Search Results

Search found 33227 results on 1330 pages for 'open stackoverflow'.

Page 390/1330 | < Previous Page | 386 387 388 389 390 391 392 393 394 395 396 397  | Next Page >

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Reading a file with a supplied name in C++

    - by Cosmina
    I must read a file with a given name (it's caled "hamlet.txt"). The class used to read the file is defined like this #ifndef READWORDS_H #define READWORDS_H /** * ReadWords class. Provides mechanisms to read a text file, and return * capitalized words from that file. */ using namespace std; #include <string> #include <fstream> class ReadWords { public: /** * Constructor. Opens the file with the default name "text.txt". * Program exits with an error message if the file does not exist. */ ReadWords(); /** * Constructor. Opens the file with the given filename. * Program exits with an error message if the file does not exist. * @param filename - a C string naming the file to read. */ ReadWords(char *filename); My definition of the members of the classis this: #include<string> #include<fstream> #include<iostream> #include "ReadWords.h" using namespace std; ReadWords::ReadWords() { wordfile.open("text.txt"); if( !wordfile ) { cout<<"Errors while opening the file!"<<endl; } } ReadWords::ReadWords(char *filename) { wordfile.open(filename); if ( !wordfile ) { cout<<"Errors while opening the file!"<<endl; } wordfile>>nextword; } And the main to test it. using namespace std; #include #include #include "ReadWords.h" int main() { char name[30]; cout<<"Please input a name for the file that you wish to open"; cin>>name; ReadWords x( name[] ); } When I complie it gives me the error: main.cpp:14: error: expected primary-expression before ']' token I know it's got something to do with the function ReadWords( char *filename), but I do not know what. Any help please?

    Read the article

  • Upload and parse csv file with "universal newline" in python on Google App Engine

    - by greg
    Hi, I'm uploading a csv/tsv file from a form in GAE, and I try to parse the file with python csv module. Like describe here, uploaded files in GAE are strings. So I treat my uploaded string a file-like object : file = self.request.get('catalog') catalog = csv.reader(StringIO.StringIO(file),dialect=csv.excel_tab) But new lines in my files are not necessarily '\n' (thanks to excel..), and it generated an error : Error: new-line character seen in unquoted field - do you need to open the file in universal-newline mode? Does anyone know how to use StringIO.StringIO to treat strings like files open in universal-newline?

