Search Results

Search found 21111 results on 845 pages for 'null pointer'.

Page 413/845 | < Previous Page | 409 410 411 412 413 414 415 416 417 418 419 420  | Next Page >

  • Decode html tag so that it can be read when it goes back to the server more specifically the controller

    - by Yusuf
    My engine is Aspx. How can I decode/encode the html tags that is in my text box. I have the html tag to make it more readable. I tried the ValidationRequest and the htmlDecode(freqQuestion.Answer) but no luck. I just keep getting the same message. Server Error in '/Administrator' Application. A potentially dangerous Request.Form value was detected from the client (QuestionAnswer="...ics Phone:123-456-7890 Description: Request Validation has detected a potentially dangerous client input value, and processing of the request has been aborted. This value may indicate an attempt to compromise the security of your application, such as a cross-site scripting attack. To allow pages to override application request validation settings, set the requestValidationMode attribute in the httpRuntime configuration section to requestValidationMode="2.0". Example: . After setting this value, you can then disable request validation by setting validateRequest="false" in the Page directive or in the configuration section. However, it is strongly recommended that your application explicitly check all inputs in this case. For more information, see http://go.microsoft.com/fwlink/?LinkId=153133. View Page <%@ Page Title="" Language="C#" MasterPageFile="~/Views/Shared/Site.Master" validateRequest="false" Inherits="System.Web.Mvc.ViewPage<dynamic>" %> <asp:Content ID="Content1" ContentPlaceHolderID="TitleContent" runat="server"> EditFreqQuestionsUser </asp:Content> <asp:Content ID="Content2" ContentPlaceHolderID="MainContent" runat="server"> <script type="text/javascript"> $(document).ready(function () { $("#freqQuestionsUserUpdateButton").click(function () { $("#updateFreqQuestionsUser").submit(); }); }); </script> <h2>Edit Freq Questions User </h2> <%Administrator.DarkstarAdminProductionServices.FreqQuestionsUser freqQuestionsUser = ViewBag.freqQuestionsUser != null ? ViewBag.freqQuestionsUser : new Administrator.DarkstarAdminProductionServices.FreqQuestionsUser(); %> <%List<string> UserRoleList = Session["UserRoles"] != null ? (List<string>)Session["UserRoles"] : new List<string>(); %> <form id="updateFreqQuestionsUser" action="<%=Url.Action("SaveFreqQuestionsUser","Prod")%>" method="post"> <table> <tr> <td colspan="3" class="tableHeader">Freq Questions User Details <input type ="hidden" value="<%=freqQuestionsUser.freqQuestionsUserId%>" name="freqQuestionsUserId"/> </td> </tr> <tr> <td colspan="2" class="label">Question Description:</td> <td class="content"> <input type="text" maxlength="2000" name="QuestionDescription" value="<%=freqQuestionsUser.questionDescription%>" /> </td> </tr> <tr> <td colspan="2" class="label">QuestionAnswer:</td> <td class="content"> <input type="text" maxlength="2000" name="QuestionAnswer" value="<%=Server.HtmlDecode(freqQuestionsUser.questionAnswer)%>" /> </td> </tr> <tr> <td colspan="3" class="tableFooter"> <br /> <a id="freqQuestionsUserUpdateButton" href="#" class="regularButton">Save</a> <a href="javascript:history.back()" class="regularButton">Cancel</a> </td> </tr> </table> </form> </asp:Content> Controller [AuthorizeAttribute(AdminRoles = "EditFreqQuestionsUser")] public ActionResult SaveFreqQuestionsUser(string QuestionDescription, string QuestionAnswer) { Guid freqQuestionsUserId = Request.Form["freqQuestionsUserId"] != null ? new Guid(Request.Form["freqQuestionsUserId"]) : Guid.Empty; //load agreement eula ref AdminProductionServices.FreqQuestionsUser freqqQuestionsUser = Administrator.Models.AdminProduction.FreqQuestionsUser.LoadFreqQuestionsUser(freqQuestionsUserId, string.Empty, string.Empty)[0]; freqqQuestionsUser.questionDescription = QuestionDescription; freqqQuestionsUser.questionAnswer = QuestionAnswer; //save it Administrator.Models.AdminProduction.FreqQuestionsUser.addFreqQuestionsUser(freqqQuestionsUser); return RedirectToAction("SearchFreqQuestionsUser", "Prod", new { FreqQuestionsUserId = freqQuestionsUserId }); }

    Read the article

  • Windows Azure Service Bus Scatter-Gather Implementation

    - by Alan Smith
    One of the more challenging enterprise integration patterns that developers may wish to implement is the Scatter-Gather pattern. In this article I will show the basic implementation of a scatter-gather pattern using the topic-subscription model of the windows azure service bus. I’ll be using the implementation in demos, and also as a lab in my training courses, and the pattern will also be included in the next release of my free e-book the “Windows Azure Service Bus Developer Guide”. The Scatter-Gather pattern answers the following scenario. How do you maintain the overall message flow when a message needs to be sent to multiple recipients, each of which may send a reply? Use a Scatter-Gather that broadcasts a message to multiple recipients and re-aggregates the responses back into a single message. The Enterprise Integration Patterns website provides a description of the Scatter-Gather pattern here.   The scatter-gather pattern uses a composite of the publish-subscribe channel pattern and the aggregator pattern. The publish-subscribe channel is used to broadcast messages to a number of receivers, and the aggregator is used to gather the response messages and aggregate them together to form a single message. Scatter-Gather Scenario The scenario for this scatter-gather implementation is an application that allows users to answer questions in a poll based voting scenario. A poll manager application will be used to broadcast questions to users, the users will use a voting application that will receive and display the questions and send the votes back to the poll manager. The poll manager application will receive the users’ votes and aggregate them together to display the results. The scenario should be able to scale to support a large number of users.   Scatter-Gather Implementation The diagram below shows the overall architecture for the scatter-gather implementation.       Messaging Entities Looking at the scatter-gather pattern diagram it can be seen that the topic-subscription architecture is well suited for broadcasting a message to a number of subscribers. The poll manager application can send the question messages to a topic, and each voting application can receive the question message on its own subscription. The static limit of 2,000 subscriptions per topic in the current release means that 2,000 voting applications can receive question messages and take part in voting. The vote messages can then be sent to the poll manager application using a queue. The voting applications will send their vote messages to the queue, and the poll manager will receive and process the vote messages. The questions topic and answer queue are created using the Windows Azure Developer Portal. Each instance of the voting application will create its own subscription in the questions topic when it starts, allowing the question messages to be broadcast to all subscribing voting applications. Data Contracts Two simple data contracts will be used to serialize the questions and votes as brokered messages. The code for these is shown below.   [DataContract] public class Question {     [DataMember]     public string QuestionText { get; set; } }     To keep the implementation of the voting functionality simple and focus on the pattern implementation, the users can only vote yes or no to the questions.   [DataContract] public class Vote {     [DataMember]     public string QuestionText { get; set; }       [DataMember]     public bool IsYes { get; set; } }     Poll Manager Application The poll manager application has been implemented as a simple WPF application; the user interface is shown below. A question can be entered in the text box, and sent to the topic by clicking the Add button. The topic and subscriptions used for broadcasting the messages are shown in a TreeView control. The questions that have been broadcast and the resulting votes are shown in a ListView control. When the application is started any existing subscriptions are cleared form the topic, clients are then created for the questions topic and votes queue, along with background workers for receiving and processing the vote messages, and updating the display of subscriptions.   public MainWindow() {     InitializeComponent();       // Create a new results list and data bind it.     Results = new ObservableCollection<Result>();     lsvResults.ItemsSource = Results;       // Create a token provider with the relevant credentials.     TokenProvider credentials =         TokenProvider.CreateSharedSecretTokenProvider         (AccountDetails.Name, AccountDetails.Key);       // Create a URI for the serivce bus.     Uri serviceBusUri = ServiceBusEnvironment.CreateServiceUri         ("sb", AccountDetails.Namespace, string.Empty);       // Clear out any old subscriptions.     NamespaceManager = new NamespaceManager(serviceBusUri, credentials);     IEnumerable<SubscriptionDescription> subs =         NamespaceManager.GetSubscriptions(AccountDetails.ScatterGatherTopic);     foreach (SubscriptionDescription sub in subs)     {         NamespaceManager.DeleteSubscription(sub.TopicPath, sub.Name);     }       // Create the MessagingFactory     MessagingFactory factory = MessagingFactory.Create(serviceBusUri, credentials);       // Create the topic and queue clients.     ScatterGatherTopicClient =         factory.CreateTopicClient(AccountDetails.ScatterGatherTopic);     ScatterGatherQueueClient =         factory.CreateQueueClient(AccountDetails.ScatterGatherQueue);       // Start the background worker threads.     VotesBackgroundWorker = new BackgroundWorker();     VotesBackgroundWorker.DoWork += new DoWorkEventHandler(ReceiveMessages);     VotesBackgroundWorker.RunWorkerAsync();       SubscriptionsBackgroundWorker = new BackgroundWorker();     SubscriptionsBackgroundWorker.DoWork += new DoWorkEventHandler(UpdateSubscriptions);     SubscriptionsBackgroundWorker.RunWorkerAsync(); }     When the poll manager user nters a question in the text box and clicks the Add button a question message is created and sent to the topic. This message will be broadcast to all the subscribing voting applications. An instance of the Result class is also created to keep track of the votes cast, this is then added to an observable collection named Results, which is data-bound to the ListView control.   private void btnAddQuestion_Click(object sender, RoutedEventArgs e) {     // Create a new result for recording votes.     Result result = new Result()     {         Question = txtQuestion.Text     };     Results.Add(result);       // Send the question to the topic     Question question = new Question()     {         QuestionText = result.Question     };     BrokeredMessage msg = new BrokeredMessage(question);     ScatterGatherTopicClient.Send(msg);       txtQuestion.Text = ""; }     The Results class is implemented as follows.   public class Result : INotifyPropertyChanged {     public string Question { get; set; }       private int m_YesVotes;     private int m_NoVotes;       public event PropertyChangedEventHandler PropertyChanged;       public int YesVotes     {         get { return m_YesVotes; }         set         {             m_YesVotes = value;             NotifyPropertyChanged("YesVotes");         }     }       public int NoVotes     {         get { return m_NoVotes; }         set         {             m_NoVotes = value;             NotifyPropertyChanged("NoVotes");         }     }       private void NotifyPropertyChanged(string prop)     {         if(PropertyChanged != null)         {             PropertyChanged(this, new PropertyChangedEventArgs(prop));         }     } }     The INotifyPropertyChanged interface is implemented so that changes to the number of yes and no votes will be updated in the ListView control. Receiving the vote messages from the voting applications is done asynchronously, using a background worker thread.   // This runs on a background worker. private void ReceiveMessages(object sender, DoWorkEventArgs e) {     while (true)     {         // Receive a vote message from the queue         BrokeredMessage msg = ScatterGatherQueueClient.Receive();         if (msg != null)         {             // Deserialize the message.             Vote vote = msg.GetBody<Vote>();               // Update the results.             foreach (Result result in Results)             {                 if (result.Question.Equals(vote.QuestionText))                 {                     if (vote.IsYes)                     {                         result.YesVotes++;                     }                     else                     {                         result.NoVotes++;                     }                     break;                 }             }               // Mark the message as complete.             msg.Complete();         }       } }     When a vote message is received, the result that matches the vote question is updated with the vote from the user. The message is then marked as complete. A second background thread is used to update the display of subscriptions in the TreeView, with a dispatcher used to update the user interface. // This runs on a background worker. private void UpdateSubscriptions(object sender, DoWorkEventArgs e) {     while (true)     {         // Get a list of subscriptions.         IEnumerable<SubscriptionDescription> subscriptions =             NamespaceManager.GetSubscriptions(AccountDetails.ScatterGatherTopic);           // Update the user interface.         SimpleDelegate setQuestion = delegate()         {             trvSubscriptions.Items.Clear();             TreeViewItem topicItem = new TreeViewItem()             {                 Header = AccountDetails.ScatterGatherTopic             };               foreach (SubscriptionDescription subscription in subscriptions)             {                 TreeViewItem subscriptionItem = new TreeViewItem()                 {                     Header = subscription.Name                 };                 topicItem.Items.Add(subscriptionItem);             }             trvSubscriptions.Items.Add(topicItem);               topicItem.ExpandSubtree();         };         this.Dispatcher.BeginInvoke(DispatcherPriority.Send, setQuestion);           Thread.Sleep(3000);     } }       Voting Application The voting application is implemented as another WPF application. This one is more basic, and allows the user to vote “Yes” or “No” for the questions sent by the poll manager application. The user interface for that application is shown below. When an instance of the voting application is created it will create a subscription in the questions topic using a GUID as the subscription name. The application can then receive copies of every question message that is sent to the topic. Clients for the new subscription and the votes queue are created, along with a background worker to receive the question messages. The voting application is set to receiving mode, meaning it is ready to receive a question message from the subscription.   public MainWindow() {     InitializeComponent();       // Set the mode to receiving.     IsReceiving = true;       // Create a token provider with the relevant credentials.     TokenProvider credentials =         TokenProvider.CreateSharedSecretTokenProvider         (AccountDetails.Name, AccountDetails.Key);       // Create a URI for the serivce bus.     Uri serviceBusUri = ServiceBusEnvironment.CreateServiceUri         ("sb", AccountDetails.Namespace, string.Empty);       // Create the MessagingFactory     MessagingFactory factory = MessagingFactory.Create(serviceBusUri, credentials);       // Create a subcription for this instance     NamespaceManager mgr = new NamespaceManager(serviceBusUri, credentials);     string subscriptionName = Guid.NewGuid().ToString();     mgr.CreateSubscription(AccountDetails.ScatterGatherTopic, subscriptionName);       // Create the subscription and queue clients.     ScatterGatherSubscriptionClient = factory.CreateSubscriptionClient         (AccountDetails.ScatterGatherTopic, subscriptionName);     ScatterGatherQueueClient =         factory.CreateQueueClient(AccountDetails.ScatterGatherQueue);       // Start the background worker thread.     BackgroundWorker = new BackgroundWorker();     BackgroundWorker.DoWork += new DoWorkEventHandler(ReceiveMessages);     BackgroundWorker.RunWorkerAsync(); }     I took the inspiration for creating the subscriptions in the voting application from the chat application that uses topics and subscriptions blogged by Ovais Akhter here. The method that receives the question messages runs on a background thread. If the application is in receive mode, a question message will be received from the subscription, the question will be displayed in the user interface, the voting buttons enabled, and IsReceiving set to false to prevent more questing from being received before the current one is answered.   // This runs on a background worker. private void ReceiveMessages(object sender, DoWorkEventArgs e) {     while (true)     {         if (IsReceiving)         {             // Receive a question message from the topic.             BrokeredMessage msg = ScatterGatherSubscriptionClient.Receive();             if (msg != null)             {                 // Deserialize the message.                 Question question = msg.GetBody<Question>();                   // Update the user interface.                 SimpleDelegate setQuestion = delegate()                 {                     lblQuestion.Content = question.QuestionText;                     btnYes.IsEnabled = true;                     btnNo.IsEnabled = true;                 };                 this.Dispatcher.BeginInvoke(DispatcherPriority.Send, setQuestion);                 IsReceiving = false;                   // Mark the message as complete.                 msg.Complete();             }         }         else         {             Thread.Sleep(1000);         }     } }     When the user clicks on the Yes or No button, the btnVote_Click method is called. This will create a new Vote data contract with the appropriate question and answer and send the message to the poll manager application using the votes queue. The user voting buttons are then disabled, the question text cleared, and the IsReceiving flag set to true to allow a new message to be received.   private void btnVote_Click(object sender, RoutedEventArgs e) {     // Create a new vote.     Vote vote = new Vote()     {         QuestionText = (string)lblQuestion.Content,         IsYes = ((sender as Button).Content as string).Equals("Yes")     };       // Send the vote message.     BrokeredMessage msg = new BrokeredMessage(vote);     ScatterGatherQueueClient.Send(msg);       // Update the user interface.     lblQuestion.Content = "";     btnYes.IsEnabled = false;     btnNo.IsEnabled = false;     IsReceiving = true; }     Testing the Application In order to test the application, an instance of the poll manager application is started; the user interface is shown below. As no instances of the voting application have been created there are no subscriptions present in the topic. When an instance of the voting application is created the subscription will be displayed in the poll manager. Now that a voting application is subscribing, a questing can be sent from the poll manager application. When the message is sent to the topic, the voting application will receive the message and display the question. The voter can then answer the question by clicking on the appropriate button. The results of the vote are updated in the poll manager application. When two more instances of the voting application are created, the poll manager will display the new subscriptions. More questions can then be broadcast to the voting applications. As the question messages are queued up in the subscription for each voting application, the users can answer the questions in their own time. The vote messages will be received by the poll manager application and aggregated to display the results. The screenshots of the applications part way through voting are shown below. The messages for each voting application are queued up in sequence on the voting application subscriptions, allowing the questions to be answered at different speeds by the voters.

