Search Results

Search found 21111 results on 845 pages for 'null pointer'.

Page 414/845 | < Previous Page | 410 411 412 413 414 415 416 417 418 419 420 421  | Next Page >

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • migrating from Prototype to jQuery in Rails, having trouble with duplicate get request

    - by aressidi
    I'm in the process of migrating from Prototype to jQuery and moving all JS outside of the view files. All is going fairly well with one exception. Here's what I'm trying to do, and the problem I'm having. I have a diary where users can update records in-line in the page like so: user clicks 'edit' link to edit an entry in the diary a get request is performed via jQuery and an edit form is displayed allowing the user to modify the record user updates the record, the form disappears and the updated record is shown in place of the form All of that works so far. The problem arises when: user updates a record user clicks 'edit' to update another record in this case, the edit form is shown twice! In firebug I get a status code 200 when the form shows, and then moments later, another edit form shows again with a status code of 304 I only want the form to show once, not twice. The form shows twice only after I update a record, otherwise everything works fine. Here's the code, any ideas? I think this might have to do with the fact that in food_item_update.js I call the editDiaryEntry() after a record is updated, but if I don't call that function and try and update the record after it's been modified, then it just spits up the .js.erb response on the screen. That's also why I have the editDiaryEntry() in the add_food.js.erb file. Any help would be greatly appreciated. diary.js jQuery(document).ready(function() { postFoodEntry(); editDiaryEntry(); initDatePicker(); }); function postFoodEntry() { jQuery('form#add_entry').submit(function(e) { e.preventDefault(); jQuery.post(this.action, jQuery(this).serialize(), null, "script"); // return this }); } function editDiaryEntry() { jQuery('.edit_link').click(function(e) { e.preventDefault(); // This should look to see if one version of this is open... if (jQuery('#edit_container_' + this.id).length == 0 ) { jQuery.get('/diary/entry/edit', {id: this.id}, null, "script"); } }); } function closeEdit () { jQuery('.close_edit').click(function(e) { e.preventDefault(); jQuery('.entry_edit_container').remove(); jQuery("#entry_" + this.id).show(); }); } function updateDiaryEntry() { jQuery('.edit_entry_form').submit(function(e) { e.preventDefault(); jQuery.post(this.action, $(this).serialize(), null, "script"); }); } function initDatePicker() { jQuery("#date, #edit_date").datepicker(); }; add_food.js.erb jQuery("#entry_alert").show(); jQuery('#add_entry')[ 0 ].reset(); jQuery('#diary_entries').html("<%= escape_javascript(render :partial => 'members/diary/diary_entries', :object => @diary, :locals => {:record_counter => 0, :date_header => 0, :edit_mode => @diary_edit}, :layout => false ) %>"); jQuery('#entry_alert').html("<%= escape_javascript(render :partial => 'members/diary/entry_alert', :locals => {:type => @type, :message => @alert_message}) %>"); jQuery('#entry_alert').show(); setTimeout(function() { jQuery('#entry_alert').fadeOut('slow'); }, 5000); editDiaryEntry(); food_item_edit.js.erb jQuery("#entry_<%= @entry.id %>").hide(); jQuery("#entry_<%= @entry.id %>").after("<%= escape_javascript(render :partial => 'members/diary/food_item_edit', :locals => {:user_food_profile => @entry}) %>"); closeEdit(); updateDiaryEntry(); initDatePicker(); food_item_update.js jQuery("#entry_<%= @entry.id %>").replaceWith("<%= escape_javascript(render :partial => 'members/diary/food_item', :locals => {:entry => @entry, :total_calories => 0}) %>"); jQuery('.entry_edit_container').remove(); editDiaryEntry();

    Read the article

  • Fluent NHibernate/SQL Server 2008 insert query problem

    - by Mark
    Hi all, I'm new to Fluent NHibernate and I'm running into a problem. I have a mapping defined as follows: public PersonMapping() { Id(p => p.Id).GeneratedBy.HiLo("1000"); Map(p => p.FirstName).Not.Nullable().Length(50); Map(p => p.MiddleInitial).Nullable().Length(1); Map(p => p.LastName).Not.Nullable().Length(50); Map(p => p.Suffix).Nullable().Length(3); Map(p => p.SSN).Nullable().Length(11); Map(p => p.BirthDate).Nullable(); Map(p => p.CellPhone).Nullable().Length(12); Map(p => p.HomePhone).Nullable().Length(12); Map(p => p.WorkPhone).Nullable().Length(12); Map(p => p.OtherPhone).Nullable().Length(12); Map(p => p.EmailAddress).Nullable().Length(50); Map(p => p.DriversLicenseNumber).Nullable().Length(50); Component<Address>(p => p.CurrentAddress, m => { m.Map(p => p.Line1, "Line1").Length(50); m.Map(p => p.Line2, "Line2").Length(50); m.Map(p => p.City, "City").Length(50); m.Map(p => p.State, "State").Length(50); m.Map(p => p.Zip, "Zip").Length(2); }); Map(p => p.EyeColor).Nullable().Length(3); Map(p => p.HairColor).Nullable().Length(3); Map(p => p.Gender).Nullable().Length(1); Map(p => p.Height).Nullable(); Map(p => p.Weight).Nullable(); Map(p => p.Race).Nullable().Length(1); Map(p => p.SkinTone).Nullable().Length(3); HasMany(p => p.PriorAddresses).Cascade.All(); } public PreviousAddressMapping() { Table("PriorAddress"); Id(p => p.Id).GeneratedBy.HiLo("1000"); Map(p => p.EndEffectiveDate).Not.Nullable(); Component<Address>(p => p.Address, m => { m.Map(p => p.Line1, "Line1").Length(50); m.Map(p => p.Line2, "Line2").Length(50); m.Map(p => p.City, "City").Length(50); m.Map(p => p.State, "State").Length(50); m.Map(p => p.Zip, "Zip").Length(2); }); } My test is [Test] public void can_correctly_map_Person_with_Addresses() { var myPerson = new Person("Jane", "", "Doe"); var priorAddresses = new[] { new PreviousAddress(ObjectMother.GetAddress1(), DateTime.Parse("05/13/2010")), new PreviousAddress(ObjectMother.GetAddress2(), DateTime.Parse("05/20/2010")) }; new PersistenceSpecification<Person>(Session) .CheckProperty(c => c.FirstName, myPerson.FirstName) .CheckProperty(c => c.LastName, myPerson.LastName) .CheckProperty(c => c.MiddleInitial, myPerson.MiddleInitial) .CheckList(c => c.PriorAddresses, priorAddresses) .VerifyTheMappings(); } GetAddress1() (yeah, horrible name) has Line2 == null The tables seem to be created correctly in sql server 2008, but the test fails with a SQLException "String or binary data would be truncated." When I grab the sql statement in SQL Profiler, I get exec sp_executesql N'INSERT INTO PriorAddress (Line1, Line2, City, State, Zip, EndEffectiveDate, Id) VALUES (@p0, @p1, @p2, @p3, @p4, @p5, @p6)',N'@p0 nvarchar(18),@p1 nvarchar(4000),@p2 nvarchar(10),@p3 nvarchar(2),@p4 nvarchar(5),@p5 datetime,@p6 int',@p0=N'6789 Somewhere Rd.',@p1=NULL,@p2=N'Hot Coffee',@p3=N'MS',@p4=N'09876',@p5='2010-05-13 00:00:00',@p6=1001 Notice the @p1 parameter is being set to nvarchar(4000) and being passed a NULL value. Why is it setting the parameter to nvarchar(4000)? How can I fix it? Thanks!

    Read the article

  • login form whith java/sqlite

    - by tuxou
    hi I would like to create a login form for my application with the possibility to add or remove users for an sqlite database, i have created the table users(nam, pass) but i can't unclud it in my login form, it someone could help me this is my login code: import java.awt.*; import java.awt.event.*; import javax.swing.*; public class login extends JFrame { // Variables declaration private JLabel jLabel1; private JLabel jLabel2; private JTextField jTextField1; private JPasswordField jPasswordField1; private JButton jButton1; private JPanel contentPane; // End of variables declaration public login() { super(); create(); this.setVisible(true); } private void create() { jLabel1 = new JLabel(); jLabel2 = new JLabel(); jTextField1 = new JTextField(); jPasswordField1 = new JPasswordField(); jButton1 = new JButton(); contentPane = (JPanel)this.getContentPane(); // // jLabel1 // jLabel1.setHorizontalAlignment(SwingConstants.LEFT); jLabel1.setForeground(new Color(0, 0, 255)); jLabel1.setText("username:"); // // jLabel2 // jLabel2.setHorizontalAlignment(SwingConstants.LEFT); jLabel2.setForeground(new Color(0, 0, 255)); jLabel2.setText("password:"); // // jTextField1 // jTextField1.setForeground(new Color(0, 0, 255)); jTextField1.setSelectedTextColor(new Color(0, 0, 255)); jTextField1.setToolTipText("Enter your username"); jTextField1.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { jTextField1_actionPerformed(e); } }); // // jPasswordField1 // jPasswordField1.setForeground(new Color(0, 0, 255)); jPasswordField1.setToolTipText("Enter your password"); jPasswordField1.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { jPasswordField1_actionPerformed(e); } }); // // jButton1 // jButton1.setBackground(new Color(204, 204, 204)); jButton1.setForeground(new Color(0, 0, 255)); jButton1.setText("Login"); jButton1.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { jButton1_actionPerformed(e); } }); // // contentPane // contentPane.setLayout(null); contentPane.setBorder(BorderFactory.createEtchedBorder()); contentPane.setBackground(new Color(204, 204, 204)); addComponent(contentPane, jLabel1, 5,10,106,18); addComponent(contentPane, jLabel2, 5,47,97,18); addComponent(contentPane, jTextField1, 110,10,183,22); addComponent(contentPane, jPasswordField1, 110,45,183,22); addComponent(contentPane, jButton1, 150,75,83,28); // // login // this.setTitle("Login To Members Area"); this.setLocation(new Point(76, 182)); this.setSize(new Dimension(335, 141)); this.setDefaultCloseOperation(WindowConstants.EXIT_ON_CLOSE); this.setResizable(false); } /** Add Component Without a Layout Manager (Absolute Positioning) */ private void addComponent(Container container,Component c,int x,int y,int width,int height) { c.setBounds(x,y,width,height); container.add(c); } private void jTextField1_actionPerformed(ActionEvent e) { } private void jPasswordField1_actionPerformed(ActionEvent e) { } private void jButton1_actionPerformed(ActionEvent e) { System.out.println("\njButton1_actionPerformed(ActionEvent e) called."); String username = new String(jTextField1.getText()); String password = new String(jPasswordField1.getText()); if(username.equals("") || password.equals("")) // If password and username is empty Do this { jButton1.setEnabled(false); JLabel errorFields = new JLabel("You must enter a username and password to login."); JOptionPane.showMessageDialog(null,errorFields); jTextField1.setText(""); jPasswordField1.setText(""); jButton1.setEnabled(true); this.setVisible(true); } else { JLabel optionLabel = new JLabel("You entered "+username+" as your username. Is this correct?"); int confirm =JOptionPane.showConfirmDialog(null,optionLabel); switch(confirm){ // Switch Case case JOptionPane.YES_OPTION: // Attempt to Login user jButton1.setEnabled(false); // Set button enable to false to prevent 2 login attempts break; case JOptionPane.NO_OPTION: // No Case.(Go back. Set text to 0) jButton1.setEnabled(false); jTextField1.setText(""); jPasswordField1.setText(""); jButton1.setEnabled(true); break; case JOptionPane.CANCEL_OPTION: // Cancel Case.(Go back. Set text to 0) jButton1.setEnabled(false); jTextField1.setText(""); jPasswordField1.setText(""); jButton1.setEnabled(true); break; } // End Switch Case } } public static void main(String[] args) { JFrame.setDefaultLookAndFeelDecorated(true); JDialog.setDefaultLookAndFeelDecorated(true); try { UIManager.setLookAndFeel("com.sun.java.swing.plaf.windows.WindowsLookAndFeel"); } catch (Exception ex) { System.out.println("Failed loading L&F: "); System.out.println(ex); } new login(); }; }