    Read the article

  • SSL confirmation dialog popup auto closes in IE8 when re-accessing a JNLP file

    - by haylem
    I'm having this very annoying problem to troubleshoot and have been going at it for way too many days now, so have a go at it. The Environment We have 2 app-servers, which can be located on either the same machine or 2 different machines, and use the same signing certificate, and host 2 different web-apps. Though let's say, for the sake of our study case here, that they are on the same physical machine. So, we have: https://company.com/webapp1/ https://company.com/webapp2/ webapp1 is GWT-based rich-client which contains on one of its screens a menu with an item that is used to invoke a Java WebStart Client located on webapp2. It does so by performing a simple window.open call via this GWT call: Window.open("https://company.com/webapp2/app.jnlp", "_blank", null); Expected Behavior User merrilly goes to webapp1 User navigates to menu entry to start the WebStart app and clicks on it browser fires off a separate window/dialog which, depending on the browser and its security settings, will: request confirmation to navigate to this secure site, directly download the file, and possibly auto-execute a javaws process if there's a file association, otherwise the user can simply click on the file and start the app (or go about doing whatever it takes here). If you close the app, close the dialog, and re-click the menu entry, the same thing should happen again. Actual Behavior On Anything but God-forsaken IE 8 (Though I admit there's also all the god-forsaken pre-IE8 stuff, but the Requirements Lords being merciful we have already recently managed to make them drop these suckers. That was close. Let's hold hands and say a prayer of gratitude.) Stuff just works. JNLP gets downloaded, app executes just fine, you can close the app and re-do all the steps and it will restart happily. People rejoice. Puppies are safe and play on green hills in the sunshine. Developers can go grab a coffee and move on to more meaningful and rewarding tasks, like checking out on SO questions. Chrome doesn't want to execute the JNLP, but who cares? Customers won't get RSI from clicking a file every other week. On God-forsaken IE8 On the first visit, the dialog opens and requests confirmation for the user to continue to webapp2, though it could be unsafe (here be dragons, I tell you). The JNLP downloads and auto-opens, the app start. Your breathing is steady and slow. You close the app, close that SSL confirmation dialog, and re-click the menu entry. The dialog opens and auto-closes. Nothing starts, the file wasn't downloaded to any known location and Fiddler just reports the connection was closed. If you close IE and reach that menu item to click it again, it is now back to working correctly. Until you try again during the same session, of course. Your heart-rate goes up, you get some more coffee to make matters worse, and start looking for plain tickets online and a cheap but heavy golf-club on an online auction site to go clubbing baby polar seals to avenge your bloodthirst, as the gates to the IE team in Redmond are probably more secured than an ice block, as one would assume they get death threats often. Plus, the IE9 and IE10 teams are already hard at work fxing the crap left by their predecessors, so maybe you don't want to be too hard on them, and you don't have money to waste on a PI to track down the former devs responsible for this mess. Added Details I have come across many problems with IE8 not downloading files over SSL when it uses a no-cache header. This was indeed one of our problems, which seems to be worked out now. It downloads files fine, webapp2 uses the following headers to serve the JNLP file: response.setHeader("Cache-Control", "private, must-revalidate"); // IE8 happy response.setHeader("Pragma", "private"); // IE8 happy response.setHeader("Expires", "0"); // IE8 happy response.setHeader("Access-Control-Allow-Origin", "*"); // allow to request via cross-origin AJAX response.setContentType("application/x-java-jnlp-file"); // please exec me As you might have inferred, we get some confirmation dialog because there's something odd with the SSL certificate. Unfortunately I have no control over that. Assuming that's only temporary and for development purposes as we usually don't get our hands on the production certs. So the SSL cert is expired and doesn't specify the server. And the confirmation dialog. Wouldn't be that bad if it weren't for IE, as other browsers don't care, just ask for confirmation, and execute as expected and consistantly. Please, pretty please, help me, or I might consider sacrificial killings as an option. And I think I just found a decently prized stainless steel golf-club, so I'm right on the edge of gore. Side Notes Might actually be related to IE8 window.open SSL Certificate issue. Though it doesn't explain why the dialog would auto-close (that really is beyong me...), it could help to not have the confirmation dialog and not need the dialog at all. For instance, I was thinking that just having a simple URL in that menu instead of have it entirely managed by GWT code to invoke a Window.open would solve the problem. But I don't have control on that menu, and also I'm very curious how this could be fixed otherwise and why the hell it happens in the first place...

    Read the article

  • How can I load a file into a DataBag from within a Yahoo PigLatin UDF?

    - by Cervo
    I have a Pig program where I am trying to compute the minimum center between two bags. In order for it to work, I found I need to COGROUP the bags into a single dataset. The entire operation takes a long time. I want to either open one of the bags from disk within the UDF, or to be able to pass another relation into the UDF without needing to COGROUP...... Code: # **** Load files for iteration **** register myudfs.jar; wordcounts = LOAD 'input/wordcounts.txt' USING PigStorage('\t') AS (PatentNumber:chararray, word:chararray, frequency:double); centerassignments = load 'input/centerassignments/part-*' USING PigStorage('\t') AS (PatentNumber: chararray, oldCenter: chararray, newCenter: chararray); kcenters = LOAD 'input/kcenters/part-*' USING PigStorage('\t') AS (CenterID:chararray, word:chararray, frequency:double); kcentersa1 = CROSS centerassignments, kcenters; kcentersa = FOREACH kcentersa1 GENERATE centerassignments::PatentNumber as PatentNumber, kcenters::CenterID as CenterID, kcenters::word as word, kcenters::frequency as frequency; #***** Assign to nearest k-mean ******* assignpre1 = COGROUP wordcounts by PatentNumber, kcentersa by PatentNumber; assignwork2 = FOREACH assignpre1 GENERATE group as PatentNumber, myudfs.kmeans(wordcounts, kcentersa) as CenterID; basically my issue is that for each patent I need to pass the sub relations (wordcounts, kcenters). In order to do this, I do a cross and then a COGROUP by PatentNumber in order to get the set PatentNumber, {wordcounts}, {kcenters}. If I could figure a way to pass a relation or open up the centers from within the UDF, then I could just GROUP wordcounts by PatentNumber and run myudfs.kmeans(wordcount) which is hopefully much faster without the CROSS/COGROUP. This is an expensive operation. Currently this takes about 20 minutes and appears to tack the CPU/RAM. I was thinking it might be more efficient without the CROSS. I'm not sure it will be faster, so I'd like to experiment. Anyway it looks like calling the Loading functions from within Pig needs a PigContext object which I don't get from an evalfunc. And to use the hadoop file system, I need some initial objects as well, which I don't see how to get. So my question is how can I open a file from the hadoop file system from within a PIG UDF? I also run the UDF via main for debugging. So I need to load from the normal filesystem when in debug mode. Another better idea would be if there was a way to pass a relation into a UDF without needing to CROSS/COGROUP. This would be ideal, particularly if the relation resides in memory.. ie being able to do myudfs.kmeans(wordcounts, kcenters) without needing the CROSS/COGROUP with kcenters... But the basic idea is to trade IO for RAM/CPU cycles. Anyway any help will be much appreciated, the PIG UDFs aren't super well documented beyond the most simple ones, even in the UDF manual.