    Read the article

  • Java implementing Exception Handling

    - by user69514
    I am trying to implement an OutOfStockException for when the user attempts to buy more items than there are available. I'm not sure if my implementation is correct. Does this look OK to you? public class OutOfStockException extends Exception { public OutOfStockException(){ super(); } public OutOfStockException(String s){ super(s); } } This is the class where I need to test it: import javax.swing.JOptionPane; public class SwimItems { static final int MAX = 100; public static void main (String [] args) { Item [] items = new Item[MAX]; int numItems; numItems = fillFreebies(items); numItems += fillTaxable(items,numItems); numItems += fillNonTaxable(items,numItems); sellStuff(items, numItems); } private static int num(String which) { int n = 0; do { try{ n=Integer.parseInt(JOptionPane.showInputDialog("Enter number of "+which+" items to add to stock:")); } catch(NumberFormatException nfe){ System.out.println("Number Format Exception in num method"); } } while (n < 1 || n > MAX/3); return n; } private static int fillFreebies(Item [] list) { int n = num("FREEBIES"); for (int i = 0; i < n; i++) try{ list [i] = new Item(JOptionPane.showInputDialog("What freebie item will you give away?"), Integer.parseInt(JOptionPane.showInputDialog("How many do you have?"))); } catch(NumberFormatException nfe){ System.out.println("Number Format Exception in fillFreebies method"); } catch(ArrayIndexOutOfBoundsException e){ System.out.println("Array Index Out Of Bounds Exception in fillFreebies method"); } return n; } private static int fillTaxable(Item [] list, int number) { int n = num("Taxable Items"); for (int i = number ; i < n + number; i++) try{ list [i] = new TaxableItem(JOptionPane.showInputDialog("What taxable item will you sell?"), Double.parseDouble(JOptionPane.showInputDialog("How much will you charge (not including tax) for each?")), Integer.parseInt(JOptionPane.showInputDialog("How many do you have?"))); } catch(NumberFormatException nfe){ System.out.println("Number Format Exception in fillTaxable method"); } catch(ArrayIndexOutOfBoundsException e){ System.out.println("Array Index Out Of Bounds Exception in fillTaxable method"); } return n; } private static int fillNonTaxable(Item [] list, int number) { int n = num("Non-Taxable Items"); for (int i = number ; i < n + number; i++) try{ list [i] = new SaleItem(JOptionPane.showInputDialog("What non-taxable item will you sell?"), Double.parseDouble(JOptionPane.showInputDialog("How much will you charge for each?")), Integer.parseInt(JOptionPane.showInputDialog("How many do you have?"))); } catch(NumberFormatException nfe){ System.out.println("Number Format Exception in fillNonTaxable method"); } catch(ArrayIndexOutOfBoundsException e){ System.out.println("Array Index Out Of Bounds Exception in fillNonTaxable method"); } return n; } private static String listEm(Item [] all, int n, boolean numInc) { String list = "Items: "; for (int i = 0; i < n; i++) { try{ list += "\n"+ (i+1)+". "+all[i].toString() ; if (all[i] instanceof SaleItem) list += " (taxable) "; if (numInc) list += " (Number in Stock: "+all[i].getNum()+")"; } catch(ArrayIndexOutOfBoundsException e){ System.out.println("Array Index Out Of Bounds Exception in listEm method"); } catch(NullPointerException npe){ System.out.println("Null Pointer Exception in listEm method"); } } return list; } private static void sellStuff (Item [] list, int n) { int choice; do { try{ choice = Integer.parseInt(JOptionPane.showInputDialog("Enter item of choice: "+listEm(list, n, false))); } catch(NumberFormatException nfe){ System.out.println("Number Format Exception in sellStuff method"); } }while (JOptionPane.showConfirmDialog(null, "Another customer?")==JOptionPane.YES_OPTION); JOptionPane.showMessageDialog(null, "Remaining "+listEm(list, n, true)); } }

    Read the article

  • adding nodes to a binary search tree randomly deletes nodes

    - by SDLFunTimes
    Hi, stack. I've got a binary tree of type TYPE (TYPE is a typedef of data*) that can add and remove elements. However for some reason certain values added will overwrite previous elements. Here's my code with examples of it inserting without overwriting elements and it not overwriting elements. the data I'm storing: struct data { int number; char *name; }; typedef struct data data; # ifndef TYPE # define TYPE data* # define TYPE_SIZE sizeof(data*) # endif The tree struct: struct Node { TYPE val; struct Node *left; struct Node *rght; }; struct BSTree { struct Node *root; int cnt; }; The comparator for the data. int compare(TYPE left, TYPE right) { int left_len; int right_len; int shortest_string; /* find longest string */ left_len = strlen(left->name); right_len = strlen(right->name); if(right_len < left_len) { shortest_string = right_len; } else { shortest_string = left_len; } /* compare strings */ if(strncmp(left->name, right->name, shortest_string) > 1) { return 1; } else if(strncmp(left->name, right->name, shortest_string) < 1) { return -1; } else { /* strings are equal */ if(left->number > right->number) { return 1; } else if(left->number < right->number) { return -1; } else { return 0; } } } And the add method struct Node* _addNode(struct Node* cur, TYPE val) { if(cur == NULL) { /* no root has been made */ cur = _createNode(val); return cur; } else { int cmp; cmp = compare(cur->val, val); if(cmp == -1) { /* go left */ if(cur->left == NULL) { printf("adding on left node val %d\n", cur->val->number); cur->left = _createNode(val); } else { return _addNode(cur->left, val); } } else if(cmp >= 0) { /* go right */ if(cur->rght == NULL) { printf("adding on right node val %d\n", cur->val->number); cur->rght = _createNode(val); } else { return _addNode(cur->rght, val); } } return cur; } } void addBSTree(struct BSTree *tree, TYPE val) { tree->root = _addNode(tree->root, val); tree->cnt++; } The function to print the tree: void printTree(struct Node *cur) { if (cur == 0) { printf("\n"); } else { printf("("); printTree(cur->left); printf(" %s, %d ", cur->val->name, cur->val->number); printTree(cur->rght); printf(")\n"); } } Here's an example of some data that will overwrite previous elements: struct BSTree myTree; struct data myData1, myData2, myData3; myData1.number = 5; myData1.name = "rooty"; myData2.number = 1; myData2.name = "lefty"; myData3.number = 10; myData3.name = "righty"; initBSTree(&myTree); addBSTree(&myTree, &myData1); addBSTree(&myTree, &myData2); addBSTree(&myTree, &myData3); printTree(myTree.root); Which will print: (( righty, 10 ) lefty, 1 ) Finally here's some test data that will go in the exact same spot as the previous data, but this time no data is overwritten: struct BSTree myTree; struct data myData1, myData2, myData3; myData1.number = 5; myData1.name = "i"; myData2.number = 5; myData2.name = "h"; myData3.number = 5; myData3.name = "j"; initBSTree(&myTree); addBSTree(&myTree, &myData1); addBSTree(&myTree, &myData2); addBSTree(&myTree, &myData3); printTree(myTree.root); Which prints: (( j, 5 ) i, 5 ( h, 5 ) ) Does anyone know what might be going wrong? Sorry if this post was kind of long.