    Read the article

  • Access Violation

    - by Justin
    I've been learning how to NOP functions in C++ or even C but there are very few tutorials online about it. I've been googling for the past few hours now and I'm just stuck. Here is my code. #include <iostream> #include <windows.h> #include <tlhelp32.h> using namespace std; //#define NOP 0x90 byte NOP[] = {0x90}; void enableDebugPrivileges() { HANDLE hcurrent=GetCurrentProcess(); HANDLE hToken; BOOL bret=OpenProcessToken(hcurrent,40,&hToken); LUID luid; bret=LookupPrivilegeValue(NULL,"SeDebugPrivilege",&luid); TOKEN_PRIVILEGES NewState,PreviousState; DWORD ReturnLength; NewState.PrivilegeCount =1; NewState.Privileges[0].Luid =luid; NewState.Privileges[0].Attributes=2; AdjustTokenPrivileges(hToken,FALSE,&NewState,28,&PreviousState,&ReturnLength); } DWORD GetProcId(char* ProcName) { PROCESSENTRY32 pe32; HANDLE hSnapshot = NULL; pe32.dwSize = sizeof( PROCESSENTRY32 ); hSnapshot = CreateToolhelp32Snapshot( TH32CS_SNAPPROCESS, 0 ); if( Process32First( hSnapshot, &pe32 ) ) { do{ if( strcmp( pe32.szExeFile, ProcName ) == 0 ) break; }while( Process32Next( hSnapshot, &pe32 ) ); } if( hSnapshot != INVALID_HANDLE_VALUE ) CloseHandle( hSnapshot ); return pe32.th32ProcessID; } void WriteMem(DWORD Address, void* Value, size_t Size) { DWORD Protect = NULL; VirtualProtect((LPVOID)Address, 3, PAGE_READWRITE, &Protect); memcpy((void*)Address, Value, 3); VirtualProtect((LPVOID)Address, 3, Protect, &Protect); } void nop_(PVOID address, int bytes){ DWORD d, ds; VirtualProtect(address, bytes, PAGE_EXECUTE_READWRITE, &d); memset(address, 144, bytes); VirtualProtect(address,bytes,d,&ds); } void MemCopy(HANDLE pHandle, void* Dest, const void* Src, int Len) { DWORD OldProtect; DWORD OldProtect2; VirtualProtect(Dest, Len, PAGE_EXECUTE_READWRITE, &OldProtect); memcpy(Dest, Src, Len); VirtualProtect(Dest, Len, OldProtect, &OldProtect2); FlushInstructionCache(pHandle, Dest, Len); } int main() { enableDebugPrivileges(); DWORD pid; HANDLE phandle; // Obtain the process ID pid = GetProcId("gr.exe"); if(GetLastError()) { cout << "Error_PID_: " << GetLastError() << endl; system("pause"); return -1; } // Obtain the process handle phandle = OpenProcess(PROCESS_ALL_ACCESS,0,pid); if(GetLastError()) { cout << "Error_HANDLE_: " << GetLastError() << endl; system("pause"); return -1; } // Debug info, 0 = bad cout <<"pid : " << pid << endl; cout <<"HANDLE: " << phandle << endl << endl; system("pause"); // Change value to short iValue = -1; int choice = 0; BYTE * bGodMode = (BYTE *) (0x409A7E); // Lives Address bool hack = true; while(hack) { system("cls"); cout << "What hack?\n0. Exit\n1. Lives\n\n!> "; cin >> choice; switch(choice) { case 0: { hack=false; break; } case 1: // Modify Time cout << "God Mode On\n!> "; // cin >> iValue; // nop_((PVOID)(0x409A7E), 3); // MemCopy(phandle, (PVOID)0x409A7E, &NOP, 1); WriteMem((DWORD)(0x00409A7E), (void*)NOP, sizeof NOP); if(GetLastError()) { cout << "Error: " << GetLastError() << endl; system("pause"); } break; default: cout << "ERROR!\n"; break; } Sleep(100); } system("pause"); return 0; } This is suppose to NOP the DEC function that is 3 bytes long preventing me from losing lives. However each time I try it, it crashes the hack and says I had a access violation. I tried to look up the reasons and most of them dealt with with the size of the location I'm writing to and what I'm copying from. Otherwise, I have absolutely no idea. Any help would be nice. The game is GunRoar and the base address "0x409A7E" is where the DEC function is.

    Read the article

  • Javascript: Can't control parent of descendant nodes.

    - by .phjasper
    I'm creating elements (level 1) dynamically which in turn create elements (level 2) themselves. However, the children of level 2 elements have "body" as their parent. In the HTML code below, the content if spotAd2 is created by my function createNode(). It's a Google Ad Sense tag. However, the Google Ad Sense tag create elements that went directly under "body". I need them to by under spotAd2. function createNode( t, // type. tn, // if type is element, tag name. a, // if type is element, attributes. v, // node value or text content p, // parent f ) // whether to make dist the first child or not. { n = null; switch( t ) { case "element": n = document.createElement( tn ); if( a ) { for( k in a ) { n.setAttribute( k, a[ k ] ); } } break; case "text": case "cdata_section": case "comment": n = document.createTextNode(v); break; } if ( p ) { if( f ) { p.insertBefore( n, p.firstChild ); } else { p.appendChild( n ); } } return n; } spotAd2 = document.getElementById("spotAd2"); n1 = createNode("element", "div", {"id":"tnDiv1"}, "\n" , null, true); n2 = createNode("element", "script", {"type":"text\/javascript"}, "\n" , n1, false); n3 = createNode("comment", "", null, "\n" + "google_ad_client = \"pub-0321943928525350\";\n" + "/* 728x90 (main top) */\n" + "google_ad_slot = \"2783893649\";\n" + "google_ad_width = 728;\n" + "google_ad_height = 90;\n" + "//\n" , n2, false); n4 = createNode("element", "script", {"type":"text\/javascript","src":"http:\/\/pagead2.googlesyndication.com\/pagead\/show_ads.js"}, "\n" , n1, false); --- Result: <body> <table cellspacing="2" cellpadding="2" border="1"> <tbody><tr> <td>Oel ngati kemeie</td> <td>Kamakto niwin</td> </tr> <tr> <td>The ad:</td> <td> <div id="spotAd2"> <!-- Created by createNode() --> <div id="tnDiv1"> <script type="text/javascript"> google_ad_client = "pub-0321943928525350"; /* 728x90 (main top) */ google_ad_slot = "2783893649"; google_ad_width = 728; google_ad_height = 90; </script> <script type="text/javascript" src="http://pagead2.googlesyndication.com/pagead/show_ads.js"></script> </div> <!-- Created by createNode() --> </div> </td> </tr> <tr> <td>txopu ra'a tsi, tsamsiyu</td> <td>teyrakup skxawng</td> </tr> </tbody></table> <!-- Created by adsense tag, need these to be under tnDiv1 --> <script src="http://pagead2.googlesyndication.com/pagead/expansion_embed.js"></script> <script src="http://googleads.g.doubleclick.net/pagead/test_domain.js"></script> <script>google_protectAndRun("ads_core.google_render_ad", google_handleError, google_render_ad);</script> <ins style="border: medium none ; margin: 0pt; padding: 0pt; display: inline-table; height: 90px; position: relative; visibility: visible; width: 728px;"> <ins style="border: medium none ; margin: 0pt; padding: 0pt; display: block; height: 90px; position: relative; visibility: visible; width: 728px;"> <iframe width="728" scrolling="no" height="90" frameborder="0" vspace="0" style="left: 0pt; position: absolute; top: 0pt;" src="http://googleads.g.doubleclick.net/pagead/ads?client=ca-pub-0321943928525350&amp;output=html&amp;h=90&amp;slotname=2783893649&amp;w=728&amp;lmt=1273708979&amp;flash=10.0.45&amp;url=http%3A%2F%2Fkenshin.katanatechworks.com%2Ftest%2FadsBrowserSide.php&amp;dt=1273708980294&amp;shv=r20100422&amp;correlator=1273708980298&amp;frm=0&amp;ga_vid=695691836.1273708981&amp;ga_sid=1273708981&amp;ga_hid=1961182006&amp;ga_fc=0&amp;u_tz=480&amp;u_his=2&amp;u_java=1&amp;u_h=1080&amp;u_w=1920&amp;u_ah=1052&amp;u_aw=1920&amp;u_cd=24&amp;u_nplug=5&amp;u_nmime=38&amp;biw=1394&amp;bih=324&amp;fu=0&amp;ifi=1&amp;dtd=955&amp;xpc=Jl67G4xiq6&amp;p=http%3A//kenshin.katanatechworks.com" name="google_ads_frame" marginwidth="0" marginheight="0" id="google_ads_frame1" hspace="0" allowtransparency="true"> </iframe> </ins> </ins> <!-- Created by adsense tag, need these to be under tnDiv1 --> </body>

    Read the article

  • SetWindowHookEx and execution blocking

    - by Kalaz
    Hello, I just wonder... I mainly use .NET but now I started to investigate WINAPI calls. For example I am using this piece of code to hook to the API functions. It starts freezing, when I try to debug the application... using System; using System.Diagnostics; using System.Runtime.InteropServices; using System.Threading; using System.Windows.Forms; public class Keyboard { private const int WH_KEYBOARD_LL = 13; private const int WM_KEYDOWN = 0x0100; private static LowLevelKeyboardProc _proc = HookCallback; private static IntPtr _hookID = IntPtr.Zero; public static event Action<Keys,bool, bool> KeyDown; public static void Hook() { new Thread(new ThreadStart(()=> { _hookID = SetHook(_proc); Application.Run(); })).Start(); } public static void Unhook() { UnhookWindowsHookEx(_hookID); } private static IntPtr SetHook(LowLevelKeyboardProc proc) { using (Process curProcess = Process.GetCurrentProcess()) using (ProcessModule curModule = curProcess.MainModule) { return SetWindowsHookEx(WH_KEYBOARD_LL, proc, GetModuleHandle(curModule.ModuleName), 0); } } private delegate IntPtr LowLevelKeyboardProc( int nCode, IntPtr wParam, IntPtr lParam); private static IntPtr HookCallback( int nCode, IntPtr wParam, IntPtr lParam) { if (nCode >= 0 && wParam == (IntPtr)WM_KEYDOWN) { int vkCode = Marshal.ReadInt32(lParam); Keys k = (Keys) vkCode; if (KeyDown != null) { KeyDown.BeginInvoke(k, IsKeyPressed(VirtualKeyStates.VK_CONTROL), IsKeyPressed(VirtualKeyStates.VK_SHIFT),null,null); } } return CallNextHookEx(_hookID, nCode, wParam, lParam); } private static bool IsKeyPressed(VirtualKeyStates virtualKeyStates) { return (GetKeyState(virtualKeyStates) & (1 << 7))==128; } [DllImport("user32.dll", CharSet = CharSet.Auto, SetLastError = true)] private static extern IntPtr SetWindowsHookEx(int idHook, LowLevelKeyboardProc lpfn, IntPtr hMod, uint dwThreadId); [DllImport("user32.dll", CharSet = CharSet.Auto, SetLastError = true)] [return: MarshalAs(UnmanagedType.Bool)] private static extern bool UnhookWindowsHookEx(IntPtr hhk); [DllImport("user32.dll", CharSet = CharSet.Auto, SetLastError = true)] private static extern IntPtr CallNextHookEx(IntPtr hhk, int nCode, IntPtr wParam, IntPtr lParam); [DllImport("kernel32.dll", CharSet = CharSet.Auto, SetLastError = true)] private static extern IntPtr GetModuleHandle(string lpModuleName); [DllImport("user32.dll")] static extern short GetKeyState(VirtualKeyStates nVirtKey); } enum VirtualKeyStates : int { VK_LBUTTON = 0x01, VK_RBUTTON = 0x02, VK_CANCEL = 0x03, VK_MBUTTON = 0x04, // VK_XBUTTON1 = 0x05, VK_XBUTTON2 = 0x06, // VK_BACK = 0x08, VK_TAB = 0x09, // VK_CLEAR = 0x0C, VK_RETURN = 0x0D, // VK_SHIFT = 0x10, VK_CONTROL = 0x11, VK_MENU = 0x12, VK_PAUSE = 0x13, VK_CAPITAL = 0x14, // VK_KANA = 0x15, VK_HANGEUL = 0x15, /* old name - should be here for compatibility */ VK_HANGUL = 0x15, VK_JUNJA = 0x17, VK_FINAL = 0x18, VK_HANJA = 0x19, VK_KANJI = 0x19, // VK_ESCAPE = 0x1B, // VK_CONVERT = 0x1C, VK_NONCONVERT = 0x1D, VK_ACCEPT = 0x1E, VK_MODECHANGE = 0x1F, // VK_SPACE = 0x20, VK_PRIOR = 0x21, VK_NEXT = 0x22, VK_END = 0x23, VK_HOME = 0x24, VK_LEFT = 0x25, VK_UP = 0x26, VK_RIGHT = 0x27, VK_DOWN = 0x28, VK_SELECT = 0x29, VK_PRINT = 0x2A, VK_EXECUTE = 0x2B, VK_SNAPSHOT = 0x2C, VK_INSERT = 0x2D, VK_DELETE = 0x2E, VK_HELP = 0x2F, // VK_LWIN = 0x5B, VK_RWIN = 0x5C, VK_APPS = 0x5D, // VK_SLEEP = 0x5F, // VK_NUMPAD0 = 0x60, VK_NUMPAD1 = 0x61, VK_NUMPAD2 = 0x62, VK_NUMPAD3 = 0x63, VK_NUMPAD4 = 0x64, VK_NUMPAD5 = 0x65, VK_NUMPAD6 = 0x66, VK_NUMPAD7 = 0x67, VK_NUMPAD8 = 0x68, VK_NUMPAD9 = 0x69, VK_MULTIPLY = 0x6A, VK_ADD = 0x6B, VK_SEPARATOR = 0x6C, VK_SUBTRACT = 0x6D, VK_DECIMAL = 0x6E, VK_DIVIDE = 0x6F, VK_F1 = 0x70, VK_F2 = 0x71, VK_F3 = 0x72, VK_F4 = 0x73, VK_F5 = 0x74, VK_F6 = 0x75, VK_F7 = 0x76, VK_F8 = 0x77, VK_F9 = 0x78, VK_F10 = 0x79, VK_F11 = 0x7A, VK_F12 = 0x7B, VK_F13 = 0x7C, VK_F14 = 0x7D, VK_F15 = 0x7E, VK_F16 = 0x7F, VK_F17 = 0x80, VK_F18 = 0x81, VK_F19 = 0x82, VK_F20 = 0x83, VK_F21 = 0x84, VK_F22 = 0x85, VK_F23 = 0x86, VK_F24 = 0x87, // VK_NUMLOCK = 0x90, VK_SCROLL = 0x91, // VK_OEM_NEC_EQUAL = 0x92, // '=' key on numpad // VK_OEM_FJ_JISHO = 0x92, // 'Dictionary' key VK_OEM_FJ_MASSHOU = 0x93, // 'Unregister word' key VK_OEM_FJ_TOUROKU = 0x94, // 'Register word' key VK_OEM_FJ_LOYA = 0x95, // 'Left OYAYUBI' key VK_OEM_FJ_ROYA = 0x96, // 'Right OYAYUBI' key // VK_LSHIFT = 0xA0, VK_RSHIFT = 0xA1, VK_LCONTROL = 0xA2, VK_RCONTROL = 0xA3, VK_LMENU = 0xA4, VK_RMENU = 0xA5, // VK_BROWSER_BACK = 0xA6, VK_BROWSER_FORWARD = 0xA7, VK_BROWSER_REFRESH = 0xA8, VK_BROWSER_STOP = 0xA9, VK_BROWSER_SEARCH = 0xAA, VK_BROWSER_FAVORITES = 0xAB, VK_BROWSER_HOME = 0xAC, // VK_VOLUME_MUTE = 0xAD, VK_VOLUME_DOWN = 0xAE, VK_VOLUME_UP = 0xAF, VK_MEDIA_NEXT_TRACK = 0xB0, VK_MEDIA_PREV_TRACK = 0xB1, VK_MEDIA_STOP = 0xB2, VK_MEDIA_PLAY_PAUSE = 0xB3, VK_LAUNCH_MAIL = 0xB4, VK_LAUNCH_MEDIA_SELECT = 0xB5, VK_LAUNCH_APP1 = 0xB6, VK_LAUNCH_APP2 = 0xB7, // VK_OEM_1 = 0xBA, // ';:' for US VK_OEM_PLUS = 0xBB, // '+' any country VK_OEM_COMMA = 0xBC, // ',' any country VK_OEM_MINUS = 0xBD, // '-' any country VK_OEM_PERIOD = 0xBE, // '.' any country VK_OEM_2 = 0xBF, // '/?' for US VK_OEM_3 = 0xC0, // '`~' for US // VK_OEM_4 = 0xDB, // '[{' for US VK_OEM_5 = 0xDC, // '\|' for US VK_OEM_6 = 0xDD, // ']}' for US VK_OEM_7 = 0xDE, // ''"' for US VK_OEM_8 = 0xDF, // VK_OEM_AX = 0xE1, // 'AX' key on Japanese AX kbd VK_OEM_102 = 0xE2, // "<>" or "\|" on RT 102-key kbd. VK_ICO_HELP = 0xE3, // Help key on ICO VK_ICO_00 = 0xE4, // 00 key on ICO // VK_PROCESSKEY = 0xE5, // VK_ICO_CLEAR = 0xE6, // VK_PACKET = 0xE7, // VK_OEM_RESET = 0xE9, VK_OEM_JUMP = 0xEA, VK_OEM_PA1 = 0xEB, VK_OEM_PA2 = 0xEC, VK_OEM_PA3 = 0xED, VK_OEM_WSCTRL = 0xEE, VK_OEM_CUSEL = 0xEF, VK_OEM_ATTN = 0xF0, VK_OEM_FINISH = 0xF1, VK_OEM_COPY = 0xF2, VK_OEM_AUTO = 0xF3, VK_OEM_ENLW = 0xF4, VK_OEM_BACKTAB = 0xF5, // VK_ATTN = 0xF6, VK_CRSEL = 0xF7, VK_EXSEL = 0xF8, VK_EREOF = 0xF9, VK_PLAY = 0xFA, VK_ZOOM = 0xFB, VK_NONAME = 0xFC, VK_PA1 = 0xFD, VK_OEM_CLEAR = 0xFE } It works well even if you put messagebox into the event or something that blocks execution. But it gets bad if you try to put breakpoint into the event. Why? I mean event is not run in the same thread that the windows hook is. That means that It shouldn't block HookCallback. It does however... I would really like to know why is this happening. My theory is that Visual Studio when breaking execution temporarily stops all threads and that means that HookCallback is blocked... Is there any book or valuable resource that would explain concepts behind all of this threading?