    Read the article

  • Proxy calls across a DMZ

    - by John
    We need to determine a quick way for our web application deployed in a DMZ to communicate to our SQL server that lives in the protected network. Only port 80 is open and available, and no direct SQL traffic is allowed across the firewall. So take the following simple system. A web page (default.aspx) makes a call (string GetData()) that resides in an assembly (Simple.DLL). GetData() uses ADO.NET to open a connection, execute a SQL call, retrieve the data, and return the data to the caller. However, since only port 80 is available and no SQL traffic is allowed, what could we do to accomplish our goal? I believe a .NET remoting solution would work, and I have heard of an architecture where a remoting layer proxies the call from Simple.DLL in the DMZ to another Simple.DLL that runs on the protected side. The remoting layer handles the communication between the two DLL’s. Can someone shed some light on how WCF/remoting can help us and how to get started with a solution?

    Read the article

  • NetBeans ("6.8" and "later") - UML support?

    - by Petike
    Hello, I wanted to download the "UML plugin" to NetBeans through the "Tools/Plugins" but I didn't find the plugin there. Then I read in many articles that the "NetBeans UML plugin is not supported anymore" :-( . Then I discovered that there exists some "NetBeans SDE" tool that supports the UML in NetBeans and there exists the "Comunity Edition" of that tool which is free, but only for "non-commercial" uses - so it's not open-source - and so I don't want to use it. So I would like to ask, if Sun (or whoever else who officially maintains (or maintained in the past) the NetBeans UML plugin) is not going to support the UML plugin to NetBeans anymore and if so, is there any "open-source" UML plugin which is supported in version "6.8" and "later" and if so - which? Thank you.