    Read the article

  • More SharePoint 2010 Expression Builders

    - by Ricardo Peres
    Introduction Following my last post, I decided to publish the whole set of expression builders that I use with SharePoint. For all who don’t know about expression builders, they allow us to employ a declarative approach, so that we don’t have to write code for “gluing” things together, like getting a value from the query string, the page’s underlying SPListItem or the current SPContext and assigning it to a control’s property. These expression builders are for some quite common scenarios, I use them quite often, and I hope you find them useful as well. SPContextExpression This expression builder allows us to specify an expression to be processed on the SPContext.Current property object. For example: 1: <asp:Literal runat="server" Text=“<%$ SPContextExpression:Site.RootWeb.Lists[0].Author.LoginName %>”/> It is identical to having the following code: 1: String authorName = SPContext.Current.Site.RootWeb.Lists[0].Author.LoginName; SPFarmProperty Returns a property stored on the farm level: 1: <asp:Literal runat="server" Text="<%$ SPFarmProperty:SomeProperty %>"/> Identical to: 1: Object someProperty = SPFarm.Local.Properties["SomeProperty"]; SPField Returns the value of a selected page’s list item field: 1: <asp:Literal runat="server" Text="<%$ SPField:Title %>"/> Does the same as: 1: String title = SPContext.Current.ListItem["Title"] as String; SPIsInAudience Checks if the current user belongs to an audience: 1: <asp:CheckBox runat="server" Checked="<%$ SPIsInAudience:SomeAudience %>"/> Equivalent to: 1: AudienceManager audienceManager = new AudienceManager(SPServiceContext.Current); 2: Audience audience = audienceManager.Audiences["SomeAudience"]; 3: Boolean isMember = audience.IsMember(SPContext.Current.Web.User.LoginName); SPIsInGroup Checks if the current user belongs to a group: 1: <asp:CheckBox runat="server" Checked="<%$ SPIsInGroup:SomeGroup %>"/> The equivalent C# code is: 1: SPContext.Current.Web.CurrentUser.Groups.OfType<SPGroup>().Any(x => String.Equals(x.Name, “SomeGroup”, StringComparison.OrdinalIgnoreCase)); SPProperty Returns the value of a user profile property for the current user: 1: <asp:Literal runat="server" Text="<%$ SPProperty:LastName %>"/> Where the same code in C# would be: 1: UserProfileManager upm = new UserProfileManager(SPServiceContext.Current); 2: UserProfile u = upm.GetUserProfile(false); 3: Object property = u["LastName"].Value; SPQueryString Returns a value passed on the query string: 1: <asp:GridView runat="server" PageIndex="<%$ SPQueryString:PageIndex %>" /> Is equivalent to (no SharePoint code this time): 1: Int32 pageIndex = Convert.ChangeType(typeof(Int32), HttpContext.Current.Request.QueryString["PageIndex"]); SPWebProperty Returns the value of a property stored at the site level: 1: <asp:Literal runat="server" Text="<%$ SPWebProperty:__ImagesListId %>"/> You can get the same result as: 1: String imagesListId = SPContext.Current.Web.AllProperties["__ImagesListId"] as String; Code OK, let’s move to the code. First, a common abstract base class, mainly for inheriting the conversion method: 1: public abstract class SPBaseExpressionBuilder : ExpressionBuilder 2: { 3: #region Protected static methods 4: protected static Object Convert(Object value, PropertyInfo propertyInfo) 5: { 6: if (value != null) 7: { 8: if (propertyInfo.PropertyType.IsAssignableFrom(value.GetType()) == false) 9: { 10: if (propertyInfo.PropertyType.IsEnum == true) 11: { 12: value = Enum.Parse(propertyInfo.PropertyType, value.ToString(), true); 13: } 14: else if (propertyInfo.PropertyType == typeof(String)) 15: { 16: value = value.ToString(); 17: } 18: else if ((typeof(IConvertible).IsAssignableFrom(propertyInfo.PropertyType) == true) && (typeof(IConvertible).IsAssignableFrom(value.GetType()) == true)) 19: { 20: value = System.Convert.ChangeType(value, propertyInfo.PropertyType); 21: } 22: } 23: } 24:  25: return (value); 26: } 27: #endregion 28:  29: #region Public override methods 30: public override CodeExpression GetCodeExpression(BoundPropertyEntry entry, Object parsedData, ExpressionBuilderContext context) 31: { 32: if (String.IsNullOrEmpty(entry.Expression) == true) 33: { 34: return (new CodePrimitiveExpression(String.Empty)); 35: } 36: else 37: { 38: return (new CodeMethodInvokeExpression(new CodeMethodReferenceExpression(new CodeTypeReferenceExpression(this.GetType()), "GetValue"), new CodePrimitiveExpression(entry.Expression.Trim()), new CodePropertyReferenceExpression(new CodeArgumentReferenceExpression("entry"), "PropertyInfo"))); 39: } 40: } 41: #endregion 42:  43: #region Public override properties 44: public override Boolean SupportsEvaluate 45: { 46: get 47: { 48: return (true); 49: } 50: } 51: #endregion 52: } Next, the code for each expression builder: 1: [ExpressionPrefix("SPContext")] 2: public class SPContextExpressionBuilder : SPBaseExpressionBuilder 3: { 4: #region Public static methods 5: public static Object GetValue(String expression, PropertyInfo propertyInfo) 6: { 7: SPContext context = SPContext.Current; 8: Object expressionValue = DataBinder.Eval(context, expression.Trim().Replace('\'', '"')); 9:  10: expressionValue = Convert(expressionValue, propertyInfo); 11:  12: return (expressionValue); 13: } 14:  15: #endregion 16:  17: #region Public override methods 18: public override Object EvaluateExpression(Object target, BoundPropertyEntry entry, Object parsedData, ExpressionBuilderContext context) 19: { 20: return (GetValue(entry.Expression, entry.PropertyInfo)); 21: } 22: #endregion 23: }   1: [ExpressionPrefix("SPFarmProperty")] 2: public class SPFarmPropertyExpressionBuilder : SPBaseExpressionBuilder 3: { 4: #region Public static methods 5: public static Object GetValue(String propertyName, PropertyInfo propertyInfo) 6: { 7: Object propertyValue = SPFarm.Local.Properties[propertyName]; 8:  9: propertyValue = Convert(propertyValue, propertyInfo); 10:  11: return (propertyValue); 12: } 13:  14: #endregion 15:  16: #region Public override methods 17: public override Object EvaluateExpression(Object target, BoundPropertyEntry entry, Object parsedData, ExpressionBuilderContext context) 18: { 19: return (GetValue(entry.Expression, entry.PropertyInfo)); 20: } 21: #endregion 22: }   1: [ExpressionPrefix("SPField")] 2: public class SPFieldExpressionBuilder : SPBaseExpressionBuilder 3: { 4: #region Public static methods 5: public static Object GetValue(String fieldName, PropertyInfo propertyInfo) 6: { 7: Object fieldValue = SPContext.Current.ListItem[fieldName]; 8:  9: fieldValue = Convert(fieldValue, propertyInfo); 10:  11: return (fieldValue); 12: } 13:  14: #endregion 15:  16: #region Public override methods 17: public override Object EvaluateExpression(Object target, BoundPropertyEntry entry, Object parsedData, ExpressionBuilderContext context) 18: { 19: return (GetValue(entry.Expression, entry.PropertyInfo)); 20: } 21: #endregion 22: }   1: [ExpressionPrefix("SPIsInAudience")] 2: public class SPIsInAudienceExpressionBuilder : SPBaseExpressionBuilder 3: { 4: #region Public static methods 5: public static Object GetValue(String audienceName, PropertyInfo info) 6: { 7: Debugger.Break(); 8: audienceName = audienceName.Trim(); 9:  10: if ((audienceName.StartsWith("'") == true) && (audienceName.EndsWith("'") == true)) 11: { 12: audienceName = audienceName.Substring(1, audienceName.Length - 2); 13: } 14:  15: AudienceManager manager = new AudienceManager(); 16: Object value = manager.IsMemberOfAudience(SPControl.GetContextWeb(HttpContext.Current).CurrentUser.LoginName, audienceName); 17:  18: if (info.PropertyType == typeof(String)) 19: { 20: value = value.ToString(); 21: } 22:  23: return(value); 24: } 25:  26: #endregion 27:  28: #region Public override methods 29: public override Object EvaluateExpression(Object target, BoundPropertyEntry entry, Object parsedData, ExpressionBuilderContext context) 30: { 31: return (GetValue(entry.Expression, entry.PropertyInfo)); 32: } 33: #endregion 34: }   1: [ExpressionPrefix("SPIsInGroup")] 2: public class SPIsInGroupExpressionBuilder : SPBaseExpressionBuilder 3: { 4: #region Public static methods 5: public static Object GetValue(String groupName, PropertyInfo info) 6: { 7: groupName = groupName.Trim(); 8:  9: if ((groupName.StartsWith("'") == true) && (groupName.EndsWith("'") == true)) 10: { 11: groupName = groupName.Substring(1, groupName.Length - 2); 12: } 13:  14: Object value = SPControl.GetContextWeb(HttpContext.Current).CurrentUser.Groups.OfType<SPGroup>().Any(x => String.Equals(x.Name, groupName, StringComparison.OrdinalIgnoreCase)); 15:  16: if (info.PropertyType == typeof(String)) 17: { 18: value = value.ToString(); 19: } 20:  21: return(value); 22: } 23:  24: #endregion 25:  26: #region Public override methods 27: public override Object EvaluateExpression(Object target, BoundPropertyEntry entry, Object parsedData, ExpressionBuilderContext context) 28: { 29: return (GetValue(entry.Expression, entry.PropertyInfo)); 30: } 31: #endregion 32: }   1: [ExpressionPrefix("SPProperty")] 2: public class SPPropertyExpressionBuilder : SPBaseExpressionBuilder 3: { 4: #region Public static methods 5: public static Object GetValue(String propertyName, System.Reflection.PropertyInfo propertyInfo) 6: { 7: SPServiceContext serviceContext = SPServiceContext.GetContext(HttpContext.Current); 8: UserProfileManager upm = new UserProfileManager(serviceContext); 9: UserProfile up = upm.GetUserProfile(false); 10: Object propertyValue = (up[propertyName] != null) ? up[propertyName].Value : null; 11:  12: propertyValue = Convert(propertyValue, propertyInfo); 13:  14: return (propertyValue); 15: } 16:  17: #endregion 18:  19: #region Public override methods 20: public override Object EvaluateExpression(Object target, BoundPropertyEntry entry, Object parsedData, ExpressionBuilderContext context) 21: { 22: return (GetValue(entry.Expression, entry.PropertyInfo)); 23: } 24: #endregion 25: }   1: [ExpressionPrefix("SPQueryString")] 2: public class SPQueryStringExpressionBuilder : SPBaseExpressionBuilder 3: { 4: #region Public static methods 5: public static Object GetValue(String parameterName, PropertyInfo propertyInfo) 6: { 7: Object parameterValue = HttpContext.Current.Request.QueryString[parameterName]; 8:  9: parameterValue = Convert(parameterValue, propertyInfo); 10:  11: return (parameterValue); 12: } 13:  14: #endregion 15:  16: #region Public override methods 17: public override Object EvaluateExpression(Object target, BoundPropertyEntry entry, Object parsedData, ExpressionBuilderContext context) 18: { 19: return (GetValue(entry.Expression, entry.PropertyInfo)); 20: } 21: #endregion 22: }   1: [ExpressionPrefix("SPWebProperty")] 2: public class SPWebPropertyExpressionBuilder : SPBaseExpressionBuilder 3: { 4: #region Public static methods 5: public static Object GetValue(String propertyName, PropertyInfo propertyInfo) 6: { 7: Object propertyValue = SPContext.Current.Web.AllProperties[propertyName]; 8:  9: propertyValue = Convert(propertyValue, propertyInfo); 10:  11: return (propertyValue); 12: } 13:  14: #endregion 15:  16: #region Public override methods 17: public override Object EvaluateExpression(Object target, BoundPropertyEntry entry, Object parsedData, ExpressionBuilderContext context) 18: { 19: return (GetValue(entry.Expression, entry.PropertyInfo)); 20: } 21: #endregion 22: } Registration You probably know how to register them, but here it goes again: add this following snippet to your Web.config file, inside the configuration/system.web/compilation/expressionBuilders section: 1: <add expressionPrefix="SPContext" type="MyNamespace.SPContextExpressionBuilder, MyAssembly, Culture=neutral, Version=1.0.0.0, PublicKeyToken=xxx" /> 2: <add expressionPrefix="SPFarmProperty" type="MyNamespace.SPFarmPropertyExpressionBuilder, MyAssembly, Culture=neutral, Version=1.0.0.0, PublicKeyToken=xxx" /> 3: <add expressionPrefix="SPField" type="MyNamespace.SPFieldExpressionBuilder, MyAssembly, Culture=neutral, Version=1.0.0.0, PublicKeyToken=xxx" /> 4: <add expressionPrefix="SPIsInAudience" type="MyNamespace.SPIsInAudienceExpressionBuilder, MyAssembly, Culture=neutral, Version=1.0.0.0, PublicKeyToken=xxx" /> 5: <add expressionPrefix="SPIsInGroup" type="MyNamespace.SPIsInGroupExpressionBuilder, MyAssembly, Culture=neutral, Version=1.0.0.0, PublicKeyToken=xxx" /> 6: <add expressionPrefix="SPProperty" type="MyNamespace.SPPropertyExpressionBuilder, MyAssembly, Culture=neutral, Version=1.0.0.0, PublicKeyToken=xxx" /> 7: <add expressionPrefix="SPQueryString" type="MyNamespace.SPQueryStringExpressionBuilder, MyAssembly, Culture=neutral, Version=1.0.0.0, PublicKeyToken=xxx" /> 8: <add expressionPrefix="SPWebProperty" type="MyNamespace.SPWebPropertyExpressionBuilder, MyAssembly, Culture=neutral, Version=1.0.0.0, PublicKeyToken=xxx" /> I’ll leave it up to you to figure out the best way to deploy this to your server!