    Read the article

  • 12c - Silly little trick with invisibility...

    - by noreply(at)blogger.com (Thomas Kyte)
    This is interesting, if you hide and then unhide a column - it will end up at the "end" of the table.  Consider:ops$tkyte%ORA12CR1> create table t ( a int, b int, c int );Table created.ops$tkyte%ORA12CR1>ops$tkyte%ORA12CR1> desc t; Name                                                  Null?    Type ----------------------------------------------------- -------- ------------------------------------ A                                                              NUMBER(38) B                                                              NUMBER(38) C                                                              NUMBER(38)ops$tkyte%ORA12CR1> alter table t modify (a invisible);Table altered.ops$tkyte%ORA12CR1> alter table t modify (a visible);Table altered.ops$tkyte%ORA12CR1> desc t; Name                                                  Null?    Type ----------------------------------------------------- -------- ------------------------------------ B                                                              NUMBER(38) C                                                              NUMBER(38) A                                                              NUMBER(38)Now, that means you can add a column or shuffle them around.  What if we had just added A to the table and really really wanted A to be first.  My first approach would be "that is what editioning views are great at".  If I couldn't use an editioning view for whatever reason - we could shuffle the columns:ops$tkyte%ORA12CR1> alter table t modify (b invisible);Table altered.ops$tkyte%ORA12CR1> alter table t modify (c invisible);Table altered.ops$tkyte%ORA12CR1> alter table t modify (b visible);Table altered.ops$tkyte%ORA12CR1> alter table t modify (c visible);Table altered.ops$tkyte%ORA12CR1>ops$tkyte%ORA12CR1> desc t; Name                                                  Null?    Type ----------------------------------------------------- -------- ------------------------------------ A                                                              NUMBER(38) B                                                              NUMBER(38) C                                                              NUMBER(38)Note: that could cause some serious invalidations in your database - so make sure you are a) aware of that b) willing to pay that penalty and c) really really really want A to be first in the table!

    Read the article

  • Application is crash..

    - by user338322
    Below is my crash Report. 0 0x326712f8 in prepareForMethodLookup () 1 0x3266cf5c in lookUpMethod () 2 0x32668f28 in objc_msgSend_uncached () 3 0x33f70996 in NSPopAutoreleasePool () 4 0x33f82a6c in -[NSAutoreleasePool drain] () 5 0x00003d3e in -[CameraViewcontroller save:] (self=0x811400, _cmd=0x319c00d4, number=0x11e210) at /Users/hardikrathore/Desktop/LiveVideoRecording/Classes/CameraViewcontroller.m:266 6 0x33f36f8a in __NSFireDelayedPerform () 7 0x32da44c2 in CFRunLoopRunSpecific () 8 0x32da3c1e in CFRunLoopRunInMode () 9 0x31bb9374 in GSEventRunModal () 10 0x30bf3c30 in -[UIApplication _run] () 11 0x30bf2230 in UIApplicationMain () 12 0x00002650 in main (argc=1, argv=0x2ffff474) at /Users/hardikrathore/Desktop/LiveVideoRecording/main.m:14 And this is the code. lines, where I am getting the error. -(void)save:(id)number { NSAutoreleasePool *pool = [[NSAutoreleasePool alloc] init]; j =[number intValue]; while(screens[j] != NULL){ NSLog(@" image made : %d",j); UIImage * image = [UIImage imageWithCGImage:screens[j]]; image=[self imageByCropping:image toRect:CGRectMake(0, 0, 320, 240)]; NSData *imgdata = UIImageJPEGRepresentation(image,0.3); [image release]; CGImageRelease(screens[j]); screens[j] = NULL; UIImage * image1 = [UIImage imageWithCGImage:screens[j+1]]; image1=[self imageByCropping:image1 toRect:CGRectMake(0, 0, 320, 240)]; NSData *imgdata1 = UIImageJPEGRepresentation(image1,0.3); [image1 release]; CGImageRelease(screens[j+1]); screens[j+1] = NULL; NSString *urlString=@"http://www.test.itmate4.com/iPhoneToServerTwice.php"; // setting up the request object now NSMutableURLRequest *request = [[NSMutableURLRequest alloc]init]; [request setURL:[NSURL URLWithString:urlString]]; [request setHTTPMethod:@"POST"]; NSString *fileName=[VideoID stringByAppendingString:@"_"]; fileName=[fileName stringByAppendingString:[NSString stringWithFormat:@"%d",k]]; NSString *fileName2=[VideoID stringByAppendingString:@"_"]; fileName2=[fileName2 stringByAppendingString:[NSString stringWithFormat:@"%d",k+1]]; /* add some header info now we always need a boundary when we post a file also we need to set the content type You might want to generate a random boundary.. this is just the same as my output from wireshark on a valid html post */ NSString *boundary = [NSString stringWithString:@"---------------------------14737809831466499882746641449"]; NSString *contentType = [NSString stringWithFormat:@"multipart/form-data; boundary=%@",boundary]; [request addValue:contentType forHTTPHeaderField: @"Content-Type"]; /* now lets create the body of the post */ //NSString *count=[NSString stringWithFormat:@"%d",front];; NSMutableData *body = [NSMutableData data]; [body appendData:[[NSString stringWithFormat:@"\r\n--%@\r\n",boundary] dataUsingEncoding:NSUTF8StringEncoding]]; //[body appendData:[[NSString stringWithFormat:@"Content-Disposition: form-data; name=\"userfile\"; count=\"@\"";filename=\"%@.jpg\"\r\n",count,fileName] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[[NSString stringWithFormat:@"Content-Disposition: form-data; name=\"userfile\"; filename=\"%@.jpg\"\r\n",fileName] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[[NSString stringWithString:@"Content-Type: application/octet-stream\r\n\r\n"] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[NSData dataWithData:imgdata]]; [body appendData:[[NSString stringWithFormat:@"\r\n--%@--\r\n",boundary] dataUsingEncoding:NSUTF8StringEncoding]]; //second boundary NSString *string1 = [[NSString alloc] initWithFormat:@"\r\n--%@\r\n",boundary]; NSString *string2 =[[NSString alloc] initWithFormat:@"Content-Disposition: form-data; name=\"userfile2\"; filename=\"%@.jpg\"\r\n",fileName2]; NSString *string3 =[[NSString alloc] initWithFormat:@"\r\n--%@--\r\n",boundary]; [body appendData:[string1 dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[string2 dataUsingEncoding:NSUTF8StringEncoding]]; //experiment //[body appendData:[[NSString stringWithFormat:@"Content-Disposition: form-data; name=\"userfile2\"; filename=\"%@.jpg\"\r\n",fileName2] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[[NSString stringWithString:@"Content-Type: application/octet-stream\r\n\r\n"] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[NSData dataWithData:imgdata1]]; //[body appendData:[[NSString stringWithFormat:@"\r\n--%@--\r\n",boundary] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[string3 dataUsingEncoding:NSUTF8StringEncoding]]; // setting the body of the post to the reqeust [request setHTTPBody:body]; // now lets make the connection to the web NSData *returnData = [NSURLConnection sendSynchronousRequest:request returningResponse:nil error:nil]; NSString *returnString = [[NSString alloc] initWithData:returnData encoding:NSUTF8StringEncoding]; if([returnString isEqualToString:@"SUCCESS"]) { NSLog(returnString); k=k+2; j=j+2; [self performSelectorInBackground:@selector(save:) withObject:(id)[NSNumber numberWithInt:j]]; } //k=k+2; [imgdata release]; [imgdata1 release]; [NSThread sleepForTimeInterval:.01]; } [pool drain]; <-------------Line 266 } As you can see in log report. I am getting the error, Line 266. Some autorelease problem Any help !!!? coz I am not getting why its happening.

    Read the article

  • Panel is not displaying in JFrame

    - by mallikarjun
    I created a chat panel and added to Jframe but the panel is not displaying. But my sop in the chat panel are displaying in the console. Any one please let me know what could be the problem My Frame public class MyFrame extends JFrame { MyPanel chatClient; String input; public MyFrame() { input = (String)JOptionPane.showInputDialog(null, "Name:", "Connect to chat server", JOptionPane.QUESTION_MESSAGE, null,null, "Test"); input=input.trim(); chatClient = new MyPanel("localhost",input); setVisible(true); setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); add(chatClient); } public static void main(String...args){ new MyFrame(); } } MyPanel: public class MyPanel extends JPanel{ ChatClient chatClient; public MyPanel(String host, String uid) { chatClient= new ChatClient(host,uid); add(chatClient.getChatPanel()); this.setVisible(true); } } chat panel: public class ChatClient { Client client; String name; ChatPanel chatPanel; String hostid; public ChatClient(String host,String uid){ client = new Client(); client.start(); System.out.println("in constructor"); Network.register(client); client.addListener(new Listener(){ public void connected(Connection connection){ System.out.println("in client connected method"); Network.RegisterName registerName = new Network.RegisterName(); registerName.name=name; client.sendTCP(registerName); } public void received(Connection connection,Object object){ System.out.println("in client received method"); if (object instanceof Network.UpdateNames) { Network.UpdateNames updateNames = (Network.UpdateNames)object; //chatFrame.setNames(updateNames.names); System.out.println("got it message"); return; } if (object instanceof Network.ChatMessage) { Network.ChatMessage chatMessage = (Network.ChatMessage)object; //chatFrame.addMessage(chatMessage.text); System.out.println("send it message"); return; } } }); // end of listner name=uid.trim(); hostid=host.trim(); chatPanel = new ChatPanel(hostid,name); chatPanel.setSendListener(new Runnable(){ public void run(){ Network.ChatMessage chatMessage = new Network.ChatMessage(); chatMessage.chatMessage=chatPanel.getSendText(); client.sendTCP(chatMessage); } }); new Thread("connect"){ public void run(){ try{ client.connect(5000, hostid,Network.port); }catch(IOException e){ e.printStackTrace(); } } }.start(); }//end of constructor static public class ChatPanel extends JPanel{ CardLayout cardLayout; JList messageList,nameList; JTextField sendText; JButton sendButton; JPanel topPanel,bottomPanel,panel; public ChatPanel(String host,String user){ setSize(600, 200); this.setVisible(true); System.out.println("Chat panel "+host+"user: "+user); { panel = new JPanel(new BorderLayout()); { topPanel = new JPanel(new GridLayout(1,2)); panel.add(topPanel); { topPanel.add(new JScrollPane(messageList=new JList())); messageList.setModel(new DefaultListModel()); } { topPanel.add(new JScrollPane(nameList=new JList())); nameList.setModel(new DefaultListModel()); } DefaultListSelectionModel disableSelections = new DefaultListSelectionModel() { public void setSelectionInterval (int index0, int index1) { } }; messageList.setSelectionModel(disableSelections); nameList.setSelectionMode(ListSelectionModel.SINGLE_SELECTION); } { bottomPanel = new JPanel(new GridBagLayout()); panel.add(bottomPanel,BorderLayout.SOUTH); bottomPanel.add(sendText=new JTextField(),new GridBagConstraints(0,0,1,1,1,0,GridBagConstraints.CENTER,GridBagConstraints.BOTH,new Insets(0,0,0,0),0,0)); bottomPanel.add(sendButton=new JButton(),new GridBagConstraints(1,0,1,1,0,0,GridBagConstraints.CENTER,0,new Insets(0,0,0,0),0,0)); } } sendText.addActionListener(new ActionListener(){ public void actionPerformed(ActionEvent e){ sendButton.doClick(); } }); } public void setSendListener (final Runnable listener) { sendButton.addActionListener(new ActionListener() { public void actionPerformed (ActionEvent evt) { if (getSendText().length() == 0) return; listener.run(); sendText.setText(""); sendText.requestFocus(); } }); } public String getSendText () { return sendText.getText().trim(); } public void setNames (final String[] names) { EventQueue.invokeLater(new Runnable(){ public void run(){ DefaultListModel model = (DefaultListModel)nameList.getModel(); model.removeAllElements(); for(String name:names) model.addElement(name); } }); } public void addMessage (final String message) { EventQueue.invokeLater(new Runnable() { public void run () { DefaultListModel model = (DefaultListModel)messageList.getModel(); model.addElement(message); messageList.ensureIndexIsVisible(model.size() - 1); } }); } } public JPanel getChatPanel(){ return chatPanel; } }