    Read the article

  • JSF HIBERNATE POSTGRESQL

    - by user312619
    When I press "Save" button I get an exception like that ; javax.servlet.ServletException: org.hibernate.exception.JDBCConnectionException: Cannot open connection javax.faces.webapp.FacesServlet.service(FacesServlet.java:325) root cause javax.faces.el.EvaluationException: org.hibernate.exception.JDBCConnectionException: Cannot open connection javax.faces.component.MethodBindingMethodExpressionAdapter.invoke(MethodBindingMethodExpressionAdapter.java:102) com.sun.faces.application.ActionListenerImpl.processAction(ActionListenerImpl.java:102) javax.faces.component.UICommand.broadcast(UICommand.java:315) javax.faces.component.UIViewRoot.broadcastEvents(UIViewRoot.java:775) javax.faces.component.UIViewRoot.processApplication(UIViewRoot.java:1267) com.sun.faces.lifecycle.InvokeApplicationPhase.execute(InvokeApplicationPhase.java:82) com.sun.faces.lifecycle.Phase.doPhase(Phase.java:101) com.sun.faces.lifecycle.LifecycleImpl.execute(LifecycleImpl.java:118) javax.faces.webapp.FacesServlet.service(FacesServlet.java:312) root cause org.hibernate.exception.JDBCConnectionException: Cannot open connection org.hibernate.exception.SQLStateConverter.convert(SQLStateConverter.java:98) org.hibernate.exception.JDBCExceptionHelper.convert(JDBCExceptionHelper.java:66) org.hibernate.exception.JDBCExceptionHelper.convert(JDBCExceptionHelper.java:52) org.hibernate.jdbc.ConnectionManager.openConnection(ConnectionManager.java:449) org.hibernate.jdbc.ConnectionManager.getConnection(ConnectionManager.java:167) org.hibernate.jdbc.JDBCContext.connection(JDBCContext.java:142) org.hibernate.transaction.JDBCTransaction.begin(JDBCTransaction.java:85) org.hibernate.impl.SessionImpl.beginTransaction(SessionImpl.java:1463) sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) java.lang.reflect.Method.invoke(Unknown Source) org.hibernate.context.ThreadLocalSessionContext$TransactionProtectionWrapper.invoke(ThreadLocalSessionContext.java:344) $Proxy108.beginTransaction(Unknown Source) com.yemex.beans.CompanyBean.saveOrUpdate(CompanyBean.java:52) sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) java.lang.reflect.Method.invoke(Unknown Source) org.apache.el.parser.AstValue.invoke(AstValue.java:196) org.apache.el.MethodExpressionImpl.invoke(MethodExpressionImpl.java:276) com.sun.faces.facelets.el.TagMethodExpression.invoke(TagMethodExpression.java:98) javax.faces.component.MethodBindingMethodExpressionAdapter.invoke(MethodBindingMethodExpressionAdapter.java:88) com.sun.faces.application.ActionListenerImpl.processAction(ActionListenerImpl.java:102) javax.faces.component.UICommand.broadcast(UICommand.java:315) javax.faces.component.UIViewRoot.broadcastEvents(UIViewRoot.java:775) javax.faces.component.UIViewRoot.processApplication(UIViewRoot.java:1267) com.sun.faces.lifecycle.InvokeApplicationPhase.execute(InvokeApplicationPhase.java:82) com.sun.faces.lifecycle.Phase.doPhase(Phase.java:101) com.sun.faces.lifecycle.LifecycleImpl.execute(LifecycleImpl.java:118) javax.faces.webapp.FacesServlet.service(FacesServlet.java:312) root cause java.sql.SQLException: No suitable driver found for jdbc:postgresql://localhost/postgres java.sql.DriverManager.getConnection(Unknown Source) java.sql.DriverManager.getConnection(Unknown Source) org.hibernate.connection.DriverManagerConnectionProvider.getConnection(DriverManagerConnectionProvider.java:133) org.hibernate.jdbc.ConnectionManager.openConnection(ConnectionManager.java:446) org.hibernate.jdbc.ConnectionManager.getConnection(ConnectionManager.java:167) org.hibernate.jdbc.JDBCContext.connection(JDBCContext.java:142) org.hibernate.transaction.JDBCTransaction.begin(JDBCTransaction.java:85) org.hibernate.impl.SessionImpl.beginTransaction(SessionImpl.java:1463) sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) java.lang.reflect.Method.invoke(Unknown Source) org.hibernate.context.ThreadLocalSessionContext$TransactionProtectionWrapper.invoke(ThreadLocalSessionContext.java:344) $Proxy108.beginTransaction(Unknown Source) com.yemex.beans.CompanyBean.saveOrUpdate(CompanyBean.java:52) sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) java.lang.reflect.Method.invoke(Unknown Source) org.apache.el.parser.AstValue.invoke(AstValue.java:196) org.apache.el.MethodExpressionImpl.invoke(MethodExpressionImpl.java:276) com.sun.faces.facelets.el.TagMethodExpression.invoke(TagMethodExpression.java:98) javax.faces.component.MethodBindingMethodExpressionAdapter.invoke(MethodBindingMethodExpressionAdapter.java:88) com.sun.faces.application.ActionListenerImpl.processAction(ActionListenerImpl.java:102) javax.faces.component.UICommand.broadcast(UICommand.java:315) javax.faces.component.UIViewRoot.broadcastEvents(UIViewRoot.java:775) javax.faces.component.UIViewRoot.processApplication(UIViewRoot.java:1267) com.sun.faces.lifecycle.InvokeApplicationPhase.execute(InvokeApplicationPhase.java:82) com.sun.faces.lifecycle.Phase.doPhase(Phase.java:101) com.sun.faces.lifecycle.LifecycleImpl.execute(LifecycleImpl.java:118) javax.faces.webapp.FacesServlet.service(FacesServlet.java:312)

    Read the article

  • which control in vs08 aspx c# will be able to take html tags as input and display it formatted accor

