Search Results

Search found 391 results on 16 pages for 'vijay anand'.

Page 4/16 | < Previous Page | 1 2 3 4 5 6 7 8 9 10 11 12  | Next Page >

  • State of Texas delivers Private Cloud Services powered by Oracle Technology

    - by Anand Akela
    State of Texas moved to private cloud infrastructure and delivering Infrastructure as a Service , Database as a Service and other Platform as a Service offerings to their 28 state agencies. Todd Kimbriel, Director of eGovernment Division at State of Texas attended Oracle Open World and talked with Oracle's John Foley about their private cloud services offering. Later, Todd participated in the keynote panel of Database as a Service Online Forum> along with Carl Olofson,IDC analyst , Juan Loaiza,SVP Oracle and couple of other Oracle customers. He discussed the IT challenges of  government organizations like state of Texas and the benefits of transitioning to Private cloud including database as a service .

    Read the article

  • installing ubuntu 12.04 along windows xp and windows 7

    - by Anand A J
    I have Windows XP installed on C drive and Windows 7 installed on F drive. I want to install Ubuntu 12.04 alongwith Windows (keeping both XP and 7) in drive G with out losing any data stored in the computer. I have a hard disk of 500 GB size with C (14.8 GB left),D,E,F, and G (15.7 GB left). I tried to install Ubuntu 12.04 from DVD and getting stuck at the time of selecting partitions .! How to select the device for boot loader installation? Will the installation of Ubuntu into G drive affects the data stored in the hard disk or in G drive especially? After installing Ubuntu can I use Windows XP and Windows 7? This is my first attempt to use Ubuntu. Can any body help me please?

    Read the article

  • Format a pc with a GRUB error

    - by Anand
    i have a pc with a grub error {caused by deleting ubuntu partition in XP dual boot} i would like to format the hard disk and install a new OS [chromium] i do not have either the ubuntu or the XP installation drives although i do have the chromium bootable drive when i try to boot from the chrome bootable USB its says "your system is repairing itself" and restarts. this keeps happening over and over again. i just want to format my HDD completely and start over with chromium (i have no important data on the HDD)

    Read the article

  • How to access a row from af:table out of context

    - by Vijay Mohan
    Scenario : Lets say you have an adf table in a jsff and it is included as af:region inside other page(parent page).Now your requirement is to access some specific rows from the table and do some operations. Now, since you are aceessing the table outside the context in which it is present, so first you will have to setup the context and then you can use the visitCallback mechanism to do the opeartions on table. Here is the sample code: ================= final RichTable table = this.getRichTable();         FacesContext facesContext = FacesContext.getCurrentInstance();         VisitContext visitContext =   RequestContext.getCurrentInstance().createVisitContext(facesContext,null, EnumSet.of(VisitHint.SKIP_TRANSIENT,VisitHint.SKIP_UNRENDERED), null);         //Annonymous call         UIXComponent.visitTree(visitContext,facesContext.getViewRoot(),new VisitCallback(){             public VisitResult visit(VisitContext context, UIComponent target)               {                   if (table != target)                   {                     return VisitResult.ACCEPT;                   }                   else if(table == target)                   {                       //Here goes the Actual Logic                       Iterator selection = table.getSelectedRowKeys().iterator();                       while (selection.hasNext()) {                           Object key = selection.next();                           //store the original key                           Object origKey = table.getRowKey();                           try {                               table.setRowKey(key);                               Object o = table.getRowData();                               JUCtrlHierNodeBinding rowData = (JUCtrlHierNodeBinding)o;                               Row row = rowData.getRow();                               System.out.println(row.getAttribute(0));                           }                           catch(Exception ex){                               ex.printStackTrace();                           }                           finally {                               //restore original key                               table.setRowKey(origKey);                           }                       }                   }                   return VisitResult.COMPLETE;               }         }); 

    Read the article

  • Examine your readiness for managing Enterprise Private Cloud

    - by Anand Akela
    Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} Cloud computing promises to deliver greater agility to meet demanding  business needs, operational efficiencies, and lower cost. However these promises cannot be realized and enterprises may not be able to get the best value out of their enterprise private cloud computing infrastructure without a comprehensive cloud management solution . Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:10.0pt; font-family:"Times New Roman","serif";} Take this new self-assessment quiz that measures the readiness of your enterprise private cloud. It scores your readiness in the following areas and discover where and how you can improve to gain total cloud control over your enterprise private cloud. Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} Complete Cloud Lifecycle Solution Check if you are ready to manage all phases of the building, managing, and consuming an enterprise cloud. You will learn how Oracle can help build and manage a rich catalog of cloud services – whether it is Infrastructure-as-a-Service, Database-as-a-Service, or Platform-as-a-Service, all from a single product. Integrated Cloud Stack Management Integrated management of the entire cloud stack – all the way from application to disk, is very important to eliminate the integration pains and costs that customers would have to otherwise incur by trying to create a cloud environment by integrating multiple point solutions. Business-Driven Clouds It is critical that an enterprise Cloud platform is not only able to run applications but also has deep business insight and visibility. Oracle Enterprise Manager 12c enables creation of application-aware and business-driven clouds that has deep insight into applications, business services and transactions. As the leading providers of business applications and the middleware, we are able to offer you a cloud solution that is optimized for business services. Proactive Management Integration of the enterprise cloud infrastructure with support can allow cloud administrators to benefit from Automatic Service Requests (ASR), proactive patch recommendations, health checks and end-of-life advisory for all of the technology deployed within cloud. Learn more about solution for Enterprise Cloud and Cloud management by attending various sessions , demos and hand-on labs at Oracle Open World 2012 . Stay Connected: Twitter |  Face book |  You Tube |  Linked in |  Newsletter

    Read the article

  • Slap the App on the VM for every private cloud solution! Really ?

    - by Anand Akela
    One of the key attractions of the general session "Managing Enterprise Private Cloud" at Oracle OpenWorld 2012 was an interactive role play depicting how to address some of the key challenges of planning, deploying and managing an enterprise private cloud. It was a face-off between Don DeVM, IT manager at a fictitious enterprise 'Vulcan' and Ed Muntz, the Enterprise Manager hero .   Don DeVM is really excited about the efficiency and cost savings from virtualization. The success he enjoyed from the infrastructure virtualization made him believe that for all cloud service delivery models ( database, testing or applications as-a-service ), he has a single solution - slap the app on the VM and here you go . However, Ed Muntz believes in delivering cloud services that allows the business units and enterprise users to manage the complete lifecycle of the cloud services they are providing, for example, setting up cloud, provisioning it to users through a self-service portal ,  managing and tuning the performance, monitoring and applying patches for database or applications. Watch the video of the face-off , see how Don and Ed address some of the key challenges of planning, deploying and managing an enterprise private cloud and be the judge ! ?

    Read the article

  • Zero to Cloud : One stop shop for resources to accelerate your transformation to enterprise private cloud

    - by Anand Akela
    Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} During the Oracle Open World 2012 last week, Oracle introduced "Zero to Cloud" resource center to help you accelerate your transformation journey to enterprise private cloud. To help organizations deploy fully operational, enterprise-grade private cloud environment in as little as half a day, Oracle has brought key content together into this single, user-friendly resource center. Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} The resource center is launched just as the Oracle Cloud Builder Summit series moves into full swing. Designed for executives, cloud architects, and IT operations professionals, the day-long event series will eventually reach nearly 100 cities around the globe. During this event, an interactive "Zero to Cloud" session will showcase the transformational journey of a fictitious enterprise to the private cloud using the latest solutions from Oracle—including, Oracle Database, Oracle Fusion Middleware, Oracle VM and Oracle Enterprise Manager, as well as Oracle’s full range of engineered systems. The online "Zero to Cloud" resource center includes best practices from Oracle experts and early adopter customers as well as interviews with Oracle development executives responsibly for Oracle’s private cloud solutions and roadmap. It also includes a new self-assessment quiz that can help determine readiness for a successful private cloud deployment. Once you've determined organizational readiness, explore early adopter tips, demos, guides, exclusive white papers and more at the "Zero to Cloud" resource center.

    Read the article

  • MultiSelectChoice: How to get underlying values selected

    - by Vijay Mohan
    Let's say you include a multiselectchoice component in your jspx/jsff page, which has <f;selectItem> or <af:forEach> binded to a VO iterator to populate the multiselectchoice and the value property of which is binded to a List attribute binding.When the user selects some items in that choice List then u want the actual values to be posted.You can check the valuepassthrough flag to true , but many a times it doesn't help and you end up getting the indexes of multiselect values.Here is a way to get the actual values..Lets say in the bean u have a utility method to achieve this as follows..You can associate a valueChangeListener for the multiselectchoice as follows..public void onValueChangeOfLOV(ValueChangeEvent valueChangeEvent) { //get array of indexes of selected items in master list List valueIndexes = (List)valueChangeEvent.getNewValue(); String concatCodes = returnSelectmanyChoiceValues(valueIndexes,"YourIterator", "YourAttribute"); } public String returnSelectmanyChoiceValues(List valueIndexes,String iterName, String idAttrName){ DCBindingContainer dc = (DCBindingContainer)BindingContext.getCurrent().getCurrentBindingsEntry(); DCIteratorBinding iter = dc.findIteratorBinding(iterName); ViewObject vo = iter.getViewObject(); String codes = ""; for(Object index : valueIndexes){ String iIndex = (String)index; Row row = vo.getRowAtRangeIndex(Integer.parseInt(iIndex)); codes = codes +(String)row.getAttribute(idAttrName)+","; } //remove last "," if(codes.endsWith(",")) codes = codes.substring(0,codes.lastIndexOf(",")); return codes; }This will return u a comma separated values of the selected items. if you want thenYou can store it in a List.