    Read the article

  • JSF2 - use view scope managed bean to pass value between navigation

    - by Fekete Kamosh
    Hi all, I am solving how to pass values from one page to another without making use of session scope managed bean. For most managed beans I would like to have only Request scope. I created a very, very simple calculator example which passes Result object resulting from actions on request bean (CalculatorRequestBean) from 5th phase as initializing value for new instance of request bean initialized in next phase lifecycle. In fact - in production environment we need to pass much more complicated data object which is not as primitive as Result defined below. What is your opinion on this solution which considers both possibilities - we stay on the same view or we navigate to the new one. But in both cases I can get to previous value stored passed using view scoped managed bean. Calculator page: <?xml version='1.0' encoding='UTF-8' ?> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xmlns:h="http://java.sun.com/jsf/html"> <h:head> <title>Calculator</title> </h:head> <h:body> <h:form> <h:panelGrid columns="2"> <h:outputText value="Value to use:"/> <h:inputText value="#{calculatorBeanRequest.valueToAdd}"/> <h:outputText value="Navigate to new view:"/> <h:selectBooleanCheckbox value="#{calculatorBeanRequest.navigateToNewView}"/> <h:commandButton value="Add" action="#{calculatorBeanRequest.add}"/> <h:commandButton value="Subtract" action="#{calculatorBeanRequest.subtract}"/> <h:outputText value="Result:"/> <h:outputText value="#{calculatorBeanRequest.result.value}"/> <h:outputText value="DUMMY" rendered="#{resultBeanView.dummy}"/> </h:panelGrid> </h:form> </h:body> Object to be passed through lifecycle: package cz.test.calculator; import java.io.Serializable; /** * Data object passed among pages. * Lets imagine it holds something much more complicated than primitive int */ public class Result implements Serializable { private int value; public void setValue(int value) { this.value = value; } public int getValue() { return value; } } Request scoped managed bean used on view "calculator.xhtml" package cz.test.calculator; import javax.annotation.PostConstruct; import javax.faces.bean.ManagedBean; import javax.faces.bean.ManagedProperty; import javax.faces.bean.RequestScoped; @ManagedBean @RequestScoped public class CalculatorBeanRequest { @ManagedProperty(value="#{resultBeanView}") ResultBeanView resultBeanView; private Result result; private int valueToAdd; /** * Should perform navigation to */ private boolean navigateToNewView; /** Creates a new instance of CalculatorBeanRequest */ public CalculatorBeanRequest() { } @PostConstruct public void init() { // Remember already saved result from view scoped bean result = resultBeanView.getResult(); } // Dependency injections public void setResultBeanView(ResultBeanView resultBeanView) { this.resultBeanView = resultBeanView; } public ResultBeanView getResultBeanView() { return resultBeanView; } // Getters, setter public void setValueToAdd(int valueToAdd) { this.valueToAdd = valueToAdd; } public int getValueToAdd() { return valueToAdd; } public boolean isNavigateToNewView() { return navigateToNewView; } public void setNavigateToNewView(boolean navigateToNewView) { this.navigateToNewView = navigateToNewView; } public Result getResult() { return result; } // Actions public String add() { result.setValue(result.getValue() + valueToAdd); return isNavigateToNewView() ? "calculator" : null; } public String subtract() { result.setValue(result.getValue() - valueToAdd); return isNavigateToNewView() ? "calculator" : null; } } and finally view scoped managed bean to pass Result variable to new page: package cz.test.calculator; import java.io.Serializable; import javax.annotation.PostConstruct; import javax.faces.bean.ManagedBean; import javax.faces.bean.ViewScoped; import javax.faces.context.FacesContext; @ManagedBean @ViewScoped public class ResultBeanView implements Serializable { private Result result = new Result(); /** Creates a new instance of ResultBeanView */ public ResultBeanView() { } @PostConstruct public void init() { // Try to find request bean ManagedBeanRequest and reset result value CalculatorBeanRequest calculatorBeanRequest = (CalculatorBeanRequest)FacesContext.getCurrentInstance().getExternalContext().getRequestMap().get("calculatorBeanRequest"); if(calculatorBeanRequest != null) { setResult(calculatorBeanRequest.getResult()); } } /** No need to have public modifier as not used on view * but only in managed bean within the same package */ void setResult(Result result) { this.result = result; } /** No need to have public modifier as not used on view * but only in managed bean within the same package */ Result getResult() { return result; } /** * To be called on page to instantiate ResultBeanView in Render view phase */ public boolean isDummy() { return false; } }

    Read the article

  • How to programatically read native DLL imports in C#?

    - by Eric
    The large hunk of C# code below is intended to print the imports of a native DLL. I copied it from from this link and modified it very slightly, just to use LoadLibraryEx as Mike Woodring does here. I find that when I call the Foo.Test method with the original example's target, MSCOREE.DLL, it prints all the imports fine. But when I use other dlls like GDI32.DLL or WSOCK32.DLL the imports do not get printed. What's missing from this code that would let it print all the imports as, for example, DUMPBIN.EXE does? (Is there a hint I'm not grokking in the original comment that says, "using mscoree.dll as an example as it doesnt export any thing"?) Here's the extract that just shows how it's being invoked: public static void Test() { // WORKS: var path = @"c:\windows\system32\mscoree.dll"; // NO ERRORS, BUT NO IMPORTS PRINTED EITHER: //var path = @"c:\windows\system32\gdi32.dll"; //var path = @"c:\windows\system32\wsock32.dll"; var hLib = LoadLibraryEx(path, 0, DONT_RESOLVE_DLL_REFERENCES | LOAD_IGNORE_CODE_AUTHZ_LEVEL); TestImports(hLib, true); } And here is the whole code example: namespace PETest2 { [StructLayout(LayoutKind.Explicit)] public unsafe struct IMAGE_IMPORT_BY_NAME { [FieldOffset(0)] public ushort Hint; [FieldOffset(2)] public fixed char Name[1]; } [StructLayout(LayoutKind.Explicit)] public struct IMAGE_IMPORT_DESCRIPTOR { #region union /// <summary> /// CSharp doesnt really support unions, but they can be emulated by a field offset 0 /// </summary> [FieldOffset(0)] public uint Characteristics; // 0 for terminating null import descriptor [FieldOffset(0)] public uint OriginalFirstThunk; // RVA to original unbound IAT (PIMAGE_THUNK_DATA) #endregion [FieldOffset(4)] public uint TimeDateStamp; [FieldOffset(8)] public uint ForwarderChain; [FieldOffset(12)] public uint Name; [FieldOffset(16)] public uint FirstThunk; } [StructLayout(LayoutKind.Explicit)] public struct THUNK_DATA { [FieldOffset(0)] public uint ForwarderString; // PBYTE [FieldOffset(4)] public uint Function; // PDWORD [FieldOffset(8)] public uint Ordinal; [FieldOffset(12)] public uint AddressOfData; // PIMAGE_IMPORT_BY_NAME } public unsafe class Interop { #region Public Constants public static readonly ushort IMAGE_DIRECTORY_ENTRY_IMPORT = 1; #endregion #region Private Constants #region CallingConvention CALLING_CONVENTION /// <summary> /// Specifies the calling convention. /// </summary> /// <remarks> /// Specifies <see cref="CallingConvention.Winapi" /> for Windows to /// indicate that the default should be used. /// </remarks> private const CallingConvention CALLING_CONVENTION = CallingConvention.Winapi; #endregion CallingConvention CALLING_CONVENTION #region IMPORT DLL FUNCTIONS private const string KERNEL_DLL = "kernel32"; private const string DBGHELP_DLL = "Dbghelp"; #endregion #endregion Private Constants [DllImport(KERNEL_DLL, CallingConvention = CALLING_CONVENTION, EntryPoint = "GetModuleHandleA"), SuppressUnmanagedCodeSecurity] public static extern void* GetModuleHandleA(/*IN*/ char* lpModuleName); [DllImport(KERNEL_DLL, CallingConvention = CALLING_CONVENTION, EntryPoint = "GetModuleHandleW"), SuppressUnmanagedCodeSecurity] public static extern void* GetModuleHandleW(/*IN*/ char* lpModuleName); [DllImport(KERNEL_DLL, CallingConvention = CALLING_CONVENTION, EntryPoint = "IsBadReadPtr"), SuppressUnmanagedCodeSecurity] public static extern bool IsBadReadPtr(void* lpBase, uint ucb); [DllImport(DBGHELP_DLL, CallingConvention = CALLING_CONVENTION, EntryPoint = "ImageDirectoryEntryToData"), SuppressUnmanagedCodeSecurity] public static extern void* ImageDirectoryEntryToData(void* Base, bool MappedAsImage, ushort DirectoryEntry, out uint Size); } static class Foo { // From winbase.h in the Win32 platform SDK. // const uint DONT_RESOLVE_DLL_REFERENCES = 0x00000001; const uint LOAD_IGNORE_CODE_AUTHZ_LEVEL = 0x00000010; [DllImport("kernel32.dll"), SuppressUnmanagedCodeSecurity] static extern uint LoadLibraryEx(string fileName, uint notUsedMustBeZero, uint flags); public static void Test() { //var path = @"c:\windows\system32\mscoree.dll"; //var path = @"c:\windows\system32\gdi32.dll"; var path = @"c:\windows\system32\wsock32.dll"; var hLib = LoadLibraryEx(path, 0, DONT_RESOLVE_DLL_REFERENCES | LOAD_IGNORE_CODE_AUTHZ_LEVEL); TestImports(hLib, true); } // using mscoree.dll as an example as it doesnt export any thing // so nothing shows up if you use your own module. // and the only none delayload in mscoree.dll is the Kernel32.dll private static void TestImports( uint hLib, bool mappedAsImage ) { unsafe { //fixed (char* pszModule = "mscoree.dll") { //void* hMod = Interop.GetModuleHandleW(pszModule); void* hMod = (void*)hLib; uint size = 0; uint BaseAddress = (uint)hMod; if (hMod != null) { Console.WriteLine("Got handle"); IMAGE_IMPORT_DESCRIPTOR* pIID = (IMAGE_IMPORT_DESCRIPTOR*)Interop.ImageDirectoryEntryToData((void*)hMod, mappedAsImage, Interop.IMAGE_DIRECTORY_ENTRY_IMPORT, out size); if (pIID != null) { Console.WriteLine("Got Image Import Descriptor"); while (!Interop.IsBadReadPtr((void*)pIID->OriginalFirstThunk, (uint)size)) { try { char* szName = (char*)(BaseAddress + pIID->Name); string name = Marshal.PtrToStringAnsi((IntPtr)szName); Console.WriteLine("pIID->Name = {0} BaseAddress - {1}", name, (uint)BaseAddress); THUNK_DATA* pThunkOrg = (THUNK_DATA*)(BaseAddress + pIID->OriginalFirstThunk); while (!Interop.IsBadReadPtr((void*)pThunkOrg->AddressOfData, 4U)) { char* szImportName; uint Ord; if ((pThunkOrg->Ordinal & 0x80000000) > 0) { Ord = pThunkOrg->Ordinal & 0xffff; Console.WriteLine("imports ({0}).Ordinal{1} - Address: {2}", name, Ord, pThunkOrg->Function); } else { IMAGE_IMPORT_BY_NAME* pIBN = (IMAGE_IMPORT_BY_NAME*)(BaseAddress + pThunkOrg->AddressOfData); if (!Interop.IsBadReadPtr((void*)pIBN, (uint)sizeof(IMAGE_IMPORT_BY_NAME))) { Ord = pIBN->Hint; szImportName = (char*)pIBN->Name; string sImportName = Marshal.PtrToStringAnsi((IntPtr)szImportName); // yes i know i am a lazy ass Console.WriteLine("imports ({0}).{1}@{2} - Address: {3}", name, sImportName, Ord, pThunkOrg->Function); } else { Console.WriteLine("Bad ReadPtr Detected or EOF on Imports"); break; } } pThunkOrg++; } } catch (AccessViolationException e) { Console.WriteLine("An Access violation occured\n" + "this seems to suggest the end of the imports section\n"); Console.WriteLine(e); } pIID++; } } } } } Console.WriteLine("Press Any Key To Continue......"); Console.ReadKey(); } }

    Read the article

  • Understanding the passing of data/life of a script in web development/CodeIgniter