    - by user287745
    i asked a few questions regarding this and got answers that indicate i will have to make an costum build editor using ,markdown, .... to achieve something like stackoverflow.com/questions/ask page. there is time limitation and the requirements are that much, i have to achieve 1) allow users to using html tags when giving input 2) save that complete input to sql db 3) display the data in db withing a contol which renders the formatting as the tags specify. i am aware label and literal controls support html tags, the problem is how to allow the user to input the textbox does not seem the support html tags? thank you Need help in implementing the affect of the WRITE A NEW POST On stackoverflow.com <%--The editor--% <asp:UpdatePanel ID="UpdatePanel7" runat="server"> <ContentTemplate> <asp:Label ID="Label4" runat="server" Text="Label"></asp:Label> <div id="textchanging" onkeyup="textoftextbox('TextBox3'); return false;"> <asp:TextBox ID="TextBox3" runat="server" CausesValidation="True" ></asp:TextBox> </div> <%-- OnTextChanged="textoftextbox('TextBox3'); return false;" gives too man literals error. --%> <asp:Button ID="Button6" runat="server" Text="Post The Comment, The New, Write on Wall" onclick="Button6_Click" /> <asp:Label ID="Label2" runat="server" Text="Label"></asp:Label> <asp:TextBox ID="TextBox4" runat="server" CausesValidation="True"></asp:TextBox> <asp:Literal ID="Literal2" runat="server" Text="this must change" here comes the div <div id="displayingarea" runat="server">This area will change</div> </ContentTemplate> </asp:UpdatePanel> <%--The editor ends--%> protected void Button6_Click(object sender, EventArgs e) { Label3.Text = displayingarea.InnerHtml; } As you see, I have implemented the effect of typing text in textbox which appears as a reflection in the div WITH FULLY FORMATTED TEXT ACCORDIG TO THE HTML TAGS USED The textbox does not allow html! Well the text box doesnot have too, script just extracts what is typed, within letting the server know. The html of the div tag also changes as typed in textbox. Now, There is a “post” button within an update plane a avoid full post back of page What I needis when the button is clicked on the value withing the div tag “innerhtml” is passed on to the label. Yes I know the chnages are only made on the client side, So when the button click event occurs the server is not aware of the new data within the div tag, Therefore the server assign the original html withing the div to the lab. Need help to overcome this, How is it that what we enter text in the textbox press the button with coding like label1.text=textbox1.text; and it works even in update panel, but the aabove code for extracting innerhtml typed at users end similar to yping in textbox does not work?

    Read the article

  • jQuery exclude elements with certain class in selector

    - by Alex Crooks
    I want to setup a click event trigger in jQuery for certain anchor tags. I want to open certain links in a new tab while ignoring ones with a certain class (before you ask I cannot put classes on the links I am trying to catch as they come from a CMS). I want to exclude links with class "button" OR "generic_link" I have tried $(".content_box a[class!=button]").click(function (e) { e.preventDefault(); window.open($(this).attr('href')); }); But that doesn't seem to work, also how do I do an OR statement to include "generic_link" in the exclusion? Many thanks

    Read the article

  • openss7 ss7 I_LINK ioctl

    - by deddihp
    Hello everyone, is there anyonve have used openss7 before ?. well, I am trying to implement MTP with mtpi interface. so i use I_LINK to link between M2PA and MTP. But I got some error, ioctl invalid argument. Do you have some suggestion for me ?. Thanks. your answer will be very helpful for me. int a1 = open("/dev/sctp_n", O_RDWR); int a2 = open("/dev/mtp", O_RDWR); ioctl(a1, I_PUSH, "m2pa-sl"); perror("m2pa-sl"); int a3 = ioctl(a1, I_LINK, a2); perror("ilink");

    Read the article

  • Download attachment issue with IE6-8 - non ssl

    - by Arun P Johny
    I'm facing an issue with file download with IE6-8 in non ssl environment. I've seen a lot of articles about the IE attachment download issue with ssl. As per the articles I tried to set the values of Pragma, Cache-Control headers, but still no luck with it. These are my response headers Cache-Control: private, max-age=5 Date: Tue, 25 May 2010 11:06:02 GMT Pragma: private Content-Length: 40492 Content-Type: application/pdf Content-Disposition: Attachment;Filename="file name.pdf" Server: Apache-Coyote/1.1 I've set the header values after going through some of these sites KB 812935 KB 316431 But these items are related to SSL. I've checked the response body and headers using fiddler, the response body is proper. I'm using window.open(url, "_blank") to download the file, if I change it to window.open(url, "_parent") or change the "Content-Disposition" to 'inline;Filename="file name.pdf"' it works fine. Please help me to solve this problem

    Read the article

  • Facebook Connect via Javascript doesn't close and doesn't pass session id

    - by ensnare
    I'm trying to authenticate users via Facebook Connect using a custom Javascript button: <form> <input type="button" value="Connect with Facebook" onclick="window.open('http://www.facebook.com/login.php?api_key=XXXXX&extern=1&fbconnect=1&req_perms=publish_stream,email&return_session=0&v=1.0&next=http%3A%2F%2Fwww.example.com%2Fxd_receiver.htm&fb_connect=1&cancel_url=http%3A%2F%2Fwww.example.com%2Fregister%2Fcancel', '_blank', 'top=442,width=480,height=460,resizable=yes', true)" onlogin='window.location="/register/step2"' /> </form> I am able to authenticate users. However after authentication, the popup window just stays open and the main window is not directed anywhere. In fact, it is the popup window that goes to "/register/step2" How can I get the login window to close as expected, and to pass the facebook session id to /register/step2? Thanks!