    Read the article

  • I.T. Chargeback : Core to Cloud Computing

    - by Anand Akela
    Contributed by Mark McGill Consolidation and Virtualization have been widely adopted over the years to help deliver benefits such as increased server utilization, greater agility and lower cost to the I.T. organization. These are key enablers of cloud, but in themselves they do not provide a complete cloud solution. Building a true enterprise private cloud involves moving from an admin driven world, where the I.T. department is ultimately responsible for the provisioning of servers, databases, middleware and applications, to a world where the consumers of I.T. resources can provision their infrastructure, platforms and even complete application stacks on demand. Switching from an admin-driven provisioning model to a user-driven model creates some challenges. How do you ensure that users provisioning resources will not provision more than they need? How do you encourage users to return resources when they have finished with them so that others can use them? While chargeback has existed as a concept for many years (especially in mainframe environments), it is the move to this self-service model that has created a need for a new breed of chargeback applications for cloud. Enabling self-service without some form of chargeback is like opening a shop where all of the goods are free. A successful chargeback solution will be able to allocate the costs of shared I.T. infrastructure based on the relative consumption by the users. Doing this creates transparency between the I.T. department and the consumers of I.T. When users are able to understand how their consumption translates to cost they are much more likely to be prudent when it comes to their use of I.T. resources. This also gives them control of their I.T. costs, as moderate usage will translate to a lower charge at the end of the month. Implementing Chargeback successfully create a win-win situation for I.T. and the consumers. Chargeback can help to ensure that I.T. resources are used for activities that deliver business value. It also improves the overall utilization of I.T. infrastructure as I.T. resources that are not needed are not left running idle. Enterprise Manager 12c provides an integrated metering and chargeback solution for Enterprise Manager Targets. This solution is built on top of the rich configuration and utilization information already available in Enterprise Manager. It provides metering not just for virtual machines, but also for physical hosts, databases and middleware. Enterprise Manager 12c provides metering based on the utilization and configuration of the following types of Enterprise Manager Target: Oracle VM Host Oracle Database Oracle WebLogic Server Using Enterprise Manager Chargeback, administrators are able to create a set of Charge Plans that are used to attach prices to the various metered resources. These plans can contain fixed costs (eg. $10/month/database), configuration based costs (eg. $10/month if OS is Windows) and utilization based costs (eg. $0.05/GB of Memory/hour) The self-service user provisioning these resources is then able to view a report that details their usage and helps them understand how this usage translates into cost. Armed with this information, the user is able to determine if the resources are delivering adequate business value based on what is being charged. Figure 1: Chargeback in Self-Service Portal Enterprise Manager 12c provides a variety of additional interfaces into this data. The administrator can access summary and trending reports. Summary reports allow the administrator to drill-down through the cost center hierarchy to identify, for example, the top resource consumers across the organization. Figure 2: Charge Summary Report Trending reports can be used for I.T. planning and budgeting as they show utilization and charge trends over a period of time. Figure 3: CPU Trend Report We also provide chargeback reports through BI Publisher. This provides a way for users who do not have an Enterprise Manager login (such as Line of Business managers) to view charge and usage information. For situations where a bill needs to be produced, chargeback can be integrated with billing applications such as Oracle Billing and Revenue Management (BRM). Further information on Enterprise Manager 12c’s integrated metering and chargeback: White Paper Screenwatch Cloud Management on OTN

    Read the article

  • News Applications internal working [on hold]

    - by Vijay
    How does news applications work other than RSS Feed based applications? I know some of them take the RSS content from the source site.But sometimes I see, those applications show - Title Description Date Image video etc. Even though when I see the original site's rss, image, video is not there in rss. So how does one get that to show in there applications? Some applications even shows feeds from magazine sites, newspaper sites. How do these applications work? I am creating an application which will link to different news sites feeds categorized (like top news, technology, games, articles etc.) On the front page it will show the website names, then on selection of any news site it will get the feed from that website and show it to user. So I would like to know All the fetching of data from should be done on user selection or data should be prefetched? Detailed information I want to fetch from the original like provided in the rss data. How should I go about it?

    Read the article

  • login problem for 13.10, my username does not appear

    - by Anand
    After upgrading my Ubuntu to the newest version 13.10, in the login interface, my account does not appear. I can login the guest session. There is also a remote login. I have no place to input my username to login my account. Does anyone have the same problem? ----EDIT---- Here is the file lightdm.conf [SeatDefaults] greeter-session=unity-greeter user-session=ubuntu ----EDIT TWO--- Here is the official bug report: https://bugs.launchpad.net/ubuntu/+source/unity-greeter/+bug/1235785

    Read the article

  • Internet (HTTP) is not working on Sony Viao

    - by vijay
    I switched my sony viao laptop from XP to ubuntu 10.04 recently. I have it connected through router at home. The internet was working fine with XP. With ubuntu, i am not able to connect to interenet. I am able to update using apt, and i am able to ping too. It seems like there is a DNS issue, when i try to goto sites from firefox, it doesn't work. I tried disabling the ipv6 in firefox config, it doesn't work. My router is on 192.168.2.1 instead of 192.168.1.1 any ideas on what config i might need to change to make this work? or could this be a drive issue?

    Read the article

  • pppoeconf problem in ubuntu

    - by Vijay Nalawade
    pppoeconf now working in ubuntu 11.04. so i tried using network manager by adding dsl connection.after putting all details user name ,password , service name its working first time, named dslconnection1. but after rebooting i am not able to connect to internet. both ppppoeconf is not working and dslconnection1 option is not visible,also auto etho is not visible. so how to connect to internet in above case

    Read the article

  • installing xbuntu desktop in ubuntu 12.04

    - by Vijay Nalawade
    I have installed ubuntu 12.04. I want to install xfce desktop.when i able to install xubuntu desktop getting following message. sudo apt-get install lubuntu-desktop Media change: please insert the disc labeled 'Ubuntu 12.04.1 LTS Precise Pangolin - Release i386 (20120817.3)' in the drive '/cdrom/' and press enter i didn't know why this error are coming and also i don't have CD driver. i installed Ubuntu using usb. please let me know how to install xubuntu desktop.

    Read the article

  • How to work for Ubuntu? [duplicate]

    - by vijay
    This question already has an answer here: How can I contribute to Ubuntu? 4 answers I am very much impressed by Ubuntu. I want to work for it but I know only C language. Can somebody guide me on how to work for Ubuntu. thanks for your reply I don't want to learn any other programming languages. programatically i want to contribute.