    - by Pete Jodo
    I hope I worded the title accurately enough but I typically use Java and don't have much experience in Web Development/PHP/CodeIgniter. I have a difficult time understanding the life cycle of a script as I found out trying to implement a certain feature to a website I am developing (as a means of learning how to). I'll first describe the feature I tried implementing and then the problem I ran into that made me question my fundamental understanding of how scripts work since I'm used to typical OOP. Ok so here goes... I have a webpage that has 2 basic tasks a user can do, create and delete an entry. What I attempted to implement was a way to time a user how long it takes them to complete a certain task. The way I did this was have a homepage where there would be a list of tasks a user to choose from (in this case 2, create and delete). A user would click a task which would link to the 'true' homepage where the user then would be expected to complete the task. My script looks like this: <?php class Site extends CI_Controller { var $task1; var $tasks = array( "task1" => NULL, "date1" => 0, "date2" => 0, "diff" => 0); function __construct() { parent::__construct(); include 'timetask.php'; $this->task1 = new TimeTask("create"); } function index() { $this->tasks['task1'] = $this->task1->getTask(); $this->tasks['diff'] = $this->task1->getTimeDiff(); if($this->tasks['diff'] == NULL) { $this->tasks['diff'] = 0; } $this->load->view('usability_test', $this->tasks); } function origIndex() { $this->task1->setDate1(new DateTime()); $this->tasks['date1'] = $this->task1->getDate1()->getTimestamp(); $data = array(); if($q = $this->site_model->get_records()) { $data['records'] = $q; } $this->load->view('options_view', $data); } function create() { $this->task1->setDate2(new DateTime()); $this->tasks['date2'] = $this->task1->getDate2()->getTimestamp(); $data = array( 'author' => $this->input->post('author'), 'title' => $this->input->post('title'), 'contents' => $this->input->post('contents') ); $this->site_model->add_record($data); $this->index(); } I only included create to keep it short. Then I also have the TimeTask class, that actually another StackOverflow so kindly helped me with: <?php class TimeTask { private $task; /** * @var DateTime */ private $date1, $date2; function __construct($currTask) { $this->task = $currTask; } public function getTimeDiff() { $hasDiff = $this->date1 && $this->date2; if ($hasDiff) { return $this->date2->getTimestamp() - $this->date1->getTimestamp(); } else { return NULL; } } public function __toString() { return (string) $this->getTimeDiff(); } /** * @return \DateTime */ public function getDate1() { return $this->date1; } /** * @param \DateTime $date1 */ public function setDate1(DateTime $date1) { $this->date1 = $date1; } /** * @return \DateTime */ public function getDate2() { return $this->date2; } /** * @param \DateTime $date2 */ public function setDate2(DateTime $date2) { $this->date2 = $date2; } /** * @return get current task */ public function getTask() { return $this->task; } } ?> I don't think posting the views is necessary for the question but here is atleast how the links are made. ...and... id", $row-title); ? Now there's no error in the code but it doesn't do what I expect of it and the reason I assume why is because that each time a function of the script is called via a new page it is NOT the same instance of the script called previously so any previously created objects are no longer there. This confuses me and leaves me quite unsure of how to implement this gracefully. Some ways I would guess of how to do this is by passing the necessary data through the URL or have data saved in a database and retrieve it later to compare the times. What would be a recommended way to do, not just this, but anything that needs previously created data? Also, am I correct to think that a script is only 'alive' for one webpage at a time? Thanks!

    Read the article

  • Receiving broadcast packets using packet socket

    - by user314336
    Hello I try to send DHCP RENEW packets to the network and receive the responses. I broadcast the packet and I can see that it's successfully sent using Wireshark. But I have difficulties receiving the responses.I use packet sockets to catch the packets. I can see that there are responses to my RENEW packet using Wireshark, but my function 'packet_receive_renew' sometimes catch the packets but sometimes it can not catch the packets. I set the file descriptor using FDSET but the 'select' in my code can not realize that there are new packets for that file descriptor and timeout occurs. I couldn't make it clear that why it sometimes catches the packets and sometimes doesn't. Anybody have an idea? Thanks in advance. Here's the receive function. int packet_receive_renew(struct client_info* info) { int fd; struct sockaddr_ll sock, si_other; struct sockaddr_in si_me; fd_set rfds; struct timeval tv; time_t start, end; int bcast = 1; int ret = 0, try = 0; char buf[1500] = {'\0'}; uint8_t tmp[BUFLEN] = {'\0'}; struct dhcp_packet pkt; socklen_t slen = sizeof(si_other); struct dhcps* new_dhcps; memset((char *) &si_me, 0, sizeof(si_me)); memset((char *) &si_other, 0, sizeof(si_other)); memset(&pkt, 0, sizeof(struct dhcp_packet)); define SERVER_AND_CLIENT_PORTS ((67 << 16) + 68) static const struct sock_filter filter_instr[] = { /* check for udp */ BPF_STMT(BPF_LD|BPF_B|BPF_ABS, 9), BPF_JUMP(BPF_JMP|BPF_JEQ|BPF_K, IPPROTO_UDP, 0, 4), /* L5, L1, is UDP? */ /* skip IP header */ BPF_STMT(BPF_LDX|BPF_B|BPF_MSH, 0), /* L5: */ /* check udp source and destination ports */ BPF_STMT(BPF_LD|BPF_W|BPF_IND, 0), BPF_JUMP(BPF_JMP|BPF_JEQ|BPF_K, SERVER_AND_CLIENT_PORTS, 0, 1), /* L3, L4 */ /* returns */ BPF_STMT(BPF_RET|BPF_K, 0x0fffffff ), /* L3: pass */ BPF_STMT(BPF_RET|BPF_K, 0), /* L4: reject */ }; static const struct sock_fprog filter_prog = { .len = sizeof(filter_instr) / sizeof(filter_instr[0]), /* casting const away: */ .filter = (struct sock_filter *) filter_instr, }; printf("opening raw socket on ifindex %d\n", info->interf.if_index); if (-1==(fd = socket(PF_PACKET, SOCK_DGRAM, htons(ETH_P_IP)))) { perror("packet_receive_renew::socket"); return -1; } printf("got raw socket fd %d\n", fd); /* Use only if standard ports are in use */ /* Ignoring error (kernel may lack support for this) */ if (-1==setsockopt(fd, SOL_SOCKET, SO_ATTACH_FILTER, &filter_prog, sizeof(filter_prog))) perror("packet_receive_renew::setsockopt"); sock.sll_family = AF_PACKET; sock.sll_protocol = htons(ETH_P_IP); //sock.sll_pkttype = PACKET_BROADCAST; sock.sll_ifindex = info->interf.if_index; if (-1 == bind(fd, (struct sockaddr *) &sock, sizeof(sock))) { perror("packet_receive_renew::bind"); close(fd); return -3; } if (-1 == setsockopt(fd, SOL_SOCKET, SO_BROADCAST, &bcast, sizeof(bcast))) { perror("packet_receive_renew::setsockopt"); close(fd); return -1; } FD_ZERO(&rfds); FD_SET(fd, &rfds); tv.tv_sec = TIMEOUT; tv.tv_usec = 0; ret = time(&start); if (-1 == ret) { perror("packet_receive_renew::time"); close(fd); return -1; } while(1) { ret = select(fd + 1, &rfds, NULL, NULL, &tv); time(&end); if (TOTAL_PENDING <= (end - start)) { fprintf(stderr, "End receiving\n"); break; } if (-1 == ret) { perror("packet_receive_renew::select"); close(fd); return -4; } else if (ret) { new_dhcps = (struct dhcps*)calloc(1, sizeof(struct dhcps)); if (-1 == recvfrom(fd, buf, 1500, 0, (struct sockaddr*)&si_other, &slen)) { perror("packet_receive_renew::recvfrom"); close(fd); return -4; } deref_packet((unsigned char*)buf, &pkt, info); if (-1!=(ret=get_option_val(pkt.options, DHO_DHCP_SERVER_IDENTIFIER, tmp))) { sprintf((char*)tmp, "%d.%d.%d.%d", tmp[0],tmp[1],tmp[2],tmp[3]); fprintf(stderr, "Received renew from %s\n", tmp); } else { fprintf(stderr, "Couldnt get DHO_DHCP_SERVER_IDENTIFIER%s\n", tmp); close(fd); return -5; } new_dhcps->dhcps_addr = strdup((char*)tmp); //add to list if (info->dhcps_list) info->dhcps_list->next = new_dhcps; else info->dhcps_list = new_dhcps; new_dhcps->next = NULL; } else { try++; tv.tv_sec = TOTAL_PENDING - try * TIMEOUT; tv.tv_usec = 0; fprintf(stderr, "Timeout occured\n"); } } close(fd); printf("close fd:%d\n", fd); return 0; }

    Read the article

  • Java Box Class: Unsolvable: aligning components to the left or right

    - by user323186
    I have been trying to left align buttons contained in a Box to the left, with no success. They align left alright, but for some reason dont shift all the way left as one would imagine. I attach the code below. Please try compiling it and see for yourself. Seems bizarre to me. Thanks, Eric import java.awt.Dimension; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import java.io.BufferedReader; import java.io.File; import java.io.FileNotFoundException; import java.io.FileReader; import java.io.IOException; import javax.swing.Box; import javax.swing.BoxLayout; import javax.swing.JButton; import javax.swing.JFileChooser; import javax.swing.JFrame; import javax.swing.JMenu; import javax.swing.JMenuBar; import javax.swing.JMenuItem; import javax.swing.JScrollPane; import javax.swing.JTextArea; public class MainGUI extends Box implements ActionListener{ //Create GUI Components Box centerGUI=new Box(BoxLayout.X_AXIS); Box bottomGUI=new Box(BoxLayout.X_AXIS); //centerGUI subcomponents JTextArea left=new JTextArea(), right=new JTextArea(); JScrollPane leftScrollPane = new JScrollPane(left), rightScrollPane = new JScrollPane(right); //bottomGUI subcomponents JButton encrypt=new JButton("Encrypt"), decrypt=new JButton("Decrypt"), close=new JButton("Close"), info=new JButton("Info"); //Create Menubar components JMenuBar menubar=new JMenuBar(); JMenu fileMenu=new JMenu("File"); JMenuItem open=new JMenuItem("Open"), save=new JMenuItem("Save"), exit=new JMenuItem("Exit"); int returnVal =0; public MainGUI(){ super(BoxLayout.Y_AXIS); initCenterGUI(); initBottomGUI(); initFileMenu(); add(centerGUI); add(bottomGUI); addActionListeners(); } private void addActionListeners() { open.addActionListener(this); save.addActionListener(this); exit.addActionListener(this); encrypt.addActionListener(this); decrypt.addActionListener(this); close.addActionListener(this); info.addActionListener(this); } private void initFileMenu() { fileMenu.add(open); fileMenu.add(save); fileMenu.add(exit); menubar.add(fileMenu); } public void initCenterGUI(){ centerGUI.add(leftScrollPane); centerGUI.add(rightScrollPane); } public void initBottomGUI(){ bottomGUI.setAlignmentX(LEFT_ALIGNMENT); //setBorder(BorderFactory.createLineBorder(Color.BLACK)); bottomGUI.add(encrypt); bottomGUI.add(decrypt); bottomGUI.add(close); bottomGUI.add(info); } @Override public void actionPerformed(ActionEvent arg0) { // find source of the action Object source=arg0.getSource(); //if action is of such a type do the corresponding action if(source==close){ kill(); } else if(source==open){ //CHOOSE FILE File file1 =chooseFile(); String input1=readToString(file1); System.out.println(input1); left.setText(input1); } else if(source==decrypt){ //decrypt everything in Right Panel and output in left panel decrypt(); } else if(source==encrypt){ //encrypt everything in left panel and output in right panel encrypt(); } else if(source==info){ //show contents of info file in right panel doInfo(); } else { System.out.println("Error"); //throw new UnimplementedActionException(); } } private void doInfo() { // TODO Auto-generated method stub } private void encrypt() { // TODO Auto-generated method stub } private void decrypt() { // TODO Auto-generated method stub } private String readToString(File file) { FileReader fr = null; try { fr = new FileReader(file); } catch (FileNotFoundException e1) { e1.printStackTrace(); } BufferedReader br=new BufferedReader(fr); String line = null; try { line = br.readLine(); } catch (IOException e) { e.printStackTrace(); } String input=""; while(line!=null){ input=input+"\n"+line; try { line=br.readLine(); } catch (IOException e) { e.printStackTrace(); } } return input; } private File chooseFile() { //Create a file chooser final JFileChooser fc = new JFileChooser(); returnVal = fc.showOpenDialog(fc); return fc.getSelectedFile(); } private void kill() { System.exit(0); } public static void main(String[] args) { // TODO Auto-generated method stub MainGUI test=new MainGUI(); JFrame f=new JFrame("Tester"); f.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); f.setJMenuBar(test.menubar); f.setPreferredSize(new Dimension(600,400)); //f.setUndecorated(true); f.add(test); f.pack(); f.setVisible(true); } }

    Read the article

  • How can I map "insert='false' update='false'" on a composite-id key-property which is also used in a one-to-many FK?