    Read the article

  • CheckBox ListView SelectedValues DependencyProperty Binding

    - by Ristogod
    I am writing a custom control that is a ListView that has a CheckBox on each item in the ListView to indicate that item is Selected. I was able to do so with the following XAML. <ListView x:Class="CheckedListViewSample.CheckBoxListView" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" xmlns:mc="http://schemas.openxmlformats.org/markup-compatibility/2006" xmlns:d="http://schemas.microsoft.com/expression/blend/2008" mc:Ignorable="d"> <ListView.Style> <Style TargetType="{x:Type ListView}"> <Setter Property="SelectionMode" Value="Multiple" /> <Style.Resources> <Style TargetType="ListViewItem"> <Setter Property="Template"> <Setter.Value> <ControlTemplate TargetType="ListViewItem"> <Border BorderThickness="{TemplateBinding Border.BorderThickness}" Padding="{TemplateBinding Control.Padding}" BorderBrush="{TemplateBinding Border.BorderBrush}" Background="{TemplateBinding Panel.Background}" SnapsToDevicePixels="True"> <CheckBox IsChecked="{Binding IsSelected, RelativeSource={RelativeSource FindAncestor, AncestorType={x:Type ListViewItem}}}"> <CheckBox.Content> <ContentPresenter Content="{TemplateBinding ContentControl.Content}" ContentTemplate="{TemplateBinding ContentControl.ContentTemplate}" HorizontalAlignment="{TemplateBinding Control.HorizontalContentAlignment}" VerticalAlignment="{TemplateBinding Control.VerticalContentAlignment}" SnapsToDevicePixels="{TemplateBinding UIElement.SnapsToDevicePixels}" /> </CheckBox.Content> </CheckBox> </Border> </ControlTemplate> </Setter.Value> </Setter> </Style> </Style.Resources> </Style> </ListView.Style> </ListView> I however am trying to attempt one more feature. The ListView has a SelectedItems DependencyProperty that returns a collection of the Items that are checked. However, I need to implement a SelectedValues DependencyProperty. I also am implementing a SelectedValuesPath DependencyProperty. By using the SelectedValuesPath, I indicate the path where the values are found for each selected item. So if my items have an ID property, I can specify using the SelectedValuesPath property "ID". The SelectedValues property would then return a collection of ID values. I have this working also using this code in the code-behind: using System.Windows; using System.Windows.Controls; using System.ComponentModel; using System.Collections; using System.Collections.Generic; namespace CheckedListViewSample { /// <summary> /// Interaction logic for CheckBoxListView.xaml /// </summary> public partial class CheckBoxListView : ListView { public static DependencyProperty SelectedValuesPathProperty = DependencyProperty.Register("SelectedValuesPath", typeof(string), typeof(CheckBoxListView), new PropertyMetadata(string.Empty, null)); public static DependencyProperty SelectedValuesProperty = DependencyProperty.Register("SelectedValues", typeof(IList), typeof(CheckBoxListView), new PropertyMetadata(new List<object>(), null)); [Category("Appearance")] [Localizability(LocalizationCategory.NeverLocalize)] [Bindable(true)] public string SelectedValuesPath { get { return ((string)(base.GetValue(CheckBoxListView.SelectedValuesPathProperty))); } set { base.SetValue(CheckBoxListView.SelectedValuesPathProperty, value); } } [Bindable(true)] [DesignerSerializationVisibility(DesignerSerializationVisibility.Hidden)] [Category("Appearance")] public IList SelectedValues { get { return ((IList)(base.GetValue(CheckBoxListView.SelectedValuesPathProperty))); } set { base.SetValue(CheckBoxListView.SelectedValuesPathProperty, value); } } public CheckBoxListView() : base() { InitializeComponent(); base.SelectionChanged += new SelectionChangedEventHandler(CheckBoxListView_SelectionChanged); } private void CheckBoxListView_SelectionChanged(object sender, SelectionChangedEventArgs e) { List<object> values = new List<object>(); foreach (var item in SelectedItems) { if (string.IsNullOrWhiteSpace(SelectedValuesPath)) { values.Add(item); } else { try { values.Add(item.GetType().GetProperty(SelectedValuesPath).GetValue(item, null)); } catch { } } } base.SetValue(CheckBoxListView.SelectedValuesProperty, values); e.Handled = true; } } } My problem is that my binding only works one way right now. I'm having trouble trying to figure out how to implement my SelectedValues DependencyProperty so that I could Bind a Collection of values to it, and when the control is loaded, the CheckBoxes are checked with items that have values that correspond to the SelectedValues. I've considered using the PropertyChangedCallBack event, but can't quite figure out how I could write that to achieve my goal. I'm also unsure of how I find the correct ListViewItem to set it as Selected. And lastly, if I can find the ListViewItem and set it to be Selected, won't that fire my SelectionChanged event each time I set a ListViewItem to be Selected?

    Read the article

  • How do I create an instance of this class in Android?

    - by Lloyd Banks
    I was wondering if it is possible to create an instance of this class (from the link, which creates a listview) from another class so that I can call on either lazyadapter.java or customizedlistview.java (not sure which one) to inflate that same listview. Is this possible? This is what I tried (obviously incorrect): CustomizedListView clv = new CustomizedListView(); clv.onCreate(...); source: http://www.androidhive.info/2012/02/android-custom-listview-with-image-and-text/ LazyAdapter.java import java.util.ArrayList; import java.util.HashMap; import android.app.Activity; import android.content.Context; import android.view.LayoutInflater; import android.view.View; import android.view.ViewGroup; import android.widget.BaseAdapter; import android.widget.ImageView; import android.widget.TextView; public class LazyAdapter extends BaseAdapter { private Activity activity; private ArrayList&lt;HashMap&lt;String, String&gt;&gt; data; private static LayoutInflater inflater=null; public ImageLoader imageLoader; public LazyAdapter(Activity a, ArrayList&lt;HashMap&lt;String, String&gt;&gt; d) { activity = a; data=d; inflater = (LayoutInflater)activity.getSystemService(Context.LAYOUT_INFLATER_SERVICE); imageLoader=new ImageLoader(activity.getApplicationContext()); } public int getCount() { return data.size(); } public Object getItem(int position) { return position; } public long getItemId(int position) { return position; } public View getView(int position, View convertView, ViewGroup parent) { View vi=convertView; if(convertView==null) vi = inflater.inflate(R.layout.list_row, null); TextView title = (TextView)vi.findViewById(R.id.title); // title TextView artist = (TextView)vi.findViewById(R.id.artist); // artist name TextView duration = (TextView)vi.findViewById(R.id.duration); // duration ImageView thumb_image=(ImageView)vi.findViewById(R.id.list_image); // thumb image HashMap&lt;String, String&gt; song = new HashMap&lt;String, String&gt;(); song = data.get(position); // Setting all values in listview title.setText(song.get(CustomizedListView.KEY_TITLE)); artist.setText(song.get(CustomizedListView.KEY_ARTIST)); duration.setText(song.get(CustomizedListView.KEY_DURATION)); imageLoader.DisplayImage(song.get(CustomizedListView.KEY_THUMB_URL), thumb_image); return vi; } } CustomizedListView.java import java.util.ArrayList; import java.util.HashMap; import org.w3c.dom.Document; import org.w3c.dom.Element; import org.w3c.dom.NodeList; import android.app.Activity; import android.os.Bundle; import android.view.View; import android.widget.AdapterView; import android.widget.AdapterView.OnItemClickListener; import android.widget.ListView; public class CustomizedListView extends Activity { // All static variables static final String URL = "http://api.androidhive.info/music/music.xml"; // XML node keys static final String KEY_SONG = "song"; // parent node static final String KEY_ID = "id"; static final String KEY_TITLE = "title"; static final String KEY_ARTIST = "artist"; static final String KEY_DURATION = "duration"; static final String KEY_THUMB_URL = "thumb_url"; ListView list; LazyAdapter adapter; @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); ArrayList&lt;HashMap&lt;String, String&gt;&gt; songsList = new ArrayList&lt;HashMap&lt;String, String&gt;&gt;(); XMLParser parser = new XMLParser(); String xml = parser.getXmlFromUrl(URL); // getting XML from URL Document doc = parser.getDomElement(xml); // getting DOM element NodeList nl = doc.getElementsByTagName(KEY_SONG); // looping through all song nodes &lt;song&gt; for (int i = 0; i &lt; nl.getLength(); i++) { // creating new HashMap HashMap&lt;String, String&gt; map = new HashMap&lt;String, String&gt;(); Element e = (Element) nl.item(i); // adding each child node to HashMap key =&gt; value map.put(KEY_ID, parser.getValue(e, KEY_ID)); map.put(KEY_TITLE, parser.getValue(e, KEY_TITLE)); map.put(KEY_ARTIST, parser.getValue(e, KEY_ARTIST)); map.put(KEY_DURATION, parser.getValue(e, KEY_DURATION)); map.put(KEY_THUMB_URL, parser.getValue(e, KEY_THUMB_URL)); // adding HashList to ArrayList songsList.add(map); } list=(ListView)findViewById(R.id.list); // Getting adapter by passing xml data ArrayList adapter=new LazyAdapter(this, songsList); list.setAdapter(adapter); // Click event for single list row list.setOnItemClickListener(new OnItemClickListener() { @Override public void onItemClick(AdapterView&lt;?&gt; parent, View view, int position, long id) { } }); } }