    Read the article

  • Top tweets SOA Partner Community – October 2013

    - by JuergenKress
    Send your tweets @soacommunity #soacommunity and follow us at http://twitter.com/soacommunity Ronald Luttikhuizen ?My latest upload: SOA Made Simple | Introduction to SOA on @slideshare http://www.slideshare.net/rluttikhuizen/soa-made-simple-introduction-to-soa … via @SlideShare OTNArchBeat ?ArchBeat Link-o-Rama for October 4, 2013 #cloud #linux #oaam #soa http://pub.vitrue.com/y4SK Lucas Jellema ?My blog article shows news on the new SOA Suite 12c release - as it was publicly available during #oow13 see: http://technology.amis.nl/2013/09/27/oow13-soa-suite-12c/ … Yogesh Sontakke ?Introducing OER's new Express Workflows - Simplified Lifecycle Management. Blog post: http://bit.ly/16JKHCf @soacommunity #soagovernance SrinivasPadmanabhuni ?"@OTNArchBeat: SOA and User Interfaces - by @soacommunity @HajoNormann @gschmutz @t_winterberg et al #industrialsoa http://pub.vitrue.com/KmOp " SOA Community ?SOA and User-Interfaces http://servicetechmag.com/I76/0913-2 article published part of #industrialSOA at Service Technology Magazine #soacommunity Estafet Limited ?@Estafet win @UKOUG Middleware Partner of the Year 2013 Yogesh Sontakke ?RT @VikasAatOracle: #Oracle #B2B - written by experts #soa #soacommunity #oraclesoa - time to get a copy ! @SOAScott Danilo Schmiedel ?Thanks a lot to Juergen @soacommunity for the super interesting and well-organized Partner Advisory Council yesterday! Such a Great Value! OTNArchBeat ?Case management supporting re-landscaping application portfolios | @leonsmiers http://pub.vitrue.com/MC5j Samantha Searle ?Apply for the #GartnerBPM 2014 Excellence Awards - find out how via this link http://ow.ly/ptaNQ #Gartner #bpm #process #entarch #cio OTNArchBeat ?SOA and User Interfaces - by @soacommunity @hajonormann @gschmutz @t_winterberg et al #industrialsoa http://pub.vitrue.com/KmOp Dain Hansen ?Hybrid #cloud is on the rise, but is the IT department's culture standing in the way? http://add.vc/eJN #CloudIntegration #OracleSOA OTNArchBeat #SOASuite 11g ps6 - Download your log files directly from the Enterprise Manager | @whitehorsenl http://pub.vitrue.com/KrJ2 Whitehorses ?Whiteblog: SOA Suite 11g ps6 - Download your log files directly from the Enterprise Manager (http://goo.gl/2Gqiax ) Rajesh Raheja ?Cloud integration session recap #oow13 http://blog.raastech.com/2013/09/recap-of-real-world-cloud-integration.html?m=1 … Vikas Anand ?@Ahmed_Aboulnaga thanks for the excellent summary and kind words. #oow13 #cloud #oraclesoa http://blog.raastech.com/2013/09/recap-of-real-world-cloud-integration.html?m=1 … Luis Augusto Weir ?REST is also SOA. Check it out http://www.soa4u.co.uk/2013/09/restful-is-also-soa.html?m=1 … #soacommunity Graham ?“@OracleBPM & @soacommunity: 5 Ways to Modernize Applications with BPM #AppAdvantage" #oracleday http://bit.ly/15yC6e3 SOA Community ?#ACED director asked me for BPM references in FSI - ever visited my #SOACommunity workspace? https://beehiveonline.oracle.com/teamcollab/overview/SOA_Community_Workspace … #soacommunity #bpm OracleBlogs ?SOA Community Newsletter September 2013 http://ow.ly/2Aj6oK OTNArchBeat ?OOW13: First glimpses of the new #SOASuite12c | @LucasJellema http://pub.vitrue.com/2YgX sbernhardt ?Just published new blog entry on OOW 2013 wrap up. http://thecattlecrew.wordpress.com/2013/09/30/oracle-open-world-2013-wrap-up/ … #oow13 @OC_WIRE @soacommunity Emiel Paasschens ?Home with family after an overwhelming #OOW week in San Francisco with lot of info & meetings. Special thanx to @OracleBelux & @soacommunity Robert van Mölken ?Had a awesome week at #OOW13 in SF. Highlights were the @soacommunity Wine tour, @OracleBelux meet-ups and @OracleSOA CAB. Thanks to all :) SOA Community ?The place Oracle Fusion middleware comes from - Oracle 200 - TKs office - next Oracle 100 - SOA & BPM #soacommunity pic.twitter.com/qibFOQVbRo Oracle BPM ?5 Ways to Modernize Applications with BPM #AppAdvantage http://pub.vitrue.com/l2dn Simon Haslam ?Ha ha - how did we miss that! RT @lucasjellema: Post conference announcement of a new middleware appliance? #oow13 pic.twitter.com/3NvcjPfjXb OTNArchBeat ?The OTNArchBeat Daily is out! http://paper.li/OTNArchBeat/1329828521 … ? Top stories today via @lucasjellema @myfear @TylerJewell Packt Publishing ?Get 50% off ALL our DRM-free eBooks - this weekend only! Go to http://www.packtpub.com/ and use code BIG50, as often as you like! #BIG50 OracleBlogs ?Global Perspective: ACE Director from EMEA Weighs in on AppAdvantage http://ow.ly/2Afek2 orclateamsoa ?#orclateamsoa Blog: BPM Auditing Demystified - I've heard from a couple of customers recently asking about BPM aud... http://ow.ly/2AfbAn AMIS, Oracle & Java ?Cool #soasuite 12c feature managed file transfer - visit Dave Barry at demo point sr212 #oow #soacommunity pic.twitter.com/gb4HLbUarR SOA Community ?Let us know what was best at #OOW @soacommunity save trip home - thanks for coming to #SF ;-) see you at #OOW2014 pic.twitter.com/xbWXjRapqh Lonneke Dikmans ?Nice @dschmied is talking about the different steps in his project. He starts with explaining the user interface design #oow13 #ux #acm Lonneke Dikmans ?Saving the best for the end: managing knowledge worker processes by @dschmied and Prasen.#oow13 #acm cool stuff: adaptive case management Luis Augusto Weir ?SOA Governance is more than just OER. Requires people, processes and tools. Check it out #SOA #soacommunity http://youtu.be/Ohn06smVKVw Lonneke Dikmans ?“@OracleSOA: #oow Join us for:Enterprise SOA Infrastructure Best Practices Thu 9/26 2:00 PM - 3:00 PM Moscone West - 2020 SOA Community ?Business Process Management (BPM) 11g PS6 Awareness Course http://wp.me/p10C8u-1as Ajay Khanna ?Detect, Analyze, Act - Fast! http://wp.me/p10C8u-1ao via @soacommunity #OracleBPM Simone Geib ?It took a while, but I finally reached 500 followers. Thanks everybody and especially @soacommunity :) SOA Community ?Functional Testing Business Processes In Oracle BPM Suite 11g by Arun Pareek http://wp.me/p10C8u-1aq SOA Community Distribute the September edition of the SOA Community newsletter READ it! Didn't receive it register http://www.oracle.com/goto/emea/soa #soacommunity SOA Community ?Detect, Analyze, Act - Fast! by Ajay Khanna http://wp.me/p10C8u-1ao Robert van Mölken ?Finalised my #OOW presentation #CON8736 and live demo on wednesday 25th at 11:45am. Also giving a short version at the SOA CAB on thursday. Rajesh Raheja ?"The AppAdvantage of Oracle Cloud & On-premises Integration" http://bit.ly/14RYHmZ SOA Community ?Additional new content SOA & BPM Partner Community http://wp.me/p10C8u-1aw Dain Hansen ?Right now #oow13 SOA, BPM - Customer Advisory Boards. 'No tweeting' says @SOASimone. Instagram of funny cats still ok. leonsmiers ?Case Management with Oracle BPM Suite our presentation on #oow13 http://www.slideshare.net/leonsmiers/oracle-open-world-2013-case-management-smiers-kitson … #capgemini @nkitson72 Mark Simpson ?Flextronics reduced cost of processing an invoice to <$1 from $7 due to BPM @OracleBPM #oow13 saving millions. Way less than industry avg. Holger Mueller ?#Siemens Shared Services CIO says that #Fusion #Middleware made the difference for #Oracle over #Workday. #Integration matters. #OOW13 oracleopenworld ?Miss any #oow13 keynotes, or simply want to rewatch? Check out the live streaming site for keynotes on demand: http://pub.vitrue.com/RG4D SOA Community ?Analyze your m2m data and act on it! Big data Pattern matching, fast data & soa #soacommunity #oow pic.twitter.com/48Q1z4ckh7 SOA Community ?Top tweets SOA Partner Community – September 2013 http://wp.me/p10C8u-1cR Simone Geib ?#oraclesoa hands on lab at #oow13 pic.twitter.com/IJJrqXIMiu Danilo Schmiedel #oow13 CON8436: Managing Knowledge Worker Processes. Come & get a free Adaptive Case Management poster @soacommunity pic.twitter.com/FRc2CSyLwb John Sim ?Great job again Jurgen @soacommunity helping bring Ace Community together! Danilo Schmiedel ?Excellent #OracleBPM Adaptive Case Management intro by @heidibuelowBPM and Prasen at the #oow13 demo ground.Last chance today @soacommunity SOA Community ?Thanks to all our #bpm #soa and #weblogic partners for the great middleware business #oow #soacommunity pic.twitter.com/dBwZ8DMHfH Whitehorses ?Thanks @soacommunity for the party tonight. Great to meet product management & see all the talented EMEA middleware specialists. #oow13 Danilo Schmiedel ?Great tool demo from Link Consulting about managing your SOA with OER #oow13 @soacommunity Torsten Winterberg ?“@soacommunity: thanks to @dschmied and @OC_WIRE for making it happen to have our case management poster as printed version hier at #oow13 Ronald Luttikhuizen ?These were the architects involved in the diagram excitement :) just after State of SOA podcast with @OTNArchBeat pic.twitter.com/5B8jIrVTA9 SOA Community ?Tanks to AVIO for the excellent #bpmn poster and the great bpm business - visit then at #OOW & get the poster pic.twitter.com/ebTg9pFY1C Dain Hansen ?Kurian introducing Oracle Platform-as-a-Service developments. #oow13 #OracleCloud pic.twitter.com/evJLTU53rx Bruce Tierney ?API Management "multi-level pie chart" at #oow13 by Oracle's Tim Hall pic.twitter.com/q12OIRdaue Dain Hansen ?This is not your Daddy's BAM @soacommunity: Is this BAM? Very cool in #soasuite 12c get a demo at sr225 pic.twitter.com/EvwqXW9U5j SOA Community ?Is this BAM? Very cool in #soasuite 12c get a demo at sr225 pic.twitter.com/LybHxyF362 SOA Community ?SOA governance by @Yogesh_Sontakke at demo point sr214 many good new features - key for soa projects #oow #soa pic.twitter.com/DFK0ummsK1 SOA Community ?Cool #soasuite 12c feature managed file transfer - visit Dave Barry at demo point sr212 #oow #soacommunity pic.twitter.com/GDKcqDGhCF SOA Community ?Adaptive Case Management demo point at #OOW visit @heidibuelowBPM get a demo and cmmn notation poster #soacommunity pic.twitter.com/T7yEyI7tdn Lonneke Dikmans ?In case you missed it: http://blog.vennster.nl/2013/09/case-management-part-1.html?spref=tw … Lucas Jellema ?SOA Suite news: Cloud Adapters RightNow and SalesForce plus SDK to develop custom cloud adapters (CY13); REST/JSON support in SB/SCA (12c) Oracle SOA ?Cloud Integration and AppAdvantage: Transform your Enterprise #soa #oow13 http://pub.vitrue.com/UfPB Dain Hansen ?Cloud Integration and AppAdvantage: Transform your Enterprise #soa #oow13 http://pub.vitrue.com/4QWA Hajo Normann ?#BigData, eventing & real time #analytics suggest timely next actions in #oracleBPM & #oracleACM; #oow13 #FastData pic.twitter.com/aFVGrTXPqu Mark Simpson ?OEP CQL engine now used in BAM12c for event stream summary computation with temporal and pattern match features to feed dashboards. #oow13 Mark Simpson ?BAM12c virtually a new product. Analytics that senses ahead of time and also compares to historical trends to guide process or case #oow13 Andrejus Baranovskis ?Enabling UI Shell 12c/11g Multitasking Behavior http://fb.me/18l9vxQfA Amit Zavery ?Oracle Fusion Middleware Empowers Business Users, EVP Thomas Kurian's session summary http://onforb.es/18Ta1jf #oow13 #oraclemiddle #oracle Vikas Anand ?#oow13 #oracleopenworld BPM on display at Middleware keynote by Thomas Kurian pic.twitter.com/PMm719S0Ui SOA Community ?BPM composer - business user empowerment #oow #soacommunity #bpmsuite pic.twitter.com/0Qgl6oVh0h SOA Community ?Model your process in BPMN - make is executable and analyze & improve them #oow #soacommunity pic.twitter.com/jkLlObDdoi Bruce Tierney ?@demed and Thomas Kurian talk mobile and cloud at #oow13 pic.twitter.com/bAAeqn5a2V Amit Zavery ?Thomas Kurian showcasing all the new features of Oracle Fusion Middleware #oraclemiddle #oow13 SOA Community ?Demo time cloud adapters in #soasuite at Thomas Kurian keynote. Build and integrate mobile apps in minutes #oow pic.twitter.com/qTnCOJLLwS SOA Community ?Soa suite cloud adapters and mobile apps by @demed at Thomas Kurian keynote #oow #oracle #soacommunity pic.twitter.com/5aMLkNH4Ng Danilo Schmiedel ?First impressions from Oracle Open World 2013 http://wp.me/p2fG8x-77 @soacommunity @OC_WIRE SOA Community ?Good morning SFO let us know if you attend #OOW & #OPN keynote - #soacommunity pic.twitter.com/hzLYGDlRgE Simon Haslam ?Had a very useful @wlscommunity PAC meeting yesterday... & probably the best swag to date! pic.twitter.com/Lqus8ysbp7 Vikas Anand ?Oracle SOA Suite - Team Blog http://bit.ly/18I1Zj7 Rajesh Raheja ?Introducing new Cloud Connectivity Adapters #soa #demopod #oow13. I'll be there Sep 23 & 24 3-6pm to meetup http://bit.ly/18I1Zj7 leonsmiers ?..and again a very successful Oracle SOA/BPM partner council on the eve of #oow13. Thanks Jurgen! @soacommunity pic.twitter.com/aM1LMlb7Yw Vikas Anand ?#oow13 #soa #oep #exalogic Canon Delivers Fast Data with Oracle Event Processing (Oracle SOA Suite) http://bit.ly/1dwPeHb #soacommunity Rolf Scheuch ?The ACM poster is a big success. Great talks and .... I am soon out of posters! #bpmcon #ACM pic.twitter.com/TriaUyXRWK Oracle SOA ?British Telecom Sucess with Oracle B2B #oow #soa #b2b http://pub.vitrue.com/1RWi leonsmiers ?(Oracle) Case Management supporting re-platforming, a pre-read before our presentation at #oow13 http://leonsmiers.blogspot.com/2013/09/case-management-supporting-re.html … #capgemini #yammer SOA & BPM Partner CommunityFor regular information on Oracle SOA Suite become a member in the SOA & BPM Partner Community for registration please visit www.oracle.com/goto/emea/soa (OPN account required) If you need support with your account please contact the Oracle Partner Business Center. Blog Twitter LinkedIn Facebook Wiki Mix Forum Technorati Tags: Twitter,SOA,Oracle BPM,Community,OPN,Jürgen Kress