    - by Gweebz
    I am working on a legacy code base with an existing DB schema. The existing code uses SQL and PL/SQL to execute queries on the DB. We have been tasked with making a small part of the project database-engine agnostic (at first, change everything eventually). We have chosen to use Hibernate 3.3.2.GA and "*.hbm.xml" mapping files (as opposed to annotations). Unfortunately, it is not feasible to change the existing schema because we cannot regress any legacy features. The problem I am encountering is when I am trying to map a uni-directional, one-to-many relationship where the FK is also part of a composite PK. Here are the classes and mapping file... CompanyEntity.java public class CompanyEntity { private Integer id; private Set<CompanyNameEntity> names; ... } CompanyNameEntity.java public class CompanyNameEntity implements Serializable { private Integer id; private String languageId; private String name; ... } CompanyNameEntity.hbm.xml <?xml version="1.0"?> <!DOCTYPE hibernate-mapping PUBLIC "-//Hibernate/Hibernate Mapping DTD 3.0//EN" "http://www.jboss.org/dtd/hibernate/hibernate-mapping-3.0.dtd"> <hibernate-mapping package="com.example"> <class name="com.example.CompanyEntity" table="COMPANY"> <id name="id" column="COMPANY_ID"/> <set name="names" table="COMPANY_NAME" cascade="all-delete-orphan" fetch="join" batch-size="1" lazy="false"> <key column="COMPANY_ID"/> <one-to-many entity-name="vendorName"/> </set> </class> <class entity-name="companyName" name="com.example.CompanyNameEntity" table="COMPANY_NAME"> <composite-id> <key-property name="id" column="COMPANY_ID"/> <key-property name="languageId" column="LANGUAGE_ID"/> </composite-id> <property name="name" column="NAME" length="255"/> </class> </hibernate-mapping> This code works just fine for SELECT and INSERT of a Company with names. I encountered a problem when I tried to update and existing record. I received a BatchUpdateException and after looking through the SQL logs I saw Hibernate was trying to do something stupid... update COMPANY_NAME set COMPANY_ID=null where COMPANY_ID=? Hibernate was trying to dis-associate child records before updating them. The problem is that this field is part of the PK and not-nullable. I found the quick solution to make Hibernate not do this is to add "not-null='true'" to the "key" element in the parent mapping. SO now may mapping looks like this... CompanyNameEntity.hbm.xml <?xml version="1.0"?> <!DOCTYPE hibernate-mapping PUBLIC "-//Hibernate/Hibernate Mapping DTD 3.0//EN" "http://www.jboss.org/dtd/hibernate/hibernate-mapping-3.0.dtd"> <hibernate-mapping package="com.example"> <class name="com.example.CompanyEntity" table="COMPANY"> <id name="id" column="COMPANY_ID"/> <set name="names" table="COMPANY_NAME" cascade="all-delete-orphan" fetch="join" batch-size="1" lazy="false"> <key column="COMPANY_ID" not-null="true"/> <one-to-many entity-name="vendorName"/> </set> </class> <class entity-name="companyName" name="com.example.CompanyNameEntity" table="COMPANY_NAME"> <composite-id> <key-property name="id" column="COMPANY_ID"/> <key-property name="languageId" column="LANGUAGE_ID"/> </composite-id> <property name="name" column="NAME" length="255"/> </class> </hibernate-mapping> This mapping gives the exception... org.hibernate.MappingException: Repeated column in mapping for entity: companyName column: COMPANY_ID (should be mapped with insert="false" update="false") My problem now is that I have tryed to add these attributes to the key-property element but that is not supported by the DTD. I have also tryed changing it to a key-many-to-one element but that didn't work either. So... How can I map "insert='false' update='false'" on a composite-id key-property which is also used in a one-to-many FK?

    Read the article

  • iPhone: Crash in Custom Autorelease Pool

    - by user338322
    My app is crashing when I try to post images in an HTTP request. I am trying to upload images to a server. The crash appears related to my autorelease pool because the crash is trapped at the [pool release] message. Here is the crash report: #0 0x326712f8 in prepareForMethodLookup () #1 0x3266cf5c in lookUpMethod () #2 0x32668f28 in objc_msgSend_uncached () #3 0x33f70996 in NSPopAutoreleasePool () #4 0x33f82a6c in -[NSAutoreleasePool drain] () #5 0x00003d3e in -[CameraViewcontroller save:] (self=0x811400, _cmd=0x319c00d4, number=0x11e210) at /Users/hardikrathore/Desktop/LiveVideoRecording/Classes/CameraViewcontroller.m:266 #6 0x33f36f8a in __NSFireDelayedPerform () #7 0x32da44c2 in CFRunLoopRunSpecific () #8 0x32da3c1e in CFRunLoopRunInMode () #9 0x31bb9374 in GSEventRunModal () #10 0x30bf3c30 in -[UIApplication _run] () #11 0x30bf2230 in UIApplicationMain () #12 0x00002650 in main (argc=1, argv=0x2ffff474) at /Users/hardikrathore/Desktop/LiveVideoRecording/main.m:14 The crash report says that final line of the following code is the point of the crash. (Line No. 266) -(void)save:(id)number { NSAutoreleasePool *pool = [[NSAutoreleasePool alloc] init]; j =[number intValue]; while(screens[j] != NULL){ NSLog(@" image made : %d",j); UIImage * image = [UIImage imageWithCGImage:screens[j]]; image=[self imageByCropping:image toRect:CGRectMake(0, 0, 320, 240)]; NSData *imgdata = UIImageJPEGRepresentation(image,0.3); [image release]; CGImageRelease(screens[j]); screens[j] = NULL; UIImage * image1 = [UIImage imageWithCGImage:screens[j+1]]; image1=[self imageByCropping:image1 toRect:CGRectMake(0, 0, 320, 240)]; NSData *imgdata1 = UIImageJPEGRepresentation(image1,0.3); [image1 release]; CGImageRelease(screens[j+1]); screens[j+1] = NULL; NSString *urlString=@"http://www.test.itmate4.com/iPhoneToServerTwice.php"; // setting up the request object now NSMutableURLRequest *request = [[NSMutableURLRequest alloc]init]; [request setURL:[NSURL URLWithString:urlString]]; [request setHTTPMethod:@"POST"]; NSString *fileName=[VideoID stringByAppendingString:@"_"]; fileName=[fileName stringByAppendingString:[NSString stringWithFormat:@"%d",k]]; NSString *fileName2=[VideoID stringByAppendingString:@"_"]; fileName2=[fileName2 stringByAppendingString:[NSString stringWithFormat:@"%d",k+1]]; /* add some header info now we always need a boundary when we post a file also we need to set the content type You might want to generate a random boundary.. this is just the same as my output from wireshark on a valid html post */ NSString *boundary = [NSString stringWithString:@"---------------------------14737809831466499882746641449"]; NSString *contentType = [NSString stringWithFormat:@"multipart/form-data; boundary=%@",boundary]; [request addValue:contentType forHTTPHeaderField: @"Content-Type"]; /* now lets create the body of the post */ //NSString *count=[NSString stringWithFormat:@"%d",front];; NSMutableData *body = [NSMutableData data]; [body appendData:[[NSString stringWithFormat:@"\r\n--%@\r\n",boundary] dataUsingEncoding:NSUTF8StringEncoding]]; //[body appendData:[[NSString stringWithFormat:@"Content-Disposition: form-data; name=\"userfile\"; count=\"@\"";filename=\"%@.jpg\"\r\n",count,fileName] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[[NSString stringWithFormat:@"Content-Disposition: form-data; name=\"userfile\"; filename=\"%@.jpg\"\r\n",fileName] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[[NSString stringWithString:@"Content-Type: application/octet-stream\r\n\r\n"] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[NSData dataWithData:imgdata]]; [body appendData:[[NSString stringWithFormat:@"\r\n--%@--\r\n",boundary] dataUsingEncoding:NSUTF8StringEncoding]]; //second boundary NSString *string1 = [[NSString alloc] initWithFormat:@"\r\n--%@\r\n",boundary]; NSString *string2 =[[NSString alloc] initWithFormat:@"Content-Disposition: form-data; name=\"userfile2\"; filename=\"%@.jpg\"\r\n",fileName2]; NSString *string3 =[[NSString alloc] initWithFormat:@"\r\n--%@--\r\n",boundary]; [body appendData:[string1 dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[string2 dataUsingEncoding:NSUTF8StringEncoding]]; //experiment //[body appendData:[[NSString stringWithFormat:@"Content-Disposition: form-data; name=\"userfile2\"; filename=\"%@.jpg\"\r\n",fileName2] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[[NSString stringWithString:@"Content-Type: application/octet-stream\r\n\r\n"] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[NSData dataWithData:imgdata1]]; //[body appendData:[[NSString stringWithFormat:@"\r\n--%@--\r\n",boundary] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[string3 dataUsingEncoding:NSUTF8StringEncoding]]; // setting the body of the post to the reqeust [request setHTTPBody:body]; // now lets make the connection to the web NSData *returnData = [NSURLConnection sendSynchronousRequest:request returningResponse:nil error:nil]; NSString *returnString = [[NSString alloc] initWithData:returnData encoding:NSUTF8StringEncoding]; if([returnString isEqualToString:@"SUCCESS"]) { NSLog(returnString); k=k+2; j=j+2; [self performSelectorInBackground:@selector(save:) withObject:(id)[NSNumber numberWithInt:j]]; } [imgdata release]; [imgdata1 release]; [NSThread sleepForTimeInterval:.01]; } [pool drain]; //<-------------Line 266 } I don't understand what is causing the crash.

    Read the article

  • Need some suggestions on my softwares architecture. [Code review]

    - by Sergio Tapia
    I'm making an open source C# library for other developers to use. My key concern is ease of use. This means using intuitive names, intuitive method usage and such. This is the first time I've done something with other people in mind, so I'm really concerned about the quality of the architecture. Plus, I wouldn't mind learning a thing or two. :) I have three classes: Downloader, Parser and Movie I was thinking that it would be best to only expose the Movie class of my library and have Downloader and Parser remain hidden from invocation. Ultimately, I see my library being used like this. using FreeIMDB; public void Test() { var MyMovie = Movie.FindMovie("The Matrix"); //Now MyMovie would have all it's fields set and ready for the big show. } Can you review how I'm planning this, and point out any wrong judgement calls I've made and where I could improve. Remember, my main concern is ease of use. Movie.cs using System; using System.Collections.Generic; using System.Linq; using System.Text; using System.Drawing; namespace FreeIMDB { public class Movie { public Image Poster { get; set; } public string Title { get; set; } public DateTime ReleaseDate { get; set; } public string Rating { get; set; } public string Director { get; set; } public List<string> Writers { get; set; } public List<string> Genres { get; set; } public string Tagline { get; set; } public string Plot { get; set; } public List<string> Cast { get; set; } public string Runtime { get; set; } public string Country { get; set; } public string Language { get; set; } public Movie FindMovie(string Title) { Movie film = new Movie(); Parser parser = Parser.FromMovieTitle(Title); film.Poster = parser.Poster(); film.Title = parser.Title(); film.ReleaseDate = parser.ReleaseDate(); //And so an so forth. } public Movie FindKnownMovie(string ID) { Movie film = new Movie(); Parser parser = Parser.FromMovieID(ID); film.Poster = parser.Poster(); film.Title = parser.Title(); film.ReleaseDate = parser.ReleaseDate(); //And so an so forth. } } } Parser.cs using System; using System.Collections.Generic; using System.Linq; using System.Text; using HtmlAgilityPack; namespace FreeIMDB { /// <summary> /// Provides a simple, and intuitive way for searching for movies and actors on IMDB. /// </summary> class Parser { private Downloader downloader = new Downloader(); private HtmlDocument Page; #region "Page Loader Events" private Parser() { } public static Parser FromMovieTitle(string MovieTitle) { var newParser = new Parser(); newParser.Page = newParser.downloader.FindMovie(MovieTitle); return newParser; } public static Parser FromActorName(string ActorName) { var newParser = new Parser(); newParser.Page = newParser.downloader.FindActor(ActorName); return newParser; } public static Parser FromMovieID(string MovieID) { var newParser = new Parser(); newParser.Page = newParser.downloader.FindKnownMovie(MovieID); return newParser; } public static Parser FromActorID(string ActorID) { var newParser = new Parser(); newParser.Page = newParser.downloader.FindKnownActor(ActorID); return newParser; } #endregion #region "Page Parsing Methods" public string Poster() { //Logic to scrape the Poster URL from the Page element of this. return null; } public string Title() { return null; } public DateTime ReleaseDate() { return null; } #endregion } } ----------------------------------------------- Do you guys think I'm heading towards a good path, or am I setting myself up for a world of hurt later on? My original thought was to separate the downloading, the parsing and the actual populating to easily have an extensible library. Imagine if one day the website changed its HTML, I would then only have to modifiy the parsing class without touching the Downloader.cs or Movie.cs class. Thanks for reading and for helping!