    Read the article

  • regular expression to read the string between <title> and </title>

    - by user262325
    Hello every one I hope to read the contents between and in a html string. I think it should be in objective-c @"<title([\\s\\S]*)</title>" below are the codes that rewrited for regular expression //source of NSStringCategory.h #import <Foundation/Foundation.h> #import <regex.h> @interface NSStringCategory:NSObject { regex_t preg; } -(id)initWithPattern:(NSString *)pattern options:(int)options; -(void)dealloc; -(BOOL)matchesString:(NSString *)string; -(NSString *)matchedSubstringOfString:(NSString *)string; -(NSArray *)capturedSubstringsOfString:(NSString *)string; +(NSStringCategory *)regexWithPattern:(NSString *)pattern options:(int)options; +(NSStringCategory *)regexWithPattern:(NSString *)pattern; +(NSString *)null; +(void)initialize; @end @interface NSString (NSStringCategory) -(BOOL)matchedByPattern:(NSString *)pattern options:(int)options; -(BOOL)matchedByPattern:(NSString *)pattern; -(NSString *)substringMatchedByPattern:(NSString *)pattern options:(int)options; -(NSString *)substringMatchedByPattern:(NSString *)pattern; -(NSArray *)substringsCapturedByPattern:(NSString *)pattern options:(int)options; -(NSArray *)substringsCapturedByPattern:(NSString *)pattern; -(NSString *)escapedPattern; @end and .m file #import "NSStringCategory.h" static NSString *nullstring=nil; @implementation NSStringCategory -(id)initWithPattern:(NSString *)pattern options:(int)options { if(self=[super init]) { int err=regcomp(&preg,[pattern UTF8String],options|REG_EXTENDED); if(err) { char errbuf[256]; regerror(err,&preg,errbuf,sizeof(errbuf)); [NSException raise:@"CSRegexException" format:@"Could not compile regex \"%@\": %s",pattern,errbuf]; } } return self; } -(void)dealloc { regfree(&preg); [super dealloc]; } -(BOOL)matchesString:(NSString *)string { if(regexec(&preg,[string UTF8String],0,NULL,0)==0) return YES; return NO; } -(NSString *)matchedSubstringOfString:(NSString *)string { const char *cstr=[string UTF8String]; regmatch_t match; if(regexec(&preg,cstr,1,&match,0)==0) { return [[[NSString alloc] initWithBytes:cstr+match.rm_so length:match.rm_eo-match.rm_so encoding:NSUTF8StringEncoding] autorelease]; } return nil; } -(NSArray *)capturedSubstringsOfString:(NSString *)string { const char *cstr=[string UTF8String]; int num=preg.re_nsub+1; regmatch_t *matches=calloc(sizeof(regmatch_t),num); if(regexec(&preg,cstr,num,matches,0)==0) { NSMutableArray *array=[NSMutableArray arrayWithCapacity:num]; int i; for(i=0;i<num;i++) { NSString *str; if(matches[i].rm_so==-1&&matches[i].rm_eo==-1) str=nullstring; else str=[[[NSString alloc] initWithBytes:cstr+matches[i].rm_so length:matches[i].rm_eo-matches[i].rm_so encoding:NSUTF8StringEncoding] autorelease]; [array addObject:str]; } free(matches); return [NSArray arrayWithArray:array]; } free(matches); return nil; } +(NSStringCategory *)regexWithPattern:(NSString *)pattern options:(int)options { return [[[NSStringCategory alloc] initWithPattern:pattern options:options] autorelease]; } +(NSStringCategory *)regexWithPattern:(NSString *)pattern { return [[[NSStringCategory alloc] initWithPattern:pattern options:0] autorelease]; } +(NSString *)null { return nullstring; } +(void)initialize { if(!nullstring) nullstring=[[NSString alloc] initWithString:@""]; } @end @implementation NSString (NSStringCategory) -(BOOL)matchedByPattern:(NSString *)pattern options:(int)options { NSStringCategory *re=[NSStringCategory regexWithPattern:pattern options:options|REG_NOSUB]; return [re matchesString:self]; } -(BOOL)matchedByPattern:(NSString *)pattern { return [self matchedByPattern:pattern options:0]; } -(NSString *)substringMatchedByPattern:(NSString *)pattern options:(int)options { NSStringCategory *re=[NSStringCategory regexWithPattern:pattern options:options]; return [re matchedSubstringOfString:self]; } -(NSString *)substringMatchedByPattern:(NSString *)pattern { return [self substringMatchedByPattern:pattern options:0]; } -(NSArray *)substringsCapturedByPattern:(NSString *)pattern options:(int)options { NSStringCategory *re=[NSStringCategory regexWithPattern:pattern options:options]; return [re capturedSubstringsOfString:self]; } -(NSArray *)substringsCapturedByPattern:(NSString *)pattern { return [self substringsCapturedByPattern:pattern options:0]; } -(NSString *)escapedPattern { int len=[self length]; NSMutableString *escaped=[NSMutableString stringWithCapacity:len]; for(int i=0;i<len;i++) { unichar c=[self characterAtIndex:i]; if(c=='^'||c=='.'||c=='['||c=='$'||c=='('||c==')' ||c=='|'||c=='*'||c=='+'||c=='?'||c=='{'||c=='\\') [escaped appendFormat:@"\\%C",c]; else [escaped appendFormat:@"%C",c]; } return [NSString stringWithString:escaped]; } @end I use the codes below to get the string between "" and "" NSStringCategory *a=[[NSStringCategory alloc] initWithPattern:@"<title([\s\S]*)</title>" options:0];// Unfortunately [a matchedSubstringOfString:response]] always returns nil I do not if the regular expression is wrong or any other reason. Welcome any comment Thanks interdev

    Read the article

  • problem in loading images from web

    - by Lynnooi
    hi, I am new in android and had developed an app which get images from the website and display it. I got it working in emulator but not in real phones. In some device, it will crash or take very long loading period. Can anyone please help me or guide me in improving it as i'm not sure whether the way i loads the images is correct or not. Here are the code i use to get the images from the web and display accordingly. if (xmlURL.length() != 0) { try { URL url = new URL(xmlURL); SAXParserFactory spf = SAXParserFactory.newInstance(); SAXParser sp = spf.newSAXParser(); /* Get the XMLReader of the SAXParser we created. */ XMLReader xr = sp.getXMLReader(); /* * Create a new ContentHandler and apply it to the * XML-Reader */ xr.setContentHandler(myExampleHandler); /* Parse the xml-data from our URL. */ xr.parse(new InputSource(url.openStream())); /* Parsing has finished. */ /* * Our ExampleHandler now provides the parsed data to * us. */ ParsedExampleDataSet parsedExampleDataSet = myExampleHandler.getParsedData(); } catch (Exception e) { } } if (s.equalsIgnoreCase("wallpapers")) { Context context = helloAndroid.this.getBaseContext(); for (int j = 0; j <= myExampleHandler.filenames.size() - 1; j++) { if (myExampleHandler.filenames.elementAt(j).toString() != null) { helloAndroid.this.ed = myExampleHandler.thumbs.elementAt(j) .toString(); if (helloAndroid.this.ed.length() != 0) { Drawable image = ImageOperations(context, helloAndroid.this.ed, "image.jpg"); file_info = myExampleHandler.filenames .elementAt(j).toString(); author = "\nby " + myExampleHandler.authors.elementAt(j) .toString(); switch (j + 1) { case 1: ImageView imgView1 = new ImageView(context); imgView1 = (ImageView) findViewById(R.id.image1); if (image.getIntrinsicHeight() > 0) { imgView1.setImageDrawable(image); } else imgView1 .setImageResource(R.drawable.empty_wallpaper); tv = (TextView) findViewById(R.id.filename1); tv.setText(file_info); tv = (TextView) findViewById(R.id.author1); tv.setText(author); imgView1 .setOnClickListener(new View.OnClickListener() { public void onClick(View view) { // Perform action on click Intent myIntent1 = new Intent( helloAndroid.this, galleryFile.class); Bundle b = new Bundle(); b.putString("fileID",myExampleHandler.fileid.elementAt(0).toString()); b.putString("page", "1"); b.putString("family", s); b.putString("fi",myExampleHandler.folder_id.elementAt(folder).toString()); b.putString("kw", keyword); myIntent1.putExtras(b); startActivityForResult( myIntent1, 0); } }); break; case 2: ImageView imgView2 = new ImageView(context); imgView2 = (ImageView) findViewById(R.id.image2); imgView2.setImageDrawable(image); tv = (TextView) findViewById(R.id.filename2); tv.setText(file_info); tv = (TextView) findViewById(R.id.author2); tv.setText(author); imgView2 .setOnClickListener(new View.OnClickListener() { public void onClick(View view) { // Perform action on click Intent myIntent1 = new Intent( helloAndroid.this, galleryFile.class); Bundle b = new Bundle(); b.putString("fileID",myExampleHandler.fileid.elementAt(1).toString()); b.putString("page", "1"); b.putString("family", s); b.putString("fi",myExampleHandler.folder_id.elementAt(folder).toString()); b.putString("kw", keyword); myIntent1.putExtras(b); startActivityForResult( myIntent1, 0); } }); break; case 3: //same code break; } } } } } private Drawable ImageOperations(Context ctx, String url, String saveFilename) { try { InputStream is = (InputStream) this.fetch(url); Drawable d = Drawable.createFromStream(is, "src"); return d; } catch (MalformedURLException e) { e.printStackTrace(); return null; } catch (IOException e) { e.printStackTrace(); return null; } } public Object fetch(String address) throws MalformedURLException, IOException { URL url = new URL(address); Object content = url.getContent(); return content; }

    Read the article

  • java: how to compress data into a String and uncompress data from the String

    - by Guillaume
    I want to put some compressed data into a remote repository. To put data on this repository I can only use a method that take the name of the resource and its content as a String. (like data.txt + "hello world"). The repository is moking a filesystem but is not, so I can not use File directly. I want to be able to do the following: client send to server a file 'data.txt' server compress 'data.txt' into data.zip server send to repository content of data.zip repository store data.zip client download from repository data.zip and his able to open it with its favorite zip tool I have tried a lots of compressing example found on the web but each time a send the data to the repository, my resulting zip file is corrupted. Here is a sample class, using the zip*stream and that emulate the repository showcasing my problem. The created zip file is working, but after its 'serialization' it's get corrupted. (the sample class use jakarta commons.io ) Many thanks for your help. package zip; import java.io.File; import java.io.FileInputStream; import java.io.FileOutputStream; import java.io.IOException; import java.io.InputStream; import java.util.zip.ZipEntry; import java.util.zip.ZipInputStream; import java.util.zip.ZipOutputStream; import org.apache.commons.io.FileUtils; /** * Date: May 19, 2010 - 6:13:07 PM * * @author Guillaume AME. */ public class ZipMe { public static void addOrUpdate(File zipFile, File ... files) throws IOException { File tempFile = File.createTempFile(zipFile.getName(), null); // delete it, otherwise you cannot rename your existing zip to it. tempFile.delete(); boolean renameOk = zipFile.renameTo(tempFile); if (!renameOk) { throw new RuntimeException("could not rename the file " + zipFile.getAbsolutePath() + " to " + tempFile.getAbsolutePath()); } byte[] buf = new byte[1024]; ZipInputStream zin = new ZipInputStream(new FileInputStream(tempFile)); ZipOutputStream out = new ZipOutputStream(new FileOutputStream(zipFile)); ZipEntry entry = zin.getNextEntry(); while (entry != null) { String name = entry.getName(); boolean notInFiles = true; for (File f : files) { if (f.getName().equals(name)) { notInFiles = false; break; } } if (notInFiles) { // Add ZIP entry to output stream. out.putNextEntry(new ZipEntry(name)); // Transfer bytes from the ZIP file to the output file int len; while ((len = zin.read(buf)) > 0) { out.write(buf, 0, len); } } entry = zin.getNextEntry(); } // Close the streams zin.close(); // Compress the files if (files != null) { for (File file : files) { InputStream in = new FileInputStream(file); // Add ZIP entry to output stream. out.putNextEntry(new ZipEntry(file.getName())); // Transfer bytes from the file to the ZIP file int len; while ((len = in.read(buf)) > 0) { out.write(buf, 0, len); } // Complete the entry out.closeEntry(); in.close(); } // Complete the ZIP file } tempFile.delete(); out.close(); } public static void main(String[] args) throws IOException { final String zipArchivePath = "c:/temp/archive.zip"; final String tempFilePath = "c:/temp/data.txt"; final String resultZipFile = "c:/temp/resultingArchive.zip"; File zipArchive = new File(zipArchivePath); FileUtils.touch(zipArchive); File tempFile = new File(tempFilePath); FileUtils.writeStringToFile(tempFile, "hello world"); addOrUpdate(zipArchive, tempFile); //archive.zip exists and contains a compressed data.txt that can be read using winrar //now simulate writing of the zip into a in memory cache String archiveText = FileUtils.readFileToString(zipArchive); FileUtils.writeStringToFile(new File(resultZipFile), archiveText); //resultingArchive.zip exists, contains a compressed data.txt, but it can not //be read using winrar: CRC failed in data.txt. The file is corrupt } }

    Read the article

  • JPA behaviour...