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • SQLAuthority News – TechEd India – April 12-14, 2010 Bangalore – An Unforgettable Experience – An Op

    - by pinaldave
    TechEd India was one of the largest Technology events in India led by Microsoft. This event was attended by more than 3,000 technology enthusiasts, making it one of the most well-organized events of the year. Though I attempted to attend almost all the technology events here, I have not seen any bigger or better event in Indian subcontinents other than this. There are 21 Technical Tracks at Tech·Ed India 2010 that span more than 745 learning opportunities. I was fortunate enough to be a part of this whole event as a speaker and a delegate, as well. TechEd India Speaker Badge and A Token of Lifetime Hotel Selection I presented three different sessions at TechEd India and was also a part of panel discussion. (The details of the sessions are given at the end of this blog post.) Due to extensive traveling, I stay away from my family occasionally. For this reason, I took my wife – Nupur and daughter Shaivi (8 months old) to the event along with me. We stayed at the same hotel where the event was organized so as to maximize my time bonding with my family and to have more time in networking with technology community, at the same time. The hotel Lalit Ashok is the largest and most luxurious venue one can find in Bangalore, located in the middle of the city. The cost of the hotel was a bit pricey, but looking at all the advantages, I had decided to ask for a booking there. Hotel Lalit Ashok Nupur Dave and Shaivi Dave Arrival Day – DAY 0 – April 11, 2010 I reached the event a day earlier, and that was one wise decision for I was able to relax a bit and go over my presentation for the next day’s course. I am a kind of person who likes to get everything ready ahead of time. I was also able to enjoy a pleasant evening with several Microsoft employees and my family friends. I even checked out the location where I would be doing presentations the next day. I was fortunate enough to meet Bijoy Singhal from Microsoft who helped me out with a few of the logistics issues that occured the day before. I was not aware of the fact that the very next day he was going to be “The Man” of the TechEd 2010 event. Vinod Kumar from Microsoft was really very kind as he talked to me regarding my subsequent session. He gave me some suggestions which were really helpful that I was able to incorporate them during my presentation. Finally, I was able to meet Abhishek Kant from Microsoft; his valuable suggestions and unlimited passion have inspired many people like me to work with the Community. Pradipta from Microsoft was also around, being extremely busy with logistics; however, in those busy times, he did find some good spare time to have a chat with me and the other Community leaders. I also met Harish Ranganathan and Sachin Rathi, both from Microsoft. It was so interesting to listen to both of them talking about SharePoint. I just have no words to express my overwhelmed spirit because of all these passionate young guys - Pradipta,Vinod, Bijoy, Harish, Sachin and Ahishek (of course!). Map of TechEd India 2010 Event Day 1 – April 12, 2010 From morning until night time, today was truly a very busy day for me. I had two presentations and one panel discussion for the day. Needless to say, I had a few meetings to attend as well. The day started with a keynote from S. Somaseger where he announced the launch of Visual Studio 2010. The keynote area was really eye-catching because of the very large, bigger-than- life uniform screen. This was truly one to show. The title music of the keynote was very interesting and it featured Bijoy Singhal as the model. It was interesting to talk to him afterwards, when we laughed at jokes together about his modeling assignment. TechEd India Keynote Opening Featuring Bijoy TechEd India 2010 Keynote – S. Somasegar Time: 11:15pm – 11:45pm Session 1: True Lies of SQL Server – SQL Myth Buster Following the excellent keynote, I had my very first session on the subject of SQL Server Myth Buster. At first, I was a bit nervous as right after the keynote, for this was my very first session and during my presentation I saw lots of Microsoft Product Team members. Well, it really went well and I had a really good discussion with attendees of the session. I felt that a well begin was half-done and my confidence was regained. Right after the session, I met a few of my Community friends and had meaningful discussions with them on many subjects. The abstract of the session is as follows: In this 30-minute demo session, I am going to briefly demonstrate few SQL Server Myths and their resolutions as I back them up with some demo. This demo presentation is a must-attend for all developers and administrators who would come to the event. This is going to be a very quick yet fun session. Pinal Presenting session at TechEd India 2010 Time: 1:00 PM – 2:00 PM Lunch with Somasegar After the session I went to see my daughter, and then I headed right away to the lunch with S. Somasegar – the keynote speaker and senior vice president of the Developer Division at Microsoft. I really thank to Abhishek who made it possible for us. Because of his efforts, all the MVPs had the opportunity to meet such a legendary person and had to talk with them on Microsoft Technology. Though Somasegar is currently holding such a high position in Microsoft, he is very polite and a real gentleman, and how I wish that everybody in industry is like him. Believe me, if you spread love and kindness, then that is what you will receive back. As soon as lunch time was over, I ran to the session hall as my second presentation was about to start. Time: 2:30pm – 3:30pm Session 2: Master Data Services in Microsoft SQL Server 2008 R2 Business Intelligence is a subject which was widely talked about at TechEd. Everybody was interested in this subject, and I did not excuse myself from this great concept as well. I consider myself fortunate as I was presenting on the subject of Master Data Services at TechEd. When I had initially learned this subject, I had a bit of confusion about the usage of this tool. Later on, I decided that I would tackle about how we all developers and DBAs are not able to understand something so simple such as this, and even worst, creating confusion about the technology. During system designing, it is very important to have a reference material or master lookup tables. Well, I talked about the same subject and presented the session keeping that as my center talk. The session went very well and I received lots of interesting questions. I got many compliments for talking about this subject on the real-life scenario. I really thank Rushabh Mehta (CEO, Solid Quality Mentors India) for his supportive suggestions that helped me prepare the slide deck, as well as the subject. Pinal Presenting session at TechEd India 2010 The abstract of the session is as follows: SQL Server Master Data Services will ship with SQL Server 2008 R2 and will improve Microsoft’s platform appeal. This session provides an in-depth demonstration of MDS features and highlights important usage scenarios. Master Data Services enables consistent decision-making process by allowing you to create, manage and propagate changes from a single master view of your business entities. Also, MDS – Master Data-hub which is a vital component, helps ensure the consistency of reporting across systems and deliver faster and more accurate results across the enterprise. We will talk about establishing the basis for a centralized approach to defining, deploying, and managing master data in the enterprise. Pinal Presenting session at TechEd India 2010 The day was still not over for me. I had ran into several friends but we were not able keep our enthusiasm under control about all the rumors saying that SQL Server 2008 R2 was about to be launched tomorrow in the keynote. I then ran to my third and final technical event for the day- a panel discussion with the top technologies of India. Time: 5:00pm – 6:00pm Panel Discussion: Harness the power of Web – SEO and Technical Blogging As I have delivered two technical sessions by this time, I was a bit tired but  not less enthusiastic when I had to talk about Blog and Technology. We discussed many different topics there. I told them that the most important aspect for any blog is its content. We discussed in depth the issues with plagiarism and how to avoid it. Another topic of discussion was how we technology bloggers can create awareness in the Community about what the right kind of blogging is and what morally and technically wrong acts are. A couple of questions were raised about what type of liberty a person can have in terms of writing blogs. Well, it was generically agreed that a blog is mainly a representation of our ideas and thoughts; it should not be governed by external entities. As long as one is writing what they really want to say, but not providing incorrect information or not practicing plagiarism, a blogger should be allowed to express himself. This panel discussion was supposed to be over in an hour, but the interest of the participants was remarkable and so it was extended for 30 minutes more. Finally, we decided to bring to a close the discussion and agreed that we will continue the topic next year. TechEd India Panel Discussion on Web, Technology and SEO Surprisingly, the day was just beginning after doing all of these. By this time, I have almost met all the MVP who arrived at the event, as well as many Microsoft employees. There were lots of Community folks present, too. I decided that I would go to meet several friends from the Community and continue to communicate with me on SQLAuthority.com. I also met Abhishek Baxi and had a good talk with him regarding Win Mobile and Twitter. He also took a very quick video of me wherein I spoke in my mother’s tongue, Gujarati. It was funny that I talked in Gujarati almost all the day, but when I was talking in the interview I could not find the right Gujarati words to speak. I think we all think in English when we think about Technology, so as to address universality. After meeting them, I headed towards the Speakers’ Dinner. Time: 8:00 PM – onwards Speakers Dinner The Speakers’ dinner was indeed a wonderful opportunity for all the speakers to get together and relax. We talked so many different things, from XBOX to Hindi Movies, and from SQL to Samosas. I just could not express how much fun I had. After a long evening, when I returned tmy room and met Shaivi, I just felt instantly relaxed. Kids are really gifts from God. Today was a really long but exciting day. So many things happened in just one day: Visual Studio Lanch, lunch with Somasegar, 2 technical sessions, 1 panel discussion, community leaders meeting, speakers dinner and, last but not leas,t playing with my child! A perfect day! Day 2 – April 13, 2010 Today started with a bang with the excellent keynote by Kamal Hathi who launched SQL Server 2008 R2 in India and demonstrated the power of PowerPivot to all of us. 101 Million Rows in Excel brought lots of applause from the audience. Kamal Hathi Presenting Keynote at TechEd India 2010 The day was a bit easier one for me. I had no sessions today and no events planned. I had a few meetings planned for the second day of the event. I sat in the speaker’s lounge for half a day and met many people there. I attended nearly 9 different meetings today. The subjects of the meetings were very different. Here is a list of the topics of the Community-related meetings: SQL PASS and its involvement in India and subcontinents How to start community blogging Forums and developing aptitude towards technology Ahmedabad/Gandhinagar User Groups and their developments SharePoint and SQL Business Meeting – a client meeting Business Meeting – a potential performance tuning project Business Meeting – Solid Quality Mentors (SolidQ) And family friends Pinal Dave at TechEd India The day passed by so quickly during this meeting. In the evening, I headed to Partners Expo with friends and checked out few of the booths. I really wanted to talk about some of the products, but due to the freebies there was so much crowd that I finally decided to just take the contact details of the partner. I will now start sending them with my queries and, hopefully, I will have my questions answered. Nupur and Shaivi had also one meeting to attend; it was with our family friend Vijay Raj. Vijay is also a person who loves Technology and loves it more than anybody. I