    Read the article

  • Error showing is NullPointerException [duplicate]

    - by user3659612
    This question already has an answer here: How to check a string against null in java? 11 answers I was trying to code a wifi scanner which does 20 scans but it shows NullPointerException at if(bssid[j].equals(null)){ My code is slightly huge package com.example.scanner; import java.io.File; import java.io.FileNotFoundException; import java.io.FileOutputStream; import java.io.IOException; import java.io.OutputStreamWriter; import java.text.SimpleDateFormat; import java.util.Date; import java.util.List; import android.annotation.SuppressLint; import android.content.BroadcastReceiver; import android.content.Context; import android.content.Intent; import android.content.IntentFilter; import android.net.wifi.ScanResult; import android.net.wifi.WifiInfo; import android.net.wifi.WifiManager; import android.os.Bundle; import android.os.Environment; import android.support.v7.app.ActionBarActivity; import android.view.Menu; import android.view.View; import android.widget.ArrayAdapter; import android.widget.Button; import android.widget.ListView; import android.widget.Toast; public class MainActivity extends ActionBarActivity { WifiManager wifi; WifiScanReceiver wifireciever; WifiInfo info; Button scan, save; List<ScanResult> wifilist; ListView list; String wifis[]; String name; String[] ssid = new String[100]; String[] bssid = new String[100]; int[] lvl = new int[100]; int[] count = new int[100]; @Override protected void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.fragment_main); list=(ListView)findViewById(R.id.listView1); scan=(Button)findViewById(R.id.button1); save=(Button)findViewById(R.id.button2); scan.setOnClickListener(new View.OnClickListener() { @Override public void onClick(View v) { // TODO Auto-generated method stub wifi=(WifiManager)getSystemService(Context.WIFI_SERVICE); if (wifi.isWifiEnabled()==false){ wifi.setWifiEnabled(true); } wifireciever = new WifiScanReceiver(); for (int i=0;i<20;i++){ registerReceiver(wifireciever, new IntentFilter(WifiManager.SCAN_RESULTS_AVAILABLE_ACTION)); wifi.startScan(); if (i==19){ Toast.makeText(getBaseContext(), "Scan Finish", Toast.LENGTH_LONG).show(); } } } }); save.setOnClickListener(new View.OnClickListener() { @Override public void onClick(View v) { // TODO Auto-generated method stub savedata(); } }); } protected void savedata() { // TODO Auto-generated method stub try { File sdcard = Environment.getExternalStorageDirectory(); File directory = new File(sdcard.getAbsolutePath() + "/WIFI_RESULT"); directory.mkdirs(); name = new SimpleDateFormat("yyyy-MM-dd HH mm ss").format(new Date()); File file = new File(directory,name + "wifi_data.txt"); FileOutputStream fou = new FileOutputStream(file); OutputStreamWriter osw = new OutputStreamWriter(fou); try { for (int i =0; i < list.getCount(); i++){ osw.append(list.getItemAtPosition(i).toString()); } osw.flush(); osw.close(); Toast.makeText(getBaseContext(), "Saved", Toast.LENGTH_LONG).show(); } catch (IOException e){ e.printStackTrace(); } } catch (FileNotFoundException e){ e.printStackTrace(); } } class WifiScanReceiver extends BroadcastReceiver { @SuppressLint("UseValueOf") public void onReceive(Context c, Intent intent) { int a =0; wifi.startScan(); List<ScanResult> wifilist = wifi.getScanResults(); if (a<wifilist.size()){ a=wifilist.size(); } for(int j=0;j<wifilist.size();j++){ if(bssid[j].equals(null)){ ssid[j] = wifilist.get(j).SSID.toString(); bssid[j] = wifilist.get(j).BSSID.toString(); lvl[j] = wifilist.get(j).level; count[j]++; } else if (bssid[j].equals(wifilist.get(j).BSSID.toString())){ lvl[j] = lvl[j] + wifilist.get(j).level; count[j]++; } } wifis = new String[a]; for (int i =0; i<a; i++){ wifis[i] = ("\n" + ssid[i] + "\n AP Address" + bssid[i] + "\n Signal Strength:" + lvl[i]/count[i]).toString(); } list.setAdapter(new ArrayAdapter<String>(getApplicationContext(), android.R.layout.simple_list_item_1,wifis)); } } protected void onDestroy() { unregisterReceiver(wifireciever); super.onPause(); } protected void onResume() { registerReceiver(wifireciever, new IntentFilter(WifiManager.SCAN_RESULTS_AVAILABLE_ACTION)); super.onResume(); } @Override public boolean onCreateOptionsMenu(Menu menu) { // Inflate the menu; this adds items to the action bar if it is present. getMenuInflater().inflate(R.menu.main, menu); return true; } } NullPointerException at that point mean my array bssid isn't initialize. So I just want to know how to initialize it in main activity so that I can use that string bssid anywhere.

    Read the article

  • spoof mac address

    - by Cold-Blooded
    // macaddress.cpp : Defines the entry point for the console application. // #include "stdafx.h" #include <windows.h> #include <iostream> using namespace std; void readregistry(); void spoofmac(); void main(int argc, char* argv[]) { readregistry(); spoofmac(); } void spoofmac() { ////////////////////// ////////Write to Registry char buffer[60]; unsigned long size = sizeof(buffer); HKEY software; LPCTSTR location; char adapternum[10]=""; char numbers[11]="0123456789"; char editlocation[]="System\\CurrentControlSet\\Control\\Class\\{4D36E972-E325-11CE-BFC1-08002bE10318}\\0000"; char macaddress[60]; cout << "\n//////////////////////////////////////////////////////////////////\nPlease Enter Number of Network Adapter to Spoof or type 'E' to Exit.\nE.g. 18\n\nNumber: "; cin >> adapternum; if (adapternum[0]=='E') { exit(0); } if (strlen(adapternum)==2) { editlocation[strlen(editlocation)-2]=adapternum[0]; editlocation[strlen(editlocation)-1]=adapternum[1]; } if (strlen(adapternum)==1) { editlocation[strlen(editlocation)-1]=adapternum[0]; } if (strlen(adapternum)!=1 && strlen(adapternum)!=2) { cout << "Invaild Network Adapter Chosen\n\n"; exit(0); } cout << "Please Enter the Desired Spoofed Mac Address Without Dashes\nE.g. 00123F0F6D7F\n\nNew Mac: "; cin >> macaddress; location = editlocation; //error line strcpy(buffer,macaddress); size=sizeof(buffer); RegCreateKey(HKEY_LOCAL_MACHINE,location,&software); //RegSetValueEx(software,"NetworkAddress",NULL,REG_SZ,(LPBYTE)buffer,size); RegCloseKey(software); cout << "\nMac Address Successfully Spoofed.\n\nWritten by Lyth0s\n\n"; } void readregistry () { //////////////////////////////////// // Read From Registry char driver[60]=""; char mac[60]=""; char numbers[11]="0123456789"; char editlocation[]="System\\CurrentControlSet\\Control\\Class\\{4D36E972-E325-11CE-BFC1-08002bE10318}\\0000"; unsigned long driversize = sizeof(driver); unsigned long macsize = sizeof(mac); DWORD type; HKEY software; LPCTSTR location; int tenscount=0; int onescount=0; for (int x =0;x<=19; x+=1) { strcpy(driver,""); driversize=sizeof(driver); strcpy(mac,""); macsize=sizeof(mac); if (editlocation[strlen(editlocation)-1]=='9') { tenscount+=1; onescount=0; editlocation[strlen(editlocation)-2]=numbers[tenscount]; } editlocation[strlen(editlocation)-1]=numbers[onescount]; location=editlocation; //error line // cout << location << "\n"; // cout << "Checking 00" << location[strlen(location)-2] << location[strlen(location)-1] << "\n\n"; RegCreateKey(HKEY_LOCAL_MACHINE,location,&software); RegQueryValueEx(software,"DriverDesc",NULL,&type,(LPBYTE)driver,&driversize); //RegCloseKey(software); //RegCreateKey(HKEY_LOCAL_MACHINE,location,&software); RegQueryValueEx(software,"NetworkAddress",NULL,&type,(LPBYTE)mac,&macsize); RegCloseKey(software); cout << x << ": " << driver << "| Mac: " << mac << "\n"; onescount+=1; } } this program gives error as follows error C2440: '=' : cannot convert from 'char [83]' to 'LPCTSTR' why this error coming please explain

    Read the article

  • Json / Jsonp not connecting to php (Phonegap + jquerymobile)

    - by Madhulika Mukherjee
    I am trying to make - an android WEB application with phonegap layout with JqueryMobile What Im doing - An html form that takes ID, name, and address as input 'Serialize's this data using ajax makes a json object out of it Should send it to a file called 'connection.php' Where, this data is put into a database (MySql) Other details - My server is localhost, Im using xampp I have already created a database and table using phpmyadmin The problem - My html file, where my json object is created, does not connect to the php file which is hosted by my localhost Here is my COMPLETE html file: <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01//EN" "http://www.w3.org/TR/html4/strict.dtd"> <html> <head> <!-- Change this if you want to allow scaling --> <meta name="viewport" content="width=default-width; user-scalable=no" /> <meta http-equiv="Content-type" content="text/html;charset=utf-8"> <title>Trial app</title> <link rel="stylesheet" href="thestylesheet.css" type="text/css"> <script type="text/javascript" charset="utf-8" src="javascript1.js"></script> <script type="text/javascript" charset="utf-8" src="javascript2.js"></script> <script type="text/javascript" charset="utf-8" src="cordova-1.8.0.js"></script> <script> $(document).ready(function () { $("#btn").click( function() { alert('hello hello'); $.ajax({ url: "connection.php", type: "POST", data: { id: $('#id').val(), name: $('#name').val(), Address: $('#Address').val() }, datatype: "json", success: function (status) { if (status.success == false) { alert("Failure!"); } else { alert("Success!"); } } }); }); }); </script> </head> <body> <div data-role="header"> <h1>Heading of the app</h1> </div><!-- /header --> <div data-role="content"> <form id="target" method="post"> <label for="id"> <input type="text" id="id" placeholder="ID"> </label> <label for="name"> <input type="text" id="name" placeholder="Name"> </label> <label for="Address"> <input type="text" id="Address" placeholder="Address"> </label> <div id="btn" data-role="button" data-icon="star" data-theme="e">Add record</div> <!--<input type="submit" value="Add record" data-icon="star" data-theme="e"> --> </form> </div> </body> </html> And here is my 'connection.php' hosted by my localhost <?php header('Content-type: application/json'); $server = "localhost"; $username = "root"; $password = ""; $database = "jqueryex"; $con = mysql_connect($server, $username, $password); if($con) { echo "Connected to database!"; } else { echo "Could not connect!"; } //or die ("Could not connect: " . mysql_error()); mysql_select_db($database, $con); /* CREATE TABLE `sample` ( `id` int(11) unsigned NOT NULL AUTO_INCREMENT, `name` varchar(45) DEFAULT NULL, `Address` varchar(45) DEFAULT NULL, PRIMARY KEY (`id`) ) */ $id= json_decode($_POST['id']); $name = json_decode($_POST['name']); $Address = json_decode($_POST['Address']); $sql = "INSERT INTO sample (id, name, Address) "; $sql .= "VALUES ($id, '$name', '$Address')"; if (!mysql_query($sql, $con)) { die('Error: ' . mysql_error()); } else { echo "Comment added"; } mysql_close($con); ?> My doubts: No entry is made in my table 'sample' when i view it in phpmyadmin So obviously, i see no success messages either I dont get any errors, not from ajax and neither from the php file. Stuff Im suspecting: Should i be using jsonp instead of json? Im new to this. Is there a problem with my php file? Perhaps I need to include some more javascript files in my html file? I assume this is a very simple problem so please help me out! I think there is just some conceptual error, as i have only just started with jquery, ajax, and json. Thank you.

    Read the article

  • Access Qry Questions

    - by kralco626
    It was suggested that I repost this questions as I didn't do a very good job discribing my issue the first time. (http://stackoverflow.com/questions/2921286/access-question) THE SITUATION: I have inspections from many months of many years. Sometimes there is more than one inspection in a month, sometimes there is no inspection. However, the report that is desired by the clients requires that I have EXACTLY ONE record per month for the time frame they request the report. They understand the data issues and have stated that if there is more than one inspection in a month to take the latest one. If the is not an inspection for that month, go back in time untill you find one and use that one. So a sample of the data is as follows: (I am including many records because I was told I did not include enough data on my last try) equip_id month year runtime date 1 5 2008 400 5/10/2008 12:34 PM 1 7 2008 500 7/12/2008 1:45 PM 1 8 2008 600 8/20/2008 1:12 PM 1 8 2008 605 8/30/2008 8:00 AM 1 1 2010 2000 1/12/2010 2:00 PM 1 3 2010 2200 3/24/2010 10:00 AM 2 7 2009 1000 7/20/2009 8:00 AM 2 10 2009 1400 10/14/2009 9:00 AM 2 1 2010 1600 1/15/2010 1:00 PM 2 1 2010 1610 1/30/2010 4:00 PM 2 3 2010 1800 3/15/2010 1:00PM After all the transformations to the data are done, it should look like this: equip_id month year runtime date 1 5 2008 400 5/10/2008 12:34 PM 1 6 2008 400 5/10/2008 12:34 PM 1 7 2008 500 7/12/2008 1:45 PM 1 8 2008 605 8/30/2008 8:00 AM 1 9 2008 605 8/30/2008 8:00 AM 1 10 2008 605 8/30/2008 8:00 AM 1 11 2008 605 8/30/2008 8:00 AM 1 12 2008 605 8/30/2008 8:00 AM 1 1 2009 605 8/30/2008 8:00 AM 1 2 2009 605 8/30/2008 8:00 AM 1 3 2009 605 8/30/2008 8:00 AM 1 4 2009 605 8/30/2008 8:00 AM 1 5 2009 605 8/30/2008 8:00 AM 1 6 2009 605 8/30/2008 8:00 AM 1 7 2009 605 8/30/2008 8:00 AM 1 8 2009 605 8/30/2008 8:00 AM 1 9 2009 605 8/30/2008 8:00 AM 1 10 2009 605 8/30/2008 8:00 AM 1 11 2009 605 8/30/2008 8:00 AM 1 12 2009 605 8/30/2008 8:00 AM 1 1 2010 2000 1/12/2010 2:00 PM 1 2 2010 2000 1/12/2010 2:00 PM 1 3 2010 2200 3/24/2010 10:00 AM 2 7 2009 1000 7/20/2009 8:00 AM 2 8 2009 1000 7/20/2009 8:00 AM 2 9 2009 1000 7/20/2009 8:00 AM 2 10 2009 1400 10/14/2009 9:00 AM 2 11 2009 1400 10/14/2009 9:00 AM 2 12 2009 1400 10/14/2009 9:00 AM 2 1 2010 1610 1/30/2010 4:00 PM 2 2 2010 1610 1/30/2010 4:00 PM 2 3 2010 1800 3/15/2010 1:00PM I think that this is the most accurate dipiction of the problem that I can give. I will now say what I have tried. Although if someone else has a better approach, I am perfectly willing to throw away what I have done and do it differently... STEP 1: create a query that removes the duplicates from the data. Ie. only one record per equip_id for each month/year, keeping the latest one. (done successfully) STEP 2: create a table of the date ranges the client wants the report for. (This is done dynamically at runtime) This table two field, Month and Year. So if the client wants a report from FEb 2008 to March 2010 the table would look like: Month Year 2 2008 3 2008 . . . 12 2008 1 2009 . . . 12 2009 1 2010 2 2010 3 2010 I then left joined this table with my query from step 1. So now I have a record for every month and every year that they want the report for, with nulls(or blanks) or sometimes 0s (not sure why, access is weird, but sometiems they are nulls and sumtimes they are 0s...) for the runtimes that are not avaiable. I don't particurally like this solution, but ill do it if i have to. (this is also done successfully) STEP 3: Fill in the missing runtime values. This I HAVE NOT done successfully. Note that if the request range for the report is feb 2008 to march 2010 and the oldest record for a particular equip_id is say june 2008, it is O.K. for the runtimes to be null (or zeros) for feb - may 2008. I am working with the following query for this step: SELECT equip_id as e_id,year,month, (select top 1 runhours from qry_1_c_One_Record_per_Month a where a.equip_id = e_id order by year,month) FROM qry_1_c_One_Record_per_Month where runhours is null or runhours = 0; UNION SELECT equip_id, year, month, runhours FROM qry_1_c_One_Record_per_Month WHERE .runhours Is Not Null And runhours <> 0 However I clearly can't check the a.equip_id = e_id ... so i don't have anyway to make sure i'm looking at the correct equip_id SUMMARY: So like i said i'm willing to throw away any part, or all of what I tried. Just trying to give everyone a complete picture. I REALLY apreciate ANY help! Thanks so much in advance!

