the Web project. Add the reference to the Web.Core project, and create a wrapper method that Web will call to consume the web service. Add a new project called Web.Services, and copy step 2. This project is expected to increase in size so I'm open to any suggestions.

    Read the article

< Previous Page | 385 386 387 388 389 390 391 392 393 394 395 396  | Next Page >