    - by Marcel
    Hi I have some trouble understanding a JPA behaviour. Mabye someone could give me a hint. Situation: Product entity: @Entity public class Product implements Serializable { ... @OneToMany(mappedBy="product", fetch=FetchType.EAGER) private List<ProductResource> productResources = new ArrayList<ProductResource>(); .... public List<ProductResource> getProductResources() { return productResources; } public boolean equals(Object obj) { if (obj == this) return true; if (obj == null) return false; if (!(obj instanceof Product)) return false; Product p = (Product) obj; return p.productId == productId; } } Resource entity: @Entity public class Resource implements Serializable { ... @OneToMany(mappedBy="resource", fetch=FetchType.EAGER) private List<ProductResource> productResources = new ArrayList<ProductResource>(); ... public void setProductResource(List<ProductResource> productResource) { this.productResources = productResource; } public List<ProductResource> getProductResources() { return productResources; } public boolean equals(Object obj) { if (obj == this) return true; if (obj == null) return false; if (!(obj instanceof Resource)) return false; Resource r = (Resource) obj; return (long)resourceId==(long)r.resourceId; } } ProductResource Entity: This is a JoinTable (association class) with additional properties (amount). It maps Product and Resources. @Entity public class ProductResource implements Serializable { ... @JoinColumn(nullable=false, updatable=false) @ManyToOne(fetch=FetchType.EAGER, cascade=CascadeType.PERSIST) private Product product; @JoinColumn(nullable=false, updatable=false) @ManyToOne(fetch=FetchType.EAGER, cascade=CascadeType.PERSIST) private Resource resource; private int amount; public void setProduct(Product product) { this.product = product; if(!product.getProductResources().contains((this))){ product.getProductResources().add(this); } } public Product getProduct() { return product; } public void setResource(Resource resource) { this.resource = resource; if(!resource.getProductResources().contains((this))){ resource.getProductResources().add(this); } } public Resource getResource() { return resource; } ... public boolean equals(Object obj) { if (obj == this) return true; if (obj == null) return false; if (!(obj instanceof ProductResource)) return false; ProductResource pr = (ProductResource) obj; return (long)pr.productResourceId == (long)productResourceId; } } This is the Session Bean (running on glassfish). @Stateless(mappedName="PersistenceManager") public class PersistenceManagerBean implements PersistenceManager { @PersistenceContext(unitName = "local_mysql") private EntityManager em; public Object create(Object entity) { em.persist(entity); return entity; } public void delete(Object entity) { em.remove(em.merge(entity)); } public Object retrieve(Class entityClass, Long id) { Object entity = em.find(entityClass, id); return entity; } public void update(Object entity) { em.merge(entity); } } I call the session Bean from a java client: public class Start { public static void main(String[] args) throws NamingException { PersistenceManager pm = (PersistenceManager) new InitialContext().lookup("java:global/BackITServer/PersistenceManagerBean"); ProductResource pr = new ProductResource(); Product p = new Product(); Resource r = new Resource(); pr.setProduct(p); pr.setResource(r); ProductResource pr_stored = (ProductResource) pm.create(pr); pm.delete(pr_stored); Product p_ret = (Product) pm.retrieve(Product.class, pr_stored.getProduct().getProductId()); // prints out true ???????????????????????????????????? System.out.println(p_ret.getProductResources().contains(pr_stored)); } } So here comes my problem. Why is the ProductResource entity still in the List productResources(see code above). The productResource tuple in the db is gone after the deletion and I do newly retrieve the Product entity. If I understood right every method call of the client happens in a new persistence context, but here i obviously get back the non-refreshed product object!? Any help is appreciated Thanks Marcel

    Read the article

  • Two-way databinding of a custom templated asp.net control

    - by Jason
    I hate long code snippets and I'm sorry about this one, but it turns out that this asp.net stuff can't get much shorter and it's so specific that I haven't been able to generalize it without a full code listing. I just want simple two-way, declarative, edit-only databinding to a single instance of an object. Not a list of objects of a type with a bunch of NotImplementedExceptions for Add, Delete, and Select, but just a single view-state persisted object. This is certainly something that can be done but I've struggled with an implementation for years. This newest, closest implementation was inspired by this article from 4-Guys-From-Rolla. Unfortunately, after implementing, I'm getting the following error and I don't know what I'm missing: System.InvalidOperationException: Databinding methods such as Eval(), XPath(), and Bind() can only be used in the context of a databound control. If I don't use Bind(), and only use Eval() functionality, it works. In that way, the error is especially confusing. Update: Actually, using Eval() does NOT work, but using <%# Container.SampleString %> works. However, Eval("SampleString") gives the same error. That leads me back to this article I found earlier but had discarded. Now I believe it might be related, though I haven't cracked it yet ... Here's the simplified codeset that still produces the error: using System.ComponentModel; namespace System.Web.UI.WebControls.Special { public class SampleFormData { public string SampleString = "Sample String Data"; public int SampleInt = -1; } [ToolboxItem(false)] public class SampleSpecificFormDataContainer : DataBoundControl, INamingContainer { SampleSpecificEntryForm entryForm; internal SampleSpecificEntryForm EntryForm { get { return entryForm; } } [Bindable(true), Category("Data")] public string SampleString { get { return entryForm.FormData.SampleString; } set { entryForm.FormData.SampleString = value; } } [Bindable(true), Category("Data")] public int SampleInt { get { return entryForm.FormData.SampleInt; } set { entryForm.FormData.SampleInt = value; } } internal SampleSpecificFormDataContainer(SampleSpecificEntryForm entryForm) { this.entryForm = entryForm; } } public class SampleSpecificEntryForm : WebControl, INamingContainer { #region Template private IBindableTemplate formTemplate = null; [Browsable(false), DefaultValue(null), TemplateContainer(typeof(SampleSpecificFormDataContainer), ComponentModel.BindingDirection.TwoWay), PersistenceMode(PersistenceMode.InnerProperty)] public virtual IBindableTemplate FormTemplate { get { return formTemplate; } set { formTemplate = value; } } #endregion #region Viewstate SampleFormData FormDataVS { get { return (ViewState["FormData"] as SampleFormData) ?? new SampleFormData(); } set { ViewState["FormData"] = value; SaveViewState(); } } #endregion public override ControlCollection Controls { get { EnsureChildControls(); return base.Controls; } } private SampleSpecificFormDataContainer formDataContainer = null; [Browsable(false), DesignerSerializationVisibility(DesignerSerializationVisibility.Hidden)] public SampleSpecificFormDataContainer FormDataContainer { get { EnsureChildControls(); return formDataContainer; } } [Bindable(true), Browsable(false)] public SampleFormData FormData { get { return FormDataVS; } set { FormDataVS = value; } } protected override void CreateChildControls() { if (!this.ChildControlsCreated) { Controls.Clear(); formDataContainer = new SampleSpecificFormDataContainer(this); Controls.Add(formDataContainer); FormTemplate.InstantiateIn(formDataContainer); this.ChildControlsCreated = true; } } public override void DataBind() { CreateChildControls(); base.DataBind(); } } } With an ASP.NET page the following: <%@ Page Title="Home Page" Language="C#" MasterPageFile="~/Site.master" AutoEventWireup="true" CodeBehind="Default2.aspx.cs" Inherits="EntryFormTest._Default2" EnableEventValidation="false" %> <%@ Register Assembly="EntryForm" Namespace="System.Web.UI.WebControls.Special" TagPrefix="cc1" %> <asp:Content ID="HeaderContent" runat="server" ContentPlaceHolderID="HeadContent"> </asp:Content> <asp:Content ID="BodyContent" runat="server" ContentPlaceHolderID="MainContent"> <h2> Welcome to ASP.NET! </h2> <cc1:SampleSpecificEntryForm ID="EntryForm1" runat="server"> <FormTemplate> <asp:TextBox ID="TextBox1" runat="server" Text='<%# Bind("SampleString") %>'></asp:TextBox><br /> <h3>(<%# Container.SampleString %>)</h3><br /> <asp:Button ID="Button1" runat="server" Text="Button" /> </FormTemplate> </cc1:SampleSpecificEntryForm> </asp:Content> Default2.aspx.cs using System; namespace EntryFormTest { public partial class _Default2 : System.Web.UI.Page { protected void Page_Load(object sender, EventArgs e) { EntryForm1.DataBind(); } } } Thanks for any help!

    Read the article

  • Converting Encrypted Values

    - by Johnm
    Your database has been protecting sensitive data at rest using the cell-level encryption features of SQL Server for quite sometime. The employees in the auditing department have been inviting you to their after-work gatherings and buying you drinks. Thousands of customers implicitly include you in their prayers of thanks giving as their identities remain safe in your company's database. The cipher text resting snuggly in a column of the varbinary data type is great for security; but it can create some interesting challenges when interacting with other data types such as the XML data type. The XML data type is one that is often used as a message type for the Service Broker feature of SQL Server. It also can be an interesting data type to capture for auditing or integrating with external systems. The challenge that cipher text presents is that the need for decryption remains even after it has experienced its XML metamorphosis. Quite an interesting challenge nonetheless; but fear not. There is a solution. To simulate this scenario, we first will want to create a plain text value for us to encrypt. We will do this by creating a variable to store our plain text value: -- set plain text value DECLARE @PlainText NVARCHAR(255); SET @PlainText = 'This is plain text to encrypt'; The next step will be to create a variable that will store the cipher text that is generated from the encryption process. We will populate this variable by using a pre-defined symmetric key and certificate combination: -- encrypt plain text value DECLARE @CipherText VARBINARY(MAX); OPEN SYMMETRIC KEY SymKey     DECRYPTION BY CERTIFICATE SymCert     WITH PASSWORD='mypassword2010';     SET @CipherText = EncryptByKey                          (                            Key_GUID('SymKey'),                            @PlainText                           ); CLOSE ALL SYMMETRIC KEYS; The value of our newly generated cipher text is 0x006E12933CBFB0469F79ABCC79A583--. This will be important as we reference our cipher text later in this post. Our final step in preparing our scenario is to create a table variable to simulate the existence of a table that contains a column used to hold encrypted values. Once this table variable has been created, populate the table variable with the newly generated cipher text: -- capture value in table variable DECLARE @tbl TABLE (EncVal varbinary(MAX)); INSERT INTO @tbl (EncVal) VALUES (@CipherText); We are now ready to experience the challenge of capturing our encrypted column in an XML data type using the FOR XML clause: -- capture set in xml DECLARE @xml XML; SET @xml = (SELECT               EncVal             FROM @tbl AS MYTABLE             FOR XML AUTO, BINARY BASE64, ROOT('root')); If you add the SELECT @XML statement at the end of this portion of the code you will see the contents of the XML data in its raw format: <root>   <MYTABLE EncVal="AG4Skzy/sEafeavMeaWDBwEAAACE--" /> </root> Strangely, the value that is captured appears nothing like the value that was created through the encryption process. The result being that when this XML is converted into a readable data set the encrypted value will not be able to be decrypted, even with access to the symmetric key and certificate used to perform the decryption. An immediate thought might be to convert the varbinary data type to either a varchar or nvarchar before creating the XML data. This approach makes good sense. The code for this might look something like the following: -- capture set in xml DECLARE @xml XML; SET @xml = (SELECT              CONVERT(NVARCHAR(MAX),EncVal) AS EncVal             FROM @tbl AS MYTABLE             FOR XML AUTO, BINARY BASE64, ROOT('root')); However, this results in the following error: Msg 9420, Level 16, State 1, Line 26 XML parsing: line 1, character 37, illegal xml character A quick query that returns CONVERT(NVARCHAR(MAX),EncVal) reveals that the value that is causing the error looks like something off of a genuine Chinese menu. While this situation does present us with one of those spine-tingling, expletive-generating challenges, rest assured that this approach is on the right track. With the addition of the "style" argument to the CONVERT method, our solution is at hand. When dealing with converting varbinary data types we have three styles available to us: - The first is to not include the style parameter, or use the value of "0". As we see, this style will not work for us. - The second option is to use the value of "1" will keep our varbinary value including the "0x" prefix. In our case, the value will be 0x006E12933CBFB0469F79ABCC79A583-- - The third option is to use the value of "2" which will chop the "0x" prefix off of our varbinary value. In our case, the value will be 006E12933CBFB0469F79ABCC79A583-- Since we will want to convert this back to varbinary when reading this value from the XML data we will want the "0x" prefix, so we will want to change our code as follows: -- capture set in xml DECLARE @xml XML; SET @xml = (SELECT              CONVERT(NVARCHAR(MAX),EncVal,1) AS EncVal             FROM @tbl AS MYTABLE             FOR XML AUTO, BINARY BASE64, ROOT('root')); Once again, with the inclusion of the SELECT @XML statement at the end of this portion of the code you will see the contents of the XML data in its raw format: <root>   <MYTABLE EncVal="0x006E12933CBFB0469F79ABCC79A583--" /> </root> Nice! We are now cooking with gas. To continue our scenario, we will want to parse the XML data into a data set so that we can glean our freshly captured cipher text. Once we have our cipher text snagged we will capture it into a variable so that it can be used during decryption: -- read back xml DECLARE @hdoc INT; DECLARE @EncVal NVARCHAR(MAX); EXEC sp_xml_preparedocument @hDoc OUTPUT, @xml; SELECT @EncVal = EncVal FROM OPENXML (@hdoc, '/root/MYTABLE') WITH ([EncVal] VARBINARY(MAX) '@EncVal'); EXEC sp_xml_removedocument @hDoc; Finally, the decryption of our cipher text using the DECRYPTBYKEYAUTOCERT method and the certificate utilized to perform the encryption earlier in our exercise: SELECT     CONVERT(NVARCHAR(MAX),                     DecryptByKeyAutoCert                          (                            CERT_ID('AuditLogCert'),                            N'mypassword2010',                            @EncVal                           )                     ) EncVal; Ah yes, another hurdle presents itself! The decryption produced the value of NULL which in cryptography means that either you don't have permissions to decrypt the cipher text or something went wrong during the decryption process (ok, sometimes the value is actually NULL; but not in this case). As we see, the @EncVal variable is an nvarchar data type. The third parameter of the DECRYPTBYKEYAUTOCERT method requires a varbinary value. Therefore we will need to utilize our handy-dandy CONVERT method: SELECT     CONVERT(NVARCHAR(MAX),                     DecryptByKeyAutoCert                          (                             CERT_ID('AuditLogCert'),                             N'mypassword2010',                             CONVERT(VARBINARY(MAX),@EncVal)                           )                     ) EncVal; Oh, almost. The result remains NULL despite our conversion to the varbinary data type. This is due to the creation of an varbinary value that does not reflect the actual value of our @EncVal variable; but rather a varbinary conversion of the variable itself. In this case, something like 0x3000780030003000360045003--. Considering the "style" parameter got us past XML challenge, we will want to consider its power for this challenge as well. Knowing that the value of "1" will provide us with the actual value including the "0x", we will opt to utilize that value in this case: SELECT     CONVERT(NVARCHAR(MAX),                     DecryptByKeyAutoCert                          (                            CERT_ID('SymCert'),                            N'mypassword2010',                            CONVERT(VARBINARY(MAX),@EncVal,1)                           )                     ) EncVal; Bingo, we have success! We have discovered what happens with varbinary data when captured as XML data. We have figured out how to make this data useful post-XML-ification. Best of all we now have a choice in after-work parties now that our very happy client who depends on our XML based interface invites us for dinner in celebration. All thanks to the effective use of the style parameter.