see him growing and learning every day, but still remaining as a ‘human’. I believe that if someone acquires as much knowledge as him, that person will become either a computer or cyborg. Here, Vijay is still a kind gentleman and is able to stay as our close family friend. Shaivi was really happy to play with Uncle Vijay. Pinal Dave and Vijay Raj Renuka Prasad, a Microsoft MVP, impressed me with his passion and knowledge of SQL. Every time he gives me credit for his success, I believe that he is very humble. He has way more certifications than me and has worked many more years with SQL compared to me. He is an excellent photographer as well. Most of the photos in this blog post have been taken by him. I told him if ever he wants to do a part time job, he can do the photography very well. Pinal Dave and Renuka Prasad I also met L Srividya from Microsoft, whom I was looking forward to meet. She is a bundle of knowledge that everyone would surely learn a lot from her. I was able to get a few minutes from her and well, I felt confident. She enlightened me with SQL Server BI concepts, domain management and SQL Server security and few other interesting details. I also had a wonderful time talking about SharePoint with fellow Solid Quality Mentor Joy Rathnayake. He is very passionate about SharePoint but when you talk .NET and SQL with him, he is still overwhelmingly knowledgeable. In fact, while talking to him, I figured out that the recent training he delivered was on SQL Server 2008 R2. I told him a joke that it hurts my ego as he is more popular now in SQL training and consulting than me. I am sure all of you agree that working with good people is a gift from God. I am fortunate enough to work with the best of the best Industry experts. It was a great pleasure to hang out with my Community friends – Ahswin Kini, HimaBindu Vejella, Vasudev G, Suprotim Agrawal, Dhananjay, Vikram Pendse, Mahesh Dhola, Mahesh Mitkari,  Manu Zacharia, Shobhan, Hardik Shah, Ashish Mohta, Manan, Subodh Sohani and Sanjay Shetty (of course!) .  (Please let me know if I have met you at the event and forgot your name to list here). Time: 8:00 PM – onwards Community Leaders Dinner After lots of meetings, I headed towards the Community Leaders dinner meeting and met almost all the folks I met in morning. The discussion was almost the same but the real good thing was that we were enjoying it. The food was really good. Nupur was invited in the event, but Shaivi could not come. When Nupur tried to enter the event, she was stopped as Shaivi did not have the pass to enter the dinner. Nupur expressed that Shaivi is only 8 months old and does not eat outside food as well and could not stay by herself at this age, but the door keeper did not agree and asked that without the entry details Shaivi could not go in, but Nupur could. Nupur called me on phone and asked me to help her out. By the time, I was outside; the organizer of the event reached to the door and happily approved Shaivi to join the party. Once in the party, Shaivi had lots of fun meeting so many people. Shaivi Dave and Abhishek Kant Dean Guida (Infragistics President and CEO) and Pinal Dave (SQLAuthority.com) Day 3 – April 14, 2010 Though, it was last day, I was very much excited today as I was about to present my very favorite session. Query Optimization and Performance Tuning is my domain expertise and I make my leaving by consulting and training the same. Today’s session was on the same subject and as an additional twist, another subject about Spatial Database was presented. I was always intrigued with Spatial Database and I have enjoyed learning about it; however, I have never thought about Spatial Indexing before it was decided that I will do this session. I really thank Solid Quality Mentor Dr. Greg Low for his assistance in helping me prepare the slide deck and also review the content. Furthermore, today was really what I call my ‘learning day’ . So far I had not attended any session in TechEd and I felt a bit down for that. Everybody spends their valuable time & money to learn something new and exciting in TechEd and I had not attended a single session at the moment thinking that it was already last day of the event. I did have a plan for the day and I attended two technical sessions before my session of spatial database. I attended 2 sessions of Vinod Kumar. Vinod is a natural storyteller and there was no doubt that his sessions would be jam-packed. People attended his sessions simply because Vinod is syhe speaker. He did not have a single time disappointed audience; he is truly a good speaker. He knows his stuff very well. I personally do not think that in India he can be compared to anyone for SQL. Time: 12:30pm-1:30pm SQL Server Query Optimization, Execution and Debugging Query Performance I really had a fun time attending this session. Vinod made this session very interactive. The entire audience really got into the presentation and started participating in the event. Vinod was presenting a small problem with Query Tuning, which any developer would have encountered and solved with their help in such a fashion that a developer feels he or she have already resolved it. In one question, I was the only one who was ready to answer and Vinod told me in a light tone that I am now allowed to answer it! The audience really found it very amusing. There was a huge crowd around Vinod after the session. Vinod – A master storyteller! Time: 3:45pm-4:45pm Data Recovery / consistency with CheckDB This session was much heavier than the earlier one, and I must say this is my most favorite session I EVER attended in India. In this TechEd I have only attended two sessions, but in my career, I have attended numerous technical sessions not only in India, but all over the world. This session had taken my breath away. One by one, Vinod took the different databases, and started to corrupt them in different ways. Each database has some unique ways to get corrupted. Once that was done, Vinod started to show the DBCC CEHCKDB and demonstrated how it can solve your problem. He finally fixed all the databases with this single tool. I do have a good knowledge of this subject, but let me honestly admit that I have learned a lot from this session. I enjoyed and cheered during this session along with other attendees. I had total satisfaction that, just like everyone, I took advantage of the event and learned something. I am now TECHnically EDucated. Pinal Dave and Vinod Kumar After two very interactive and informative SQL Sessions from Vinod Kumar, the next turn me presenting on Spatial Database and Indexing. I got once again nervous but Vinod told me to stay natural and do my presentation. Well, once I got a huge stage with a total of four projectors and a large crowd, I felt better. Time: 5:00pm-6:00pm Session 3: Developing with SQL Server Spatial and Deep Dive into Spatial Indexing Pinal Presenting session at TechEd India 2010 Pinal Presenting session at TechEd India 2010 I kicked off this session with Michael J Swart‘s beautiful spatial image. This session was the last one for the day but, to my surprise, I had more than 200+ attendees. Slowly, the rain was starting outside and I was worried that the hall would not be full; despite this, there was not a single seat available in the first five minutes of the session. Thanks to all of you for attending my presentation. I had demonstrated the map of world (and India) and quickly explained what  Geographic and Geometry data types in Spatial Database are. This session had interesting story of Indexing and Comparison, as well as how different traditional indexes are from spatial indexing. Pinal Presenting session at TechEd India 2010 Due to the heavy rain during this event, the power went off for about 22 minutes (just an accident – nobodies fault). During these minutes, there were no audio, no video and no light. I continued to address the mass of 200+ people without any audio device and PowerPoint. I must thank the audience because not a single person left from the session. They all stayed in their place, some moved closure to listen to me properly. I noticed that the curiosity and eagerness to learn new things was at the peak even though it was the very last session of the TechEd. Everybody wanted get the maximum knowledge out of this whole event. I was touched by the support from audience. They listened and participated in my session even without any kinds of technology (no ppt, no mike, no AC, nothing). During these 22 minutes, I had completed my theory verbally. Pinal Presenting session at TechEd India 2010 After a while, we got the projector back online and we continued with some exciting demos. Many thanks to Microsoft people who worked energetically in background to get the backup power for project up. I had a very interesting demo wherein I overlaid Bangalore and Hyderabad on the India Map and find their aerial distance between them. After finding the aerial distance, we browsed online and found that SQL Server estimates the exact aerial distance between these two cities, as compared to the factual distance. There was a huge applause from the crowd on the subject that SQL Server takes into the count of the curvature of the earth and finds the precise distances based on details. During the process of finding the distance, I demonstrated a few examples of the indexes where I expressed how one can use those indexes to find these distances and how they can improve the performance of similar query. I also demonstrated few examples wherein we were able to see in which data type the Index is most useful. We finished the demos with a few more internal stuff. Pinal Presenting session at TechEd India 2010 Despite all issues, I was mostly satisfied with my presentation. I think it was the best session I have ever presented at any conference. There was no help from Technology for a while, but I still got lots of appreciation at the end. When we ended the session, the applause from the audience was so loud that for a moment, the rain was not audible. I was truly moved by the dedication of the Technology enthusiasts. Pinal Dave After Presenting session at TechEd India 2010 The abstract of the session is as follows: The Microsoft SQL Server 2008 delivers new spatial data types that enable you to consume, use, and extend location-based data through spatial-enabled applications. Attend this session to learn how to use spatial functionality in next version of SQL Server to build and optimize spatial queries. This session outlines the new geography data type to store geodetic spatial data and perform operations on it, use the new geometry data type to store planar spatial data and perform operations on it, take advantage of new spatial indexes for high performance queries, use the new spatial results tab to quickly and easily view spatial query results directly from within Management Studio, extend spatial data capabilities by building or integrating location-enabled applications through support for spatial standards and specifications and much more. Time: 8:00 PM – onwards Dinner by Sponsors After the lively session during the day, there was another dinner party courtesy of one of the sponsors of TechEd. All the MVPs and several Community leaders were present at the dinner. I would like to express my gratitude to Abhishek Kant for organizing this wonderful event for us. It was a blast and really relaxing in all angles. We all stayed there for a long time and talked about our sweet and unforgettable memories of the event. Pinal Dave and Bijoy Singhal It was really one wonderful event. After writing this much, I say that I have no words to express about how much I enjoyed TechEd. However, it is true that I shared with you only 1% of the total activities I have done at the event. There were so many people I have met, yet were not mentioned here although I wanted to write their names here, too . Anyway, I have learned so many things and up until now, I am not able to get over all the fun I had in this event. Pinal Dave at TechEd India 2010 The Next Days – April 15, 2010 – till today I am still not able to get my mind out of the whole experience I had at TechEd India 2010. It was like a whole Microsoft Family working together to celebrate a happy occasion. TechEd India – Truly An Unforgettable Experience! Reference : Pinal Dave (http://blog.SQLAuthority.com) Filed under: About Me, MVP, Pinal Dave, SQL, SQL Authority, SQL Query, SQL Server, SQL Tips and Tricks, SQLAuthority Author Visit, SQLAuthority News, SQLServer, T SQL, Technology Tagged: TechEd, TechEdIn