    Read the article

  • How to get latitude and longitude position that stored in MySQL and use it in Android map application

    - by gunawan haruna
    I have tried to get the latitude and longitude position that was stored in MySQL. I want use the values to my Android map application. Here is my code: deskripsi.Java Button direction = (Button) findViewById (R.id.btnDir); direction.setOnClickListener(new OnClickListener(){ public void onClick(View arg0) { Intent z = getIntent(); des_lat = z.getExtras().getString("des_lat"); des_long = z.getExtras().getString("des_long"); Intent i = new Intent(android.content.Intent.ACTION_VIEW, Uri.parse("http://maps.google.com/maps?&daddr="+des_lat+","+des_long)); //("geo:37.827500,-122.481670")); startActivity(i); } }); And here is the content.Java private ListView list; int x; private String panjang[]; public void onCreate(Bundle savedInstanceState) { // TODO Auto-generated method stub super.onCreate(savedInstanceState); setContentView(R.layout.kontent); super.initButtonSearch(); list = (ListView) findViewById(R.id.list); JSONObject jo; try { jo = new JSONObject(JsonKontent); JSONArray ja = jo.getJSONArray("result"); System.out.println("Panjang : " + ja.length()); if (ja.length() == 0) { Toast.makeText(Content.this, "Data tidak ada!", Toast.LENGTH_LONG).show(); finish(); } content_id = new String[ja.length()]; c_title = new String[ja.length()]; c_telephone = new String[ja.length()]; c_short_description = new String[ja.length()]; c_long_description = new String[ja.length()]; c_image1 = new String[ja.length()]; c_image2 = new String[ja.length()]; l_address = new String[ja.length()]; catagory_id = new String[ja.length()]; Location myLoc = new Location("sharedPreferences"); Location restLoc = new Location("restaurantTable"); l_latitude = new String[ja.length()]; l_longitude = new String[ja.length()]; c_name = new String[ja.length()]; panjang = new String[ja.length()]; for (x = 0; x < ja.length(); x++) { JSONObject joj = ja.getJSONObject(x); content_id[x] = joj.getString("content_id"); catagory_id[x] = joj.getString("catagory_id"); c_title[x] = joj.getString("c_title"); c_telephone[x] = joj.getString("c_telephone"); c_short_description[x] = joj.getString("c_short_description"); c_long_description[x] = joj.getString("c_long_description"); c_image1[x] = HTTPConnection.urlPicture + joj.getString("c_image1"); c_image2[x] = HTTPConnection.urlPicture + joj.getString("c_image2"); l_address[x] = joj.getString("l_address"); l_latitude[x] = joj.getString("l_latitude"); l_longitude[x] = joj.getString("l_longitude"); c_name[x] = joj.getString("c_name"); myLoc.setLatitude(myLatitude); myLoc.setLongitude(myLongitude); restLoc.setLatitude(Double.parseDouble(l_latitude[x])); restLoc.setLongitude(Double.parseDouble(l_longitude[x])); float f = myLoc.distanceTo(restLoc); int f_int = Math.round(f / 100); f = Float.valueOf(f_int) / 10; String dist = new DecimalFormat("#,##0.0").format(f); System.out.println("Panjang " + dist + " km"); panjang[x] = dist + " km"; } } catch (JSONException e) { Toast.makeText(Content.this, "Data yang dicari tidak ada!", Toast.LENGTH_LONG).show(); finish(); } PFCAdapter adapter = new PFCAdapter(this, c_image1, c_title, l_address, panjang); list.setAdapter(adapter); list.setOnItemClickListener(new OnItemClickListener() { public void onItemClick(AdapterView<?> arg0, View arg1, int arg2, long arg3) { // TODO Auto-generated method stub System.out.println("Content ID: " + Content.content_id[Deskripsi.id]); Deskripsi.id = arg2; waitDialog = ProgressDialog.show(Content.this, "Memuat", "Harap tunggu, sedang terhubung dengan server"); waitDialog.setIcon(R.drawable.iconnya); waitDialog.show(); new LihatRatingTask().execute(); } }); } class LihatRatingTask extends AsyncTask<Void, Void, Void> { protected Void doInBackground(Void... Arg0) { Deskripsi.jsonRating = HTTPConnection.openUrl(HTTPConnection.host + "lihat_rating.php?content_id=" + Content.content_id[Deskripsi.id]); Deskripsi.jsonSubCategory = HTTPConnection .openUrl(HTTPConnection.host + "sub_catagory_parameter.php?content_id=" + Content.content_id[Deskripsi.id]); RoutePath.place = HTTPConnection .LoadImageFromWeb(HTTPConnection.host + "Logo/" + image[Integer.valueOf(catagory_id[Deskripsi.id]) - 1]); Intent i = new Intent(Content.this, Deskripsi.class); i.putExtra("des_lat", l_latitude); i.putExtra("des_long", l_longitude); startActivity(i); waitDialog.dismiss(); return null; } protected void onPostExecute(Void result) { // TODO Auto-generated method stub super.onPostExecute(result); waitDialog.dismiss(); } } } The result is in destination EditText in maps application for Android "null,null" How to make it "destination_latitude, destination_longitude"? Help me please.

    Read the article

  • Does my basic PHP Socket Server need optimization?

    - by Tom
    Like many people, I can do a lot of things with PHP. One problem I do face constantly is that other people can do it much cleaner, much more organized and much more structured. This also results in much faster execution times and much less bugs. I just finished writing a basic PHP Socket Server (the real core), and am asking you if you can tell me what I should do different before I start expanding the core. I'm not asking about improvements such as encrypted data, authentication or multi-threading. I'm more wondering about questions like "should I maybe do it in a more object oriented way (using PHP5)?", or "is the general structure of the way the script works good, or should some things be done different?". Basically, "is this how the core of a socket server should work?" In fact, I think that if I just show you the code here many of you will immediately see room for improvements. Please be so kind to tell me. Thanks! #!/usr/bin/php -q <? // config $timelimit = 180; // amount of seconds the server should run for, 0 = run indefintely $address = $_SERVER['SERVER_ADDR']; // the server's external IP $port = 9000; // the port to listen on $backlog = SOMAXCONN; // the maximum of backlog incoming connections that will be queued for processing // configure custom PHP settings error_reporting(1); // report all errors ini_set('display_errors', 1); // display all errors set_time_limit($timelimit); // timeout after x seconds ob_implicit_flush(); // results in a flush operation after every output call //create master IPv4 based TCP socket if (!($master = socket_create(AF_INET, SOCK_STREAM, SOL_TCP))) die("Could not create master socket, error: ".socket_strerror(socket_last_error())); // set socket options (local addresses can be reused) if (!socket_set_option($master, SOL_SOCKET, SO_REUSEADDR, 1)) die("Could not set socket options, error: ".socket_strerror(socket_last_error())); // bind to socket server if (!socket_bind($master, $address, $port)) die("Could not bind to socket server, error: ".socket_strerror(socket_last_error())); // start listening if (!socket_listen($master, $backlog)) die("Could not start listening to socket, error: ".socket_strerror(socket_last_error())); //display startup information echo "[".date('Y-m-d H:i:s')."] SERVER CREATED (MAXCONN: ".SOMAXCONN.").\n"; //max connections is a kernel variable and can be adjusted with sysctl echo "[".date('Y-m-d H:i:s')."] Listening on ".$address.":".$port.".\n"; $time = time(); //set startup timestamp // init read sockets array $read_sockets = array($master); // continuously handle incoming socket messages, or close if time limit has been reached while ((!$timelimit) or (time() - $time < $timelimit)) { $changed_sockets = $read_sockets; socket_select($changed_sockets, $write = null, $except = null, null); foreach($changed_sockets as $socket) { if ($socket == $master) { if (($client = socket_accept($master)) < 0) { echo "[".date('Y-m-d H:i:s')."] Socket_accept() failed, error: ".socket_strerror(socket_last_error())."\n"; continue; } else { array_push($read_sockets, $client); echo "[".date('Y-m-d H:i:s')."] Client #".count($read_sockets)." connected (connections: ".count($read_sockets)."/".SOMAXCONN.")\n"; } } else { $data = @socket_read($socket, 1024, PHP_NORMAL_READ); //read a maximum of 1024 bytes until a new line has been sent if ($data === false) { //the client disconnected $index = array_search($socket, $read_sockets); unset($read_sockets[$index]); socket_close($socket); echo "[".date('Y-m-d H:i:s')."] Client #".($index-1)." disconnected (connections: ".count($read_sockets)."/".SOMAXCONN.")\n"; } else { if ($data = trim($data)) { //remove whitespace and continue only if the message is not empty switch ($data) { case "exit": //close connection when exit command is given $index = array_search($socket, $read_sockets); unset($read_sockets[$index]); socket_close($socket); echo "[".date('Y-m-d H:i:s')."] Client #".($index-1)." disconnected (connections: ".count($read_sockets)."/".SOMAXCONN.")\n"; break; default: //for experimental purposes, write the given data back socket_write($socket, "\n you wrote: ".$data); } } } } } } socket_close($master); //close the socket echo "[".date('Y-m-d H:i:s')."] SERVER CLOSED.\n"; ?>

    Read the article

  • Reading Excel using OpenXML

    public DataTable ReadDataFromExcel()        {         string filePath = @"c:/temp/temp.xlsx";            using (SpreadsheetDocument LobjDocument = SpreadsheetDocument.Open(filePath, false))            {                            WorkbookPart LobjWorkbookPart = LobjDocument.WorkbookPart;                Sheet LobjSheetToImport = LobjWorkbookPart.Workbook.Descendants<Sheet>().First<Sheet>();                WorksheetPart LobjWorksheetPart = (WorksheetPart)(LobjWorkbookPart.GetPartById(LobjSheetToImport.Id));                SheetData LobjSheetData = LobjWorksheetPart.Worksheet.Elements<SheetData>().First();                //Read only the data rows and skip all the header rows.                int LiRowIterator = 1;                //  for progress bar                int LiTotal = LobjSheetData.Elements<Row>().Count() - MobjImportMapper.HeaderRowIndex;                // =================                foreach (Row LobjRowItem in LobjSheetData.Elements<Row>().Skip(6))                {                    DataRow LdrDataRow = LdtExcelData.NewRow();                    int LiColumnIndex = 0;                    int LiHasData = 0;                    LdrDataRow[LiColumnIndex] = LobjRowItem.RowIndex; //LiRowIterator;                    LiColumnIndex++;                    //TODO: handle restriction of column range.                    foreach (Cell LobjCellItem in LobjRowItem.Elements<Cell>().Where(PobjCell                        => ImportHelper.GetColumnIndexFromExcelColumnName(ImportHelper.GetColumnName(PobjCell.CellReference))                        <= MobjImportMapper.LastColumnIndex))                    {                                             // Gets the column index of the cell with data                        int LiCellColumnIndex = 10;                        if (LiColumnIndex < LiCellColumnIndex)                        {                            do                            {                                LdrDataRow[LiColumnIndex] = string.Empty;                                LiColumnIndex++;                            }                            while (LiColumnIndex < LiCellColumnIndex);                        }                        string LstrCellValue = LobjCellItem.InnerText;                        if (LobjCellItem.DataType != null)                        {                            switch (LobjCellItem.DataType.Value)                            {                                case CellValues.SharedString:                                    var LobjStringTable = LobjWorkbookPart.GetPartsOfType<SharedStringTablePart>().FirstOrDefault();                                    DocumentFormat.OpenXml.OpenXmlElement LXMLElment = null;                                    string LstrXMLString = String.Empty;                                    if (LobjStringTable != null)                                    {                                        LstrXMLString =                                            LobjStringTable.SharedStringTable.ElementAt(int.Parse(LstrCellValue, CultureInfo.InvariantCulture)).InnerXml;                                        if (LstrXMLString.IndexOf("<x:rPh", StringComparison.CurrentCulture) != -1)                                        {                                            LXMLElment = LobjStringTable.SharedStringTable.ElementAt(int.Parse(LstrCellValue, CultureInfo.InvariantCulture)).FirstChild;                                            LstrCellValue = LXMLElment.InnerText;                                        }                                        else                                        {                                            LstrCellValue = LobjStringTable.SharedStringTable.ElementAt(int.Parse(LstrCellValue, CultureInfo.InvariantCulture)).InnerText;                                        }                                    }                                    break;                                default:                                    break;                            }                        }                        LdrDataRow[LiColumnIndex] = LstrCellValue.Trim();                        if (!string.IsNullOrEmpty(LstrCellValue))                            LiHasData++;                       LiColumnIndex++;                    }                    if (LiHasData > 0)                    {                        LiRowIterator++;                        LdtExcelData.Rows.Add(LdrDataRow);                    }                }            }                       return LdtExcelData;        } span.fullpost {display:none;}

    Read the article

< Previous Page | 410 411 412 413 414 415 416 417 418 419 420 421  | Next Page >