    Read the article

  • java: how to get a string representation of a compressed byte array ?

    - by Guillaume
    I want to put some compressed data into a remote repository. To put data on this repository I can only use a method that take the name of the resource and its content as a String. (like data.txt + "hello world"). The repository is moking a filesystem but is not, so I can not use File directly. I want to be able to do the following: client send to server a file 'data.txt' server compress 'data.txt' into a compressed file 'data.zip' server send a string representation of data.zip to the repository repository store data.zip client download from repository data.zip and his able to open it with its favorite zip tool The problem arise at step 3 when I try to get a string representation of my compressed file. Here is a sample class, using the zip*stream and that emulate the repository showcasing my problem. The created zip file is working, but after its 'serialization' it's get corrupted. (the sample class use jakarta commons.io ) Many thanks for your help. package zip; import java.io.File; import java.io.FileInputStream; import java.io.FileOutputStream; import java.io.IOException; import java.io.InputStream; import java.util.zip.ZipEntry; import java.util.zip.ZipInputStream; import java.util.zip.ZipOutputStream; import org.apache.commons.io.FileUtils; /** * Date: May 19, 2010 - 6:13:07 PM * * @author Guillaume AME. */ public class ZipMe { public static void addOrUpdate(File zipFile, File ... files) throws IOException { File tempFile = File.createTempFile(zipFile.getName(), null); // delete it, otherwise you cannot rename your existing zip to it. tempFile.delete(); boolean renameOk = zipFile.renameTo(tempFile); if (!renameOk) { throw new RuntimeException("could not rename the file " + zipFile.getAbsolutePath() + " to " + tempFile.getAbsolutePath()); } byte[] buf = new byte[1024]; ZipInputStream zin = new ZipInputStream(new FileInputStream(tempFile)); ZipOutputStream out = new ZipOutputStream(new FileOutputStream(zipFile)); ZipEntry entry = zin.getNextEntry(); while (entry != null) { String name = entry.getName(); boolean notInFiles = true; for (File f : files) { if (f.getName().equals(name)) { notInFiles = false; break; } } if (notInFiles) { // Add ZIP entry to output stream. out.putNextEntry(new ZipEntry(name)); // Transfer bytes from the ZIP file to the output file int len; while ((len = zin.read(buf)) > 0) { out.write(buf, 0, len); } } entry = zin.getNextEntry(); } // Close the streams zin.close(); // Compress the files if (files != null) { for (File file : files) { InputStream in = new FileInputStream(file); // Add ZIP entry to output stream. out.putNextEntry(new ZipEntry(file.getName())); // Transfer bytes from the file to the ZIP file int len; while ((len = in.read(buf)) > 0) { out.write(buf, 0, len); } // Complete the entry out.closeEntry(); in.close(); } // Complete the ZIP file } tempFile.delete(); out.close(); } public static void main(String[] args) throws IOException { final String zipArchivePath = "c:/temp/archive.zip"; final String tempFilePath = "c:/temp/data.txt"; final String resultZipFile = "c:/temp/resultingArchive.zip"; File zipArchive = new File(zipArchivePath); FileUtils.touch(zipArchive); File tempFile = new File(tempFilePath); FileUtils.writeStringToFile(tempFile, "hello world"); addOrUpdate(zipArchive, tempFile); //archive.zip exists and contains a compressed data.txt that can be read using winrar //now simulate writing of the zip into a in memory cache String archiveText = FileUtils.readFileToString(zipArchive); FileUtils.writeStringToFile(new File(resultZipFile), archiveText); //resultingArchive.zip exists, contains a compressed data.txt, but it can not //be read using winrar: CRC failed in data.txt. The file is corrupt } }

    Read the article

  • MVVM - implementing 'IsDirty' functionality to a ModelView in order to save data

    - by Brendan
    Hi, Being new to WPF & MVVM I struggling with some basic functionality. Let me first explain what I am after, and then attach some example code... I have a screen showing a list of users, and I display the details of the selected user on the right-hand side with editable textboxes. I then have a Save button which is DataBound, but I would only like this button to display when data has actually changed. ie - I need to check for "dirty data". I have a fully MVVM example in which I have a Model called User: namespace Test.Model { class User { public string UserName { get; set; } public string Surname { get; set; } public string Firstname { get; set; } } } Then, the ViewModel looks like this: using System.Collections.ObjectModel; using System.Collections.Specialized; using System.Windows.Input; using Test.Model; namespace Test.ViewModel { class UserViewModel : ViewModelBase { //Private variables private ObservableCollection<User> _users; RelayCommand _userSave; //Properties public ObservableCollection<User> User { get { if (_users == null) { _users = new ObservableCollection<User>(); //I assume I need this Handler, but I am stuggling to implement it successfully //_users.CollectionChanged += HandleChange; //Populate with users _users.Add(new User {UserName = "Bob", Firstname="Bob", Surname="Smith"}); _users.Add(new User {UserName = "Smob", Firstname="John", Surname="Davy"}); } return _users; } } //Not sure what to do with this?!?! //private void HandleChange(object sender, NotifyCollectionChangedEventArgs e) //{ // if (e.Action == NotifyCollectionChangedAction.Remove) // { // foreach (TestViewModel item in e.NewItems) // { // //Removed items // } // } // else if (e.Action == NotifyCollectionChangedAction.Add) // { // foreach (TestViewModel item in e.NewItems) // { // //Added items // } // } //} //Commands public ICommand UserSave { get { if (_userSave == null) { _userSave = new RelayCommand(param => this.UserSaveExecute(), param => this.UserSaveCanExecute); } return _userSave; } } void UserSaveExecute() { //Here I will call my DataAccess to actually save the data } bool UserSaveCanExecute { get { //This is where I would like to know whether the currently selected item has been edited and is thus "dirty" return false; } } //constructor public UserViewModel() { } } } The "RelayCommand" is just a simple wrapper class, as is the "ViewModelBase". (I'll attach the latter though just for clarity) using System; using System.ComponentModel; namespace Test.ViewModel { public abstract class ViewModelBase : INotifyPropertyChanged, IDisposable { protected ViewModelBase() { } public event PropertyChangedEventHandler PropertyChanged; protected virtual void OnPropertyChanged(string propertyName) { PropertyChangedEventHandler handler = this.PropertyChanged; if (handler != null) { var e = new PropertyChangedEventArgs(propertyName); handler(this, e); } } public void Dispose() { this.OnDispose(); } protected virtual void OnDispose() { } } } Finally - the XAML <Window x:Class="Test.MainWindow" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" xmlns:vm="clr-namespace:Test.ViewModel" Title="MainWindow" Height="350" Width="525"> <Window.DataContext> <vm:UserViewModel/> </Window.DataContext> <Grid> <ListBox Height="238" HorizontalAlignment="Left" Margin="12,12,0,0" Name="listBox1" VerticalAlignment="Top" Width="197" ItemsSource="{Binding Path=User}" IsSynchronizedWithCurrentItem="True"> <ListBox.ItemTemplate> <DataTemplate> <StackPanel> <TextBlock Text="{Binding Path=Firstname}"/> <TextBlock Text="{Binding Path=Surname}"/> </StackPanel> </DataTemplate> </ListBox.ItemTemplate> </ListBox> <Label Content="Username" Height="28" HorizontalAlignment="Left" Margin="232,16,0,0" Name="label1" VerticalAlignment="Top" /> <TextBox Height="23" HorizontalAlignment="Left" Margin="323,21,0,0" Name="textBox1" VerticalAlignment="Top" Width="120" Text="{Binding Path=User/UserName}" /> <Label Content="Surname" Height="28" HorizontalAlignment="Left" Margin="232,50,0,0" Name="label2" VerticalAlignment="Top" /> <TextBox Height="23" HorizontalAlignment="Left" Margin="323,52,0,0" Name="textBox2" VerticalAlignment="Top" Width="120" Text="{Binding Path=User/Surname}" /> <Label Content="Firstname" Height="28" HorizontalAlignment="Left" Margin="232,84,0,0" Name="label3" VerticalAlignment="Top" /> <TextBox Height="23" HorizontalAlignment="Left" Margin="323,86,0,0" Name="textBox3" VerticalAlignment="Top" Width="120" Text="{Binding Path=User/Firstname}" /> <Button Content="Button" Height="23" HorizontalAlignment="Left" Margin="368,159,0,0" Name="button1" VerticalAlignment="Top" Width="75" Command="{Binding Path=UserSave}" /> </Grid> </Window> So basically, when I edit a surname, the Save button should be enabled; and if I undo my edit - well then it should be Disabled again as nothing has changed. I have seen this in many examples, but have not yet found out how to do it. Any help would be much appreciated! Brendan