    Read the article

  • SQLAuthority News – TechEd India – April 12-14, 2010 Bangalore – An Unforgettable Experience – An Op

    - by pinaldave
    TechEd India was one of the largest Technology events in India led by Microsoft. This event was attended by more than 3,000 technology enthusiasts, making it one of the most well-organized events of the year. Though I attempted to attend almost all the technology events here, I have not seen any bigger or better event in Indian subcontinents other than this. There are 21 Technical Tracks at Tech·Ed India 2010 that span more than 745 learning opportunities. I was fortunate enough to be a part of this whole event as a speaker and a delegate, as well. TechEd India Speaker Badge and A Token of Lifetime Hotel Selection I presented three different sessions at TechEd India and was also a part of panel discussion. (The details of the sessions are given at the end of this blog post.) Due to extensive traveling, I stay away from my family occasionally. For this reason, I took my wife – Nupur and daughter Shaivi (8 months old) to the event along with me. We stayed at the same hotel where the event was organized so as to maximize my time bonding with my family and to have more time in networking with technology community, at the same time. The hotel Lalit Ashok is the largest and most luxurious venue one can find in Bangalore, located in the middle of the city. The cost of the hotel was a bit pricey, but looking at all the advantages, I had decided to ask for a booking there. Hotel Lalit Ashok Nupur Dave and Shaivi Dave Arrival Day – DAY 0 – April 11, 2010 I reached the event a day earlier, and that was one wise decision for I was able to relax a bit and go over my presentation for the next day’s course. I am a kind of person who likes to get everything ready ahead of time. I was also able to enjoy a pleasant evening with several Microsoft employees and my family friends. I even checked out the location where I would be doing presentations the next day. I was fortunate enough to meet Bijoy Singhal from Microsoft who helped me out with a few of the logistics issues that occured the day before. I was not aware of the fact that the very next day he was going to be “The Man” of the TechEd 2010 event. Vinod Kumar from Microsoft was really very kind as he talked to me regarding my subsequent session. He gave me some suggestions which were really helpful that I was able to incorporate them during my presentation. Finally, I was able to meet Abhishek Kant from Microsoft; his valuable suggestions and unlimited passion have inspired many people like me to work with the Community. Pradipta from Microsoft was also around, being extremely busy with logistics; however, in those busy times, he did find some good spare time to have a chat with me and the other Community leaders. I also met Harish Ranganathan and Sachin Rathi, both from Microsoft. It was so interesting to listen to both of them talking about SharePoint. I just have no words to express my overwhelmed spirit because of all these passionate young guys - Pradipta,Vinod, Bijoy, Harish, Sachin and Ahishek (of course!). Map of TechEd India 2010 Event Day 1 – April 12, 2010 From morning until night time, today was truly a very busy day for me. I had two presentations and one panel discussion for the day. Needless to say, I had a few meetings to attend as well. The day started with a keynote from S. Somaseger where he announced the launch of Visual Studio 2010. The keynote area was really eye-catching because of the very large, bigger-than- life uniform screen. This was truly one to show. The title music of the keynote was very interesting and it featured Bijoy Singhal as the model. It was interesting to talk to him afterwards, when we laughed at jokes together about his modeling assignment. TechEd India Keynote Opening Featuring Bijoy TechEd India 2010 Keynote – S. Somasegar Time: 11:15pm – 11:45pm Session 1: True Lies of SQL Server – SQL Myth Buster Following the excellent keynote, I had my very first session on the subject of SQL Server Myth Buster. At first, I was a bit nervous as right after the keynote, for this was my very first session and during my presentation I saw lots of Microsoft Product Team members. Well, it really went well and I had a really good discussion with attendees of the session. I felt that a well begin was half-done and my confidence was regained. Right after the session, I met a few of my Community friends and had meaningful discussions with them on many subjects. The abstract of the session is as follows: In this 30-minute demo session, I am going to briefly demonstrate few SQL Server Myths and their resolutions as I back them up with some demo. This demo presentation is a must-attend for all developers and administrators who would come to the event. This is going to be a very quick yet fun session. Pinal Presenting session at TechEd India 2010 Time: 1:00 PM – 2:00 PM Lunch with Somasegar After the session I went to see my daughter, and then I headed right away to the lunch with S. Somasegar – the keynote speaker and senior vice president of the Developer Division at Microsoft. I really thank to Abhishek who made it possible for us. Because of his efforts, all the MVPs had the opportunity to meet such a legendary person and had to talk with them on Microsoft Technology. Though Somasegar is currently holding such a high position in Microsoft, he is very polite and a real gentleman, and how I wish that everybody in industry is like him. Believe me, if you spread love and kindness, then that is what you will receive back. As soon as lunch time was over, I ran to the session hall as my second presentation was about to start. Time: 2:30pm – 3:30pm Session 2: Master Data Services in Microsoft SQL Server 2008 R2 Business Intelligence is a subject which was widely talked about at TechEd. Everybody was interested in this subject, and I did not excuse myself from this great concept as well. I consider myself fortunate as I was presenting on the subject of Master Data Services at TechEd. When I had initially learned this subject, I had a bit of confusion about the usage of this tool. Later on, I decided that I would tackle about how we all developers and DBAs are not able to understand something so simple such as this, and even worst, creating confusion about the technology. During system designing, it is very important to have a reference material or master lookup tables. Well, I talked about the same subject and presented the session keeping that as my center talk. The session went very well and I received lots of interesting questions. I got many compliments for talking about this subject on the real-life scenario. I really thank Rushabh Mehta (CEO, Solid Quality Mentors India) for his supportive suggestions that helped me prepare the slide deck, as well as the subject. Pinal Presenting session at TechEd India 2010 The abstract of the session is as follows: SQL Server Master Data Services will ship with SQL Server 2008 R2 and will improve Microsoft’s platform appeal. This session provides an in-depth demonstration of MDS features and highlights important usage scenarios. Master Data Services enables consistent decision-making process by allowing you to create, manage and propagate changes from a single master view of your business entities. Also, MDS – Master Data-hub which is a vital component, helps ensure the consistency of reporting across systems and deliver faster and more accurate results across the enterprise. We will talk about establishing the basis for a centralized approach to defining, deploying, and managing master data in the enterprise. Pinal Presenting session at TechEd India 2010 The day was still not over for me. I had ran into several friends but we were not able keep our enthusiasm under control about all the rumors saying that SQL Server 2008 R2 was about to be launched tomorrow in the keynote. I then ran to my third and final technical event for the day- a panel discussion with the top technologies of India. Time: 5:00pm – 6:00pm Panel Discussion: Harness the power of Web – SEO and Technical Blogging As I have delivered two technical sessions by this time, I was a bit tired but  not less enthusiastic when I had to talk about Blog and Technology. We discussed many different topics there. I told them that the most important aspect for any blog is its content. We discussed in depth the issues with plagiarism and how to avoid it. Another topic of discussion was how we technology bloggers can create awareness in the Community about what the right kind of blogging is and what morally and technically wrong acts are. A couple of questions were raised about what type of liberty a person can have in terms of writing blogs. Well, it was generically agreed that a blog is mainly a representation of our ideas and thoughts; it should not be governed by external entities. As long as one is writing what they really want to say, but not providing incorrect information or not practicing plagiarism, a blogger should be allowed to express himself. This panel discussion was supposed to be over in an hour, but the interest of the participants was remarkable and so it was extended for 30 minutes more. Finally, we decided to bring to a close the discussion and agreed that we will continue the topic next year. TechEd India Panel Discussion on Web, Technology and SEO Surprisingly, the day was just beginning after doing all of these. By this time, I have almost met all the MVP who arrived at the event, as well as many Microsoft employees. There were lots of Community folks present, too. I decided that I would go to meet several friends from the Community and continue to communicate with me on SQLAuthority.com. I also met Abhishek Baxi and had a good talk with him regarding Win Mobile and Twitter. He also took a very quick video of me wherein I spoke in my mother’s tongue, Gujarati. It was funny that I talked in Gujarati almost all the day, but when I was talking in the interview I could not find the right Gujarati words to speak. I think we all think in English when we think about Technology, so as to address universality. After meeting them, I headed towards the Speakers’ Dinner. Time: 8:00 PM – onwards Speakers Dinner The Speakers’ dinner was indeed a wonderful opportunity for all the speakers to get together and relax. We talked so many different things, from XBOX to Hindi Movies, and from SQL to Samosas. I just could not express how much fun I had. After a long evening, when I returned tmy room and met Shaivi, I just felt instantly relaxed. Kids are really gifts from God. Today was a really long but exciting day. So many things happened in just one day: Visual Studio Lanch, lunch with Somasegar, 2 technical sessions, 1 panel discussion, community leaders meeting, speakers dinner and, last but not leas,t playing with my child! A perfect day! Day 2 – April 13, 2010 Today started with a bang with the excellent keynote by Kamal Hathi who launched SQL Server 2008 R2 in India and demonstrated the power of PowerPivot to all of us. 101 Million Rows in Excel brought lots of applause from the audience. Kamal Hathi Presenting Keynote at TechEd India 2010 The day was a bit easier one for me. I had no sessions today and no events planned. I had a few meetings planned for the second day of the event. I sat in the speaker’s lounge for half a day and met many people there. I attended nearly 9 different meetings today. The subjects of the meetings were very different. Here is a list of the topics of the Community-related meetings: SQL PASS and its involvement in India and subcontinents How to start community blogging Forums and developing aptitude towards technology Ahmedabad/Gandhinagar User Groups and their developments SharePoint and SQL Business Meeting – a client meeting Business Meeting – a potential performance tuning project Business Meeting – Solid Quality Mentors (SolidQ) And family friends Pinal Dave at TechEd India The day passed by so quickly during this meeting. In the evening, I headed to Partners Expo with friends and checked out few of the booths. I really wanted to talk about some of the products, but due to the freebies there was so much crowd that I finally decided to just take the contact details of the partner. I will now start sending them with my queries and, hopefully, I will have my questions answered. Nupur and Shaivi had also one meeting to attend; it was with our family friend Vijay Raj. Vijay is also a person who loves Technology and loves it more than anybody. I see him