    Read the article

  • poblems with jquery code

    - by Michael
    Another jquery issue... I have tried this several times using "class" and "id" elements and I can not get it right. I am hoping the brains on stackoverflow can help! The problem that I am having is when I open the page all elments are closed. When I click on one link all links open. I believe it closes correctly the problem is that when I open the first link all items open. <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <title>Bid Items</title> <link href="bid.css" rel="stylesheet" type="text/css" /> <script src="jquerry/js/jquery.js" type="text/javascript"></script> <script type="text/javascript"> $(document).ready(function(){ $('#showhideconent').hide(); $('a').click(function(){ $('#showhideconent').show('slow'); }); $('a#close').click(function(){ $('#showhideconent').hide('slow'); }) }); $(document).ready(function(){ $('#showhideconent2').hide(); $('a').click(function(){ $('#showhideconent2').show('slow'); }); $('a#close2').click(function(){ $('#showhideconent2').hide('slow'); }) }); $(document).ready(function(){ $('#showhideconent3').hide(); $('a').click(function(){ $('#showhideconent3').show('slow'); }); $('a#close3').click(function(){ $('#showhideconent3').hide('slow'); }) }); $(document).ready(function(){ $('#showhideconent4').hide(); $('a').click(function(){ $('#showhideconent4').show('slow'); }); $('a#close4').click(function(){ $('#showhideconent4').hide('slow'); }) }); </script> </head> <body class="oneColElsCtr" onload="MM_preloadImages('Assignment4b.jpg')"> <div id="container"> <div id="mainContent"> <h1>Bid Page</h1> <h1>Coke Memorbila</h1> <a href="#" id="click">Amber Bottle 1914</a> <div id="box" align="center"> <div id="showhideconent"> <p><a href="coke/Amber1914.shtml"><img src="amber1914.jpg" width="200" height="200" alt="Amber Coke" /></a></p> <p><a href="#" id="close">Close</a> </p> </div> </div> <a href="#" id="click">Amber Bottle 1915</a> <div id="box" align="center"> <div id="showhideconent2"> <p><a href="coke/Amber1915.shtml"><img src="coke/Amber1914.shtml" width="200" height="200" alt="Amber Bottle 1915" /></a></p> <p><a href="#" id="close2">Close</a> </p> </div> </div> <a href="#" id="click">Green 1929</a> <div id="box" align="center"> <div id="showhideconent3"> <p><a href="coke/green1929.shtml"><img src="green1929.jpg" width="200" height="200" alt="Green 1929" /></a></p> <p><a href="#" id="close3">Close</a> </p> </div> </div> <a href="#" id="click">1970s Cans</a> <div id="box" align="center"> <div id="showhideconent4"> <p><a href="coke/tincans.shtml"><img src="coke_tincan.jpg" width="200" height="200" alt="Tin Cans" /></a></p> <p><a href="#" id="close4">Close</a> </p> </div> </div> </body> </html>

    Read the article

  • simple python file writing question

    - by aharon
    I'm learning Python, and have run into a bit of a problem. On my OSX install of Python 3.1, this happens in the console: >>> filename = "test" >>> reader = open(filename, 'r') >>> writer = open(filename, 'w') >>> reader.read() '' >>> writer.write("hello world\n") 12 >>> reader.read() '' And calling more test in BASH confirms that there is nothing in test. What's going on? Thanks.

    Read the article

  • C# CF: file encryption/decryption on the fly

    - by nuttynibbles
    Hi, i've seen many article on encrypt/decrypt of file and typically a button is used to choose the file for encrypt and another button to decrypt the file. i've seen some application like truecrypt and probably others which does file encryption on-the-fly with transparent. this means that when a encrypted file is clicked to access, it will automatically decrypt and play/open the file. then when the file is closed, it will automatically encrypt again. some have said that the only way to detect file open is through file system filter. but is there other ways to do this in c# compact framework?

    Read the article

  • Buyers question: Have intel AES-NI already been integrated in IPSEC stacks?

    - by deploymonkey
    Dear serverfault, I need to decide between deploying Opteron 6100 and Xeon Westmere EP, so I regard this a platform question. If not, it may be moved to stackoverflow and I hereby declare that I am very sorry. Do any (F)OSS or proprietory IPSEC stacks already use the AES-NI functions of the Westmere-EP? Thanks a bundle! ps. If anyone would like to create the tag AES-NI, You're welcome. I couldn't due to lack of rep.