growing and learning every day, but still remaining as a ‘human’. I believe that if someone acquires as much knowledge as him, that person will become either a computer or cyborg. Here, Vijay is still a kind gentleman and is able to stay as our close family friend. Shaivi was really happy to play with Uncle Vijay. Pinal Dave and Vijay Raj Renuka Prasad, a Microsoft MVP, impressed me with his passion and knowledge of SQL. Every time he gives me credit for his success, I believe that he is very humble. He has way more certifications than me and has worked many more years with SQL compared to me. He is an excellent photographer as well. Most of the photos in this blog post have been taken by him. I told him if ever he wants to do a part time job, he can do the photography very well. Pinal Dave and Renuka Prasad I also met L Srividya from Microsoft, whom I was looking forward to meet. She is a bundle of knowledge that everyone would surely learn a lot from her. I was able to get a few minutes from her and well, I felt confident. She enlightened me with SQL Server BI concepts, domain management and SQL Server security and few other interesting details. I also had a wonderful time talking about SharePoint with fellow Solid Quality Mentor Joy Rathnayake. He is very passionate about SharePoint but when you talk .NET and SQL with him, he is still overwhelmingly knowledgeable. In fact, while talking to him, I figured out that the recent training he delivered was on SQL Server 2008 R2. I told him a joke that it hurts my ego as he is more popular now in SQL training and consulting than me. I am sure all of you agree that working with good people is a gift from God. I am fortunate enough to work with the best of the best Industry experts. It was a great pleasure to hang out with my Community friends – Ahswin Kini, HimaBindu Vejella, Vasudev G, Suprotim Agrawal, Dhananjay, Vikram Pendse, Mahesh Dhola, Mahesh Mitkari,  Manu Zacharia, Shobhan, Hardik Shah, Ashish Mohta, Manan, Subodh Sohani and Sanjay Shetty (of course!) .  (Please let me know if I have met you at the event and forgot your name to list here). Time: 8:00 PM – onwards Community Leaders Dinner After lots of meetings, I headed towards the Community Leaders dinner meeting and met almost all the folks I met in morning. The discussion was almost the same but the real good thing was that we were enjoying it. The food was really good. Nupur was invited in the event, but Shaivi could not come. When Nupur tried to enter the event, she was stopped as Shaivi did not have the pass to enter the dinner. Nupur expressed that Shaivi is only 8 months old and does not eat outside food as well and could not stay by herself at this age, but the door keeper did not agree and asked that without the entry details Shaivi could not go in, but Nupur could. Nupur called me on phone and asked me to help her out. By the time, I was outside; the organizer of the event reached to the door and happily approved Shaivi to join the party. Once in the party, Shaivi had lots of fun meeting so many people. Shaivi Dave and Abhishek Kant Dean Guida (Infragistics President and CEO) and Pinal Dave (SQLAuthority.com) Day 3 – April 14, 2010 Though, it was last day, I was very much excited today as I was about to present my very favorite session. Query Optimization and Performance Tuning is my domain expertise and I make my leaving by consulting and training the same. Today’s session was on the same subject and as an additional twist, another subject about Spatial Database was presented. I was always intrigued with Spatial Database and I have enjoyed learning about it; however, I have never thought about Spatial Indexing before it was decided that I will do this session. I really thank Solid Quality Mentor Dr. Greg Low for his assistance in helping me prepare the slide deck and also review the content. Furthermore, today was really what I call my ‘learning day’ . So far I had not attended any session in TechEd and I felt a bit down for that. Everybody spends their valuable time & money to learn something new and exciting in TechEd and I had not attended a single session at the moment thinking that it was already last day of the event. I did have a plan for the day and I attended two technical sessions before my session of spatial database. I attended 2 sessions of Vinod Kumar. Vinod is a natural storyteller and there was no doubt that his sessions would be jam-packed. People attended his sessions simply because Vinod is syhe speaker. He did not have a single time disappointed audience; he is truly a good speaker. He knows his stuff very well. I personally do not think that in India he can be compared to anyone for SQL. Time: 12:30pm-1:30pm SQL Server Query Optimization, Execution and Debugging Query Performance I really had a fun time attending this session. Vinod made this session very interactive. The entire audience really got into the presentation and started participating in the event. Vinod was presenting a small problem with Query Tuning, which any developer would have encountered and solved with their help in such a fashion that a developer feels he or she have already resolved it. In one question, I was the only one who was ready to answer and Vinod told me in a light tone that I am now allowed to answer it! The audience really found it very amusing. There was a huge crowd around Vinod after the session. Vinod – A master storyteller! Time: 3:45pm-4:45pm Data Recovery / consistency with CheckDB This session was much heavier than the earlier one, and I must say this is my most favorite session I EVER attended in India. In this TechEd I have only attended two sessions, but in my career, I have attended numerous technical sessions not only in India, but all over the world. This session had taken my breath away. One by one, Vinod took the different databases, and started to corrupt them in different ways. Each database has some unique ways to get corrupted. Once that was done, Vinod started to show the DBCC CEHCKDB and demonstrated how it can solve your problem. He finally fixed all the databases with this single tool. I do have a good knowledge of this subject, but let me honestly admit that I have learned a lot from this session. I enjoyed and cheered during this session along with other attendees. I had total satisfaction that, just like everyone, I took advantage of the event and learned something. I am now TECHnically EDucated. Pinal Dave and Vinod Kumar After two very interactive and informative SQL Sessions from Vinod Kumar, the next turn me presenting on Spatial Database and Indexing. I got once again nervous but Vinod told me to stay natural and do my presentation. Well, once I got a huge stage with a total of four projectors and a large crowd, I felt better. Time: 5:00pm-6:00pm Session 3: Developing with SQL Server Spatial and Deep Dive into Spatial Indexing Pinal Presenting session at TechEd India 2010 Pinal Presenting session at TechEd India 2010 I kicked off this session with Michael J Swart‘s beautiful spatial image. This session was the last one for the day but, to my surprise, I had more than 200+ attendees. Slowly, the rain was starting outside and I was worried that the hall would not be full; despite this, there was not a single seat available in the first five minutes of the session. Thanks to all of you for attending my presentation. I had demonstrated the map of world (and India) and quickly explained what  Geographic and Geometry data types in Spatial Database are. This session had interesting story of Indexing and Comparison, as well as how different traditional indexes are from spatial indexing. Pinal Presenting session at TechEd India 2010 Due to the heavy rain during this event, the power went off for about 22 minutes (just an accident – nobodies fault). During these minutes, there were no audio, no video and no light. I continued to address the mass of 200+ people without any audio device and PowerPoint. I must thank the audience because not a single person left from the session. They all stayed in their place, some moved closure to listen to me properly. I noticed that the curiosity and eagerness to learn new things was at the peak even though it was the very last session of the TechEd. Everybody wanted get the maximum knowledge out of this whole event. I was touched by the support from audience. They listened and participated in my session even without any kinds of technology (no ppt, no mike, no AC, nothing). During these 22 minutes, I had completed my theory verbally. Pinal Presenting session at TechEd India 2010 After a while, we got the projector back online and we continued with some exciting demos. Many thanks to Microsoft people who worked energetically in background to get the backup power for project up. I had a very interesting demo wherein I overlaid Bangalore and Hyderabad on the India Map and find their aerial distance between them. After finding the aerial distance, we browsed online and found that SQL Server estimates the exact aerial distance between these two cities, as compared to the factual distance. There was a huge applause from the crowd on the subject that SQL Server takes into the count of the curvature of the earth and finds the precise distances based on details. During the process of finding the distance, I demonstrated a few examples of the indexes where I expressed how one can use those indexes to find these distances and how they can improve the performance of similar query. I also demonstrated few examples wherein we were able to see in which data type the Index is most useful. We finished the demos with a few more internal stuff. Pinal Presenting session at TechEd India 2010 Despite all issues, I was mostly satisfied with my presentation. I think it was the best session I have ever presented at any conference. There was no help from Technology for a while, but I still got lots of appreciation at the end. When we ended the session, the applause from the audience was so loud that for a moment, the rain was not audible. I was truly moved by the dedication of the Technology enthusiasts. Pinal Dave After Presenting session at TechEd India 2010 The abstract of the session is as follows: The Microsoft SQL Server 2008 delivers new spatial data types that enable you to consume, use, and extend location-based data through spatial-enabled applications. Attend this session to learn how to use spatial functionality in next version of SQL Server to build and optimize spatial queries. This session outlines the new geography data type to store geodetic spatial data and perform operations on it, use the new geometry data type to store planar spatial data and perform operations on it, take advantage of new spatial indexes for high performance queries, use the new spatial results tab to quickly and easily view spatial query results directly from within Management Studio, extend spatial data capabilities by building or integrating location-enabled applications through support for spatial standards and specifications and much more. Time: 8:00 PM – onwards Dinner by Sponsors After the lively session during the day, there was another dinner party courtesy of one of the sponsors of TechEd. All the MVPs and several Community leaders were present at the dinner. I would like to express my gratitude to Abhishek Kant for organizing this wonderful event for us. It was a blast and really relaxing in all angles. We all stayed there for a long time and talked about our sweet and unforgettable memories of the event. Pinal Dave and Bijoy Singhal It was really one wonderful event. After writing this much, I say that I have no words to express about how much I enjoyed TechEd. However, it is true that I shared with you only 1% of the total activities I have done at the event. There were so many people I have met, yet were not mentioned here although I wanted to write their names here, too . Anyway, I have learned so many things and up until now, I am not able to get over all the fun I had in this event. Pinal Dave at TechEd India 2010 The Next Days – April 15, 2010 – till today I am still not able to get my mind out of the whole experience I had at TechEd India 2010. It was like a whole Microsoft Family working together to celebrate a happy occasion. TechEd India – Truly An Unforgettable Experience! Reference : Pinal Dave (http://blog.SQLAuthority.com) Filed under: About Me, MVP, Pinal Dave, SQL, SQL Authority, SQL Query, SQL Server, SQL Tips and Tricks, SQLAuthority Author Visit, SQLAuthority News, SQLServer, T SQL, Technology Tagged: TechEd, TechEdIn

    Read the article

  • How to make a sum of total for each id

    - by JetJack
    Using Crystal report 7 I want to view the table 1 and sum of table2 table1 id name 001 raja 002 vijay 003 suresh .... table2 id value 001 100 001 200 001 150 002 200 003 150 003 200 ... I want to display all the rows from table1 and sum(values) from table2. How to do this in crystal report Expected Output id name value 001 raja 450 002 vijay 200 003 suresh 350 .... Note: I add the table field directly to the report, i am not added store procedure or views or query in the report. How to do this. Need Crystal report help

    Read the article

  • Cannot delete a SharePoint web application

    - by Vijay
    What I have? I have normal web application and it has 3 site collections with name, "PDirectory". Other than this I have only Central administration web application in the farm. What I want? I want to delete that web application, "PDirectory". What problem am I facing? I am not able to delete the web application. I get below error when I try to delete it but, the site collections got deleted! Error: An object in the SharePoint administrative framework, "SPWebApplication Name=XXX Parent=SPWebService", could not be deleted because other objects depend on it. Update all of these dependants to point to null or different objects and retry this operation. The dependant objects are as follows: SPFarm Name=SharePoint_Config SPFarm Name=SharePoint_Config at Microsoft.SharePoint.Administration.SPConfigurationDatabase.DeleteObject(Guid id) at Microsoft.SharePoint.Administration.SPConfigurationDatabase.DeleteObject(SPPersistedObject obj) at Microsoft.SharePoint.Administration.SPPersistedObject.Delete() at Microsoft.SharePoint.Administration.SPWebApplication.Delete() at Microsoft.SharePoint.ApplicationPages.DeleteWebApplicationPage.BtnSubmit_Click(Object sender, EventArgs e) at System.Web.UI.WebControls.Button.OnClick(EventArgs e) at System.Web.UI.WebControls.Button.RaisePostBackEvent(String eventArgument) at System.Web.UI.WebControls.Button.System.Web.UI.IPostBackEventHandler.RaisePostBackEvent(String eventArgument) at System.Web.UI.Page.RaisePostBackEvent(IPostBackEventHandler sourceControl, String eventArgument) at System.Web.UI.Page.RaisePostBackEvent(NameValueCollection postData) at System.Web.UI.Page.ProcessRequestMain(Boolean includeStagesBeforeAsyncPoint, Boolean includeStagesAfterAsyncPoint) Can somebody tell me how I can delete this web application? Thanks in advance!

    Read the article

  • Unexpected behaviour when dynamically add node in HAproxy server

    - by Anand Soni
    I wanted to use HAProxy for my web app for load balancing purpose. I am trying to add a new rabbitmq node dynamically in HAProxy server using command : haproxy -p /var/run/haproxy.pid -sf $(cat /var/run/haproxy.pid). I am doing tcp connection mode with leastconn balance algorithm in load balancing. What is expected is when there is 3 connection in one rabbitmq, I add a new rabbit server in HAProxy server. so the next connection would pass to 2nd rabbitmq server which is not happening in my case. It distributes the connection in haphazardly manner. Here is my config file: defaults log global mode http option httplog option dontlognull retries 3 option redispatch maxconn 2000 contimeout 5000 clitimeout 5000 srvtimeout 5000 listen rabbitmq 0.0.0.0:5672 mode tcp stats enable balance leastconn option tcplog server rabbit01 xx.xx.xx.xx:5672 check server rabbit02 xx.xx.xx.xx:5672 check listen tomcatq 0.0.0.0:80 mode http stats enable balance roundrobin stats refresh 10s stats refresh 10s stats uri /lb?stats stats auth admin:admin option httplog What is the problem causing this behavior? Any suggestion will appreciated.

    Read the article

  • Tomcat shudown does not kill process

    - by vijay.shad
    Hi all, I have got some problems with my tomcat instance. I am using apache-tomcat-6.0.20 for linux.My OS is CENTOS when I execute command # bin/shutdown.sh It does not close the process that is running the tomcat. Can any body please give me some idea; what is happening with the process.

    Read the article

  • Connecting CR 2008 and Oracle database: "TNS file could not be opened"

    - by anand
    I am trying to connect to an Oracle database using CR 2008 drivers for oracle (specifically OLE db driver). When I try to connect I provide the correct connection parameters however I keep getting "TNS file could not be opened" error. I am very confused about this message does this mean I am missing some component? From my understanding the driver should be able to connect. Currently on the computer running Crystal reports there is only has Crystal reports 2008 installed. Do i need to install the oracle instant client on the CR computer in order to make a proper connection? Any suggestions would be greatly appreciated!

    Read the article

< Previous Page | 1 2 3 4 5 6 7 8 9 10 11 12  | Next Page >