    Read the article

  • Excel macro send rich mail using LotusNotes

    - by CC
    Hi everybody. I'm working on a small macro to send mail from excel 2007 using my Lotus Notes session. The sending mail part is working fine. Now I need to send in the body part, a part of a stylesheet (for instance the area from A1:B20). This area has colors, bold font. To send my email here is the code: Set oSess = CreateObject("Notes.NotesSession") Set oDB = oSess.GETDATABASE("", "") Call oDB.OPENMAIL flag = True If Not (oDB.IsOpen) Then flag = oDB.Open("", "") If Not flag Then MsgBox "Can't open mail file: " & oDB.SERVER & " " & oDB.FILEPATH End If On Error GoTo err_handler 'Building Message Set oDoc = oDB.CREATEDOCUMENT Set oItem = oDoc.CREATERICHTEXTITEM("BODY") oDoc.Form = "Memo" 'mail subject oDoc.Subject = "subject" 'mail body oDoc.sendto = "[email protected]" oDoc.body = "my text" oDoc.postdate = Date oDoc.SaveMessageOnSend = True oDoc.visable = True 'Sending Message oDoc.SEND False Does anybody has an idea about how to send a stylesheet ? Thanks alot.

    Read the article

  • Attaching HTML file as email in VB 6.0

    - by Shax
    Hi, I am trying to attach an html file file to email using Visual Basic 6.0. when the cursor is comes on Open strFile For Binary Access Read As #hFile line it gives error "Error encoding file - Bad file name or number". Please all your help and support would be highly appreciated. Dim handleFile As Integer Dim strValue As String Dim lEventCtr As Long handleFile = FreeFile Open strFile For Binary Access Read As #handleFile Do While Not EOF(hFile) ' read & Base 64 encode a line of characters strValue = Input(57, #handleFile) SendCommand EncodeBase64String(strValue) & vbCrLf ' DoEvents (occasionally) lEventCtr = lEventCtr + 1 If lEventCtr Mod 50 = 0 Then DoEvents Loop Close #handleFile Exit Sub File_Error: Close #handleFile m_ErrorDesc = "Error encoding file - " & Err.Description Err.Raise Err.Number, Err.Source, m_ErrorDesc End Sub

    Read the article

  • Cloud services, Public IPs and SIP

    - by Guido N
    I'm trying to run a custom SIP software (which uses JAIN SIP 1.2) on a cloud box. What I'd really like is to have a real public IP aka which is listed by "ifconfig -a" command. This is because atm I don't want to write additional SIP code / add a SIP proxy in order to manage private IP addresses / address translation. I gave Amazon EC2 a go, but as reported here http://stackoverflow.com/questions/10013549/sip-and-ec2-elastic-ips it's not fit for purpose (they do a 1:1 NAT translation between the private IP of the box and its Elastic IP). Does anyone know of a cloud service that provides real static public IP addresses?

    Read the article

  • CABasicAnimation not scrolling with rest of View

    - by morgman
    All, I'm working on reproducing the pulsing Blue circle effect that the map uses to show your own location... I layered a UIView over a MKMapView. The UIView contains the pulsing animation. I ended up using the following code gleaned from numerous answers here on stackoverflow: CABasicAnimation* pulseAnimation = [CABasicAnimation animationWithKeyPath:@"opacity"]; pulseAnimation.toValue = [NSNumber numberWithFloat: 0.0]; pulseAnimation.duration = 1.0; pulseAnimation.repeatCount = HUGE_VALF; pulseAnimation.autoreverses = YES; pulseAnimation.timingFunction = [CAMediaTimingFunction functionWithName:kCAMediaTimingFunctionEaseInEaseOut]; [self.layer addAnimation:pulseAnimation forKey:@"pulseAnimation"]; CABasicAnimation* resizeAnimation = [CABasicAnimation animationWithKeyPath:@"bounds.size"]; resizeAnimation.toValue = [NSValue valueWithCGSize:CGSizeMake(0.0f, 0.0f)]; resizeAnimation.fillMode = kCAFillModeBoth; resizeAnimation.duration = 1.0; resizeAnimation.repeatCount = HUGE_VALF; resizeAnimation.autoreverses = YES; resizeAnimation.timingFunction = [CAMediaTimingFunction functionWithName:kCAMediaTimingFunctionEaseInEaseOut]; [self.layer addAnimation:resizeAnimation forKey:@"resizeAnimation"]; This does an acceptable job of pulsing/fading a circle I drew in the UIView using: CGContextRef context = UIGraphicsGetCurrentContext(); CGContextSetRGBStrokeColor(context, 1.0, 0.0, 0.0, 0.4); // And draw with a blue fill color CGContextSetRGBFillColor(context, 1.0, 0.0, 0.0, 0.1); // Draw them with a 2.0 stroke width so they are a bit more visible. CGContextSetLineWidth(context, 2.0); CGContextAddEllipseInRect(context, CGRectMake(x-30, y-30, 60.0, 60.0)); CGContextDrawPath(context, kCGPathFillStroke); But I soon found that while this appears to work, as soon as I drag the underlying map to another position the animation screws up... While the position I want highlighted is centered on the screen the animation works ok, once I've dragged the position so it's no longer centered the animation now pulses starting at the center of the screen scaling up to center on the position dragged off center, and back again... A humorous and cool effect, but not what I was looking for. I realize I may have been lucky on several fronts. I'm not sure what I misunderstood. I think the animation is scaling the entire layer which just happens to have my circle drawn in the middle of it. So it works when centered but not when off center. I tried the following gleaned from one of the questions suggested by stackoverflow when I started this question: CABasicAnimation* translateAnimation = [CABasicAnimation animationWithKeyPath:@"position"]; translateAnimation.fromValue = [NSValue valueWithCGPoint:CGPointMake(oldx, oldy )]; translateAnimation.toValue = [NSValue valueWithCGPoint:CGPointMake(x, y )]; // translateAnimation.fillMode = kCAFillModeBoth; translateAnimation.duration = 1.0; translateAnimation.timingFunction = [CAMediaTimingFunction functionWithName:kCAMediaTimingFunctionEaseInEaseOut]; [self.layer addAnimation:translateAnimation forKey:@"translateAnimation"]; But it doesn't help much, when I play with it sometimes it looks like once time it animates in the correct spot after I've moved it offcenter, but then it switches back to the animating from the center point to the new location. Sooo, any suggestions or do I need to provide additional information.

    Read the article

  • OCR Web Service

    - by sdfx
    I am searching for an OCR web service (eventually open source, preferably free) that simply receives an image and returns the text of the image in writing. I've looked at tesseract, OCRopus and GOCR but the only open server I could find is WeOCR. Unfortunately the detection rates (at least during my tests) are sub-par and the speed is not much better. Does anyone have any experience with OCR web services? I guess the license of tesseract allows the operation of such a service, are there any out there?

    Read the article

  • Using a bookmarklet to track a package

    - by user307558
    I'm trying to write a bookmarklet that tracks a package in the mail. First it checks to see if the tracking page is open, if not it opens it in a new tab, and then sets the value of the form to the tracking number. Finally, it submits the form. What I'm so far unable to do is set the value of the form in the case where the bookmarklet opens up a new tab. Here's what I have: javascript: (function(){ var trackingNumber = "/*tracking number*/"; var a = document.forms.trackingForm; if ('http://fedex.com/Tracking' == document.location) { trackingForm.trackNbrs.value = trackingNumber; document.forms.trackingForm.submit(); } else { window.open('http://fedex.com/Tracking'); this.window.onload = function(){ //This seems to be the problem trackingForm.trackNbrs.value = trackingNumber; onload(document.forms.trackingForm.submit()); } } })(); Any ideas?

    Read the article

  • Posting an action works... but no image

    - by Brian Rice
    I'm able to post an open graph action to facebook using the following url: https://graph.facebook.com/me/video.watches with the following post data: video=http://eqnetwork.com/home/video.html?f=8e7b4f27-8cbd-4430-84df-d9ccb46da45f.mp4 It seems to be getting the title from the open graph metatags at the "video" object. But, it's not getting the image (even though one is specified in the metatag "og:image"). Also, if I add this to the post data: picture=http://eqnetwork.com/icons/mgen/overplayThumbnail.ms?drid=14282&subType=ljpg&w=120&h=120&o=1&thumbnail= still no image. Any thoughts? Brian

    Read the article

  • Virtual drivers with Windows Driver Model - where to begin?

    - by waitinforatrain
    I've never written drivers before but I'm starting an open-source project that involves creating virtual MIDI ports that will send the MIDI data over a network. For this, I presume I would be creating some sort of virtual driver using WDM (unless it's possible with kernel hooks?) - but being a beginner to driver development I don't know where to begin. Does anyone know any useful resources that would help me with this project? Or some open-source code from a similar project that I could fork as a starting point?

    Read the article

< Previous Page | 386 387 388 389 390 391 392 393 394 395 396 397  | Next Page >