    Read the article

  • Jquery Live Function

    - by marharépa
    Hi! I want to make this script to work as LIVE() function. Please help me! $(".img img").each(function() { $(this).cjObjectScaler({ destElem: $(this).parent(), method: "fit" }); }); the cjObjectScaler script (called in the html header) is this: (thanks for Doug Jones) (function ($) { jQuery.fn.imagesLoaded = function (callback) { var elems = this.filter('img'), len = elems.length; elems.bind('load', function () { if (--len <= 0) { callback.call(elems, this); } }).each(function () { // cached images don't fire load sometimes, so we reset src. if (this.complete || this.complete === undefined) { var src = this.src; // webkit hack from http://groups.google.com/group/jquery-dev/browse_thread/thread/eee6ab7b2da50e1f this.src = '#'; this.src = src; } }); }; })(jQuery); /* CJ Object Scaler */ (function ($) { jQuery.fn.cjObjectScaler = function (options) { /* user variables (settings) ***************************************/ var settings = { // must be a jQuery object method: "fill", // the parent object to scale our object into destElem: null, // fit|fill fade: 0 // if positive value, do hide/fadeIn }; /* system variables ***************************************/ var sys = { // function parameters version: '2.1.1', elem: null }; /* scale the image ***************************************/ function scaleObj(obj) { // declare some local variables var destW = jQuery(settings.destElem).width(), destH = jQuery(settings.destElem).height(), ratioX, ratioY, scale, newWidth, newHeight, borderW = parseInt(jQuery(obj).css("borderLeftWidth"), 10) + parseInt(jQuery(obj).css("borderRightWidth"), 10), borderH = parseInt(jQuery(obj).css("borderTopWidth"), 10) + parseInt(jQuery(obj).css("borderBottomWidth"), 10), objW = jQuery(obj).width(), objH = jQuery(obj).height(); // check for valid border values. IE takes in account border size when calculating width/height so just set to 0 borderW = isNaN(borderW) ? 0 : borderW; borderH = isNaN(borderH) ? 0 : borderH; // calculate scale ratios ratioX = destW / jQuery(obj).width(); ratioY = destH / jQuery(obj).height(); // Determine which algorithm to use if (!jQuery(obj).hasClass("cf_image_scaler_fill") && (jQuery(obj).hasClass("cf_image_scaler_fit") || settings.method === "fit")) { scale = ratioX < ratioY ? ratioX : ratioY; } else if (!jQuery(obj).hasClass("cf_image_scaler_fit") && (jQuery(obj).hasClass("cf_image_scaler_fill") || settings.method === "fill")) { scale = ratioX < ratioY ? ratioX : ratioY; } // calculate our new image dimensions newWidth = parseInt(jQuery(obj).width() * scale, 10) - borderW; newHeight = parseInt(jQuery(obj).height() * scale, 10) - borderH; // Set new dimensions & offset jQuery(obj).css({ "width": newWidth + "px", "height": newHeight + "px"//, // "position": "absolute", // "top": (parseInt((destH - newHeight) / 2, 10) - parseInt(borderH / 2, 10)) + "px", // "left": (parseInt((destW - newWidth) / 2, 10) - parseInt(borderW / 2, 10)) + "px" }).attr({ "width": newWidth, "height": newHeight }); // do our fancy fade in, if user supplied a fade amount if (settings.fade > 0) { jQuery(obj).fadeIn(settings.fade); } } /* set up any user passed variables ***************************************/ if (options) { jQuery.extend(settings, options); } /* main ***************************************/ return this.each(function () { sys.elem = this; // if they don't provide a destObject, use parent if (settings.destElem === null) { settings.destElem = jQuery(sys.elem).parent(); } // need to make sure the user set the parent's position. Things go bonker's if not set. // valid values: absolute|relative|fixed if (jQuery(settings.destElem).css("position") === "static") { jQuery(settings.destElem).css({ "position": "relative" }); } // if our object to scale is an image, we need to make sure it's loaded before we continue. if (typeof sys.elem === "object" && typeof settings.destElem === "object" && typeof settings.method === "string") { // if the user supplied a fade amount, hide our image if (settings.fade > 0) { jQuery(sys.elem).hide(); } if (sys.elem.nodeName === "IMG") { // to fix the weird width/height caching issue we set the image dimensions to be auto; jQuery(sys.elem).width("auto"); jQuery(sys.elem).height("auto"); // wait until the image is loaded before scaling jQuery(sys.elem).imagesLoaded(function () { scaleObj(this); }); } else { scaleObj(jQuery(sys.elem)); } } else { console.debug("CJ Object Scaler could not initialize."); return; } }); }; })(jQuery);

    Read the article

  • problem in displaying list using array adapters

    - by Rahul Varma
    Hi, I am trying to display the list of songs using array adapters. But the problem is i couldnt display the list and only empty screen with preset background is showing up. Here's the code...All the thee are seperate classes... Plz help me... public class SongsAdapter extends ArrayAdapter<SongsList>{ private Context context; TextView tvTitle; TextView tvMovie; TextView tvSinger; String s; public SongsAdapter(Context context, int resource, int textViewResourceId, String title) { super(context, resource, textViewResourceId); this.context=context; } public View getView(int position, View convertView, ViewGroup parent) { final int i=position; List<SongsList> listSongs = new ArrayList<SongsList>(); String title = listSongs.get(i).gettitleName().toString(); String album = listSongs.get(i).getmovieName().toString(); String artist = listSongs.get(i).getsingerName().toString(); String imgal = listSongs.get(i).gettitleName().toString(); LayoutInflater inflater = ((Activity) context).getLayoutInflater(); View v = inflater.inflate(R.layout.row, null); tvTitle=(TextView)v.findViewById(R.id.text2); tvMovie=(TextView)v.findViewById(R.id.text3); tvSinger=(TextView)v.findViewById(R.id.text1); tvTitle.setText(title); tvMovie.setText(album); tvSinger.setText(artist); final ImageView im=(ImageView)v.findViewById(R.id.image); s="http://www.gorinka.com/"+imgal; String imgPath=s; AsyncImageLoaderv asyncImageLoaderv=new AsyncImageLoaderv(); Bitmap cachedImage = asyncImageLoaderv.loadDrawable(imgPath, new AsyncImageLoaderv.ImageCallback() { public void imageLoaded(Bitmap imageDrawable, String imageUrl) { im.setImageBitmap(imageDrawable); } }); im.setImageBitmap(cachedImage); return v; } public class imageloader implements Runnable{ private String ss; private ImageView im; public imageloader(String s, ImageView im) { this.ss=s; this.im=im; Thread thread = new Thread(this); thread.start(); } public void run(){ try { HttpGet httpRequest = null; httpRequest = new HttpGet(ss); HttpClient httpclient = new DefaultHttpClient(); HttpResponse response = (HttpResponse) httpclient.execute(httpRequest); HttpEntity entity = response.getEntity(); BufferedHttpEntity bufHttpEntity = new BufferedHttpEntity(entity); InputStream is = bufHttpEntity.getContent(); Bitmap bm = BitmapFactory.decodeStream(is); Log.d("img","img"); is.close(); im.setImageBitmap(bm); } catch (Exception t) { Log.e("bitmap url", "Exception in updateStatus()", t); } } } } public class SongsList { private String titleName; private String movieName; private String singerName; private String imagePath; private String mediaPath; // Constructor for the SongsList class public SongsList(String titleName, String movieName, String singerName,String imagePath,String mediaPath ) { super(); this.titleName = titleName; this.movieName = movieName; this.singerName = singerName; this.imagePath = imagePath; this.mediaPath = mediaPath; } public String gettitleName() { return titleName; } public void settitleName(String titleName) { this.titleName = titleName; } public String getmovieName() { return movieName; } public void setmovieName(String movieName) { this.movieName = movieName; } public String getsingerName() { return singerName; } public void setsingerName(String singerName) { this.singerName = singerName; } public String getimagePath() { return imagePath; } public void setimagePath(String imagePath) { this.imagePath = imagePath; } public String getmediaPath() { return mediaPath; } public void setmediaPath(String mediaPath) { this.mediaPath = mediaPath; } } public class MusicListActivity extends Activity { @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.openadiuofile); ListView list = (ListView)findViewById(R.id.list1); SongsAdapter adapter = new SongsAdapter(this,R.layout.row, R.id.text2, null); list.setAdapter(adapter); } }

    Read the article

  • Problems in php coding

    - by anwar
    Hi there everyone im new to PHP and Joomla and I have developed a component in Joomla but my code is giving me errors. I have tried to solve the problem but I’am unable to solve it. So can anyone suggest me what is the problem with my code? Thanks in advance. Here are my two files: 1st view.html.php defined('_JEXEC') or die('=;)'); jimport('joomla.application.component.view'); class namnamViewlistrestaurant extends JView { function display($tpl = null) { $item = 'item'; RestUser::RestrictDirectAccess(); //-- Custom css JHTML::stylesheet( 'style.css', 'components/com_namnam/assets/css/' ); $cuisine=Lookups::getLookup('cuisine'); $lists['cuisine'] = JHTML::_('select.genericlist', $cuisine, 'idcuisine[]', 'class="inputbox" size="7"', 'value', 'text', $item->idcuisine); $category=Lookups::getLookup('restcategory'); $lists['category'] = JHTML::_('select.genericlist', $category, 'idcategory[]', 'class="inputbox" multiple="multiple" size="7"', 'value', 'text', $item->idcategory); $items = & $this->get('Data'); $pagination =& $this->get('Pagination'); $lists = & $this->get('List'); $this->assignRef('items', $items); $this->assignRef('pagination', $pagination); $this->assignRef('lists', $lists); parent::display($tpl); }//function }//class And 2nd is listrestaurant.php defined('_JEXEC') or die('=;)'); jimport('joomla.application.component.model'); class namnamModellistrestaurant extends JModel { var $_data; var $_total = null; var $_pagination = null; function __construct() { parent::__construct(); global $mainframe, $option; $limit = $mainframe->getUserStateFromRequest( 'global.list.limit', 'limit', $mainframe->getCfg('list_limit'), 'int' ); $limitstart = $mainframe->getUserStateFromRequest( $option.'.limitstart', 'limitstart', 0, 'int' ); $limitstart = ($limit != 0 ? (floor($limitstart / $limit) * $limit) : 0); $this->setState('limit', $limit); $this->setState('limitstart', $limitstart); } function _buildQuery() { $where = array(); $where[]=" idowner=".RestUser::getUserID()." "; if ($this->search) { $where[] = 'LOWER(name) LIKE \''. $this->search. '\''; } $where =( count($where) ) ? ' WHERE ' . implode( ' AND ', $where ) : ''; $orderby = ''; #_ECR_MAT_FILTER_MODEL1_ if (($this->filter_order) && ($this->filter_order_Dir)) { $orderby = ' ORDER BY '. $this->filter_order .' '. $this->filter_order_Dir; } $this->_query = ' SELECT *' . ' FROM #__namnam_restaurants ' . $where . $orderby ; return $this->_query; } function getData() { if (empty($this->_data)) { $query = $this->_buildQuery(); $this->_data = $this->_getList($query, $this->getState('limitstart'), $this->getState('limit')); } return $this->_data; } function getList() { // table ordering $lists['order_Dir'] = $this->filter_order_Dir; $lists['order'] = $this->filter_order; // search filter $lists['search']= $this->search; return $lists; } function getTotal() { // Load the content if it doesn't already exist if (empty($this->_total)) { $query = $this->_buildQuery(); $this->_total = $this->_getListCount($query); } return $this->_total; } function getPagination() { // Load the content if it doesn't already exist if (empty($this->_pagination)) { jimport('joomla.html.pagination'); $this->_pagination = new JPagination($this->getTotal(), $this->getState('limitstart'), $this->getState('limit') ); } return $this->_pagination; } }//class And the errors are: Notice: Trying to get property of non-object in C:\wamp\www\namnam.com\components\com_namnam\views\listrestaurant\view.html.php on line 26 Notice: Trying to get property of non-object in C:\wamp\www\namnam.com\components\com_namnam\views\listrestaurant\view.html.php on line 29 Notice: Undefined property: namnamModellistrestaurant::$search in C:\wamp\www\namnam.com\components\com_namnam\models\listrestaurant.php on line 38 Notice: Undefined property: namnamModellistrestaurant::$filter_order in C:\wamp\www\namnam.com\components\com_namnam\models\listrestaurant.php on line 48 Notice: Undefined property: namnamModellistrestaurant::$search in C:\wamp\www\namnam.com\components\com_namnam\models\listrestaurant.php on line 38 Notice: Undefined property: namnamModellistrestaurant::$filter_order in C:\wamp\www\namnam.com\components\com_namnam\models\listrestaurant.php on line 48 Notice: Undefined property: namnamModellistrestaurant::$filter_order_Dir in C:\wamp\www\namnam.com\components\com_namnam\models\listrestaurant.php on line 76 Notice: Undefined property: namnamModellistrestaurant::$filter_order in C:\wamp\www\namnam.com\components\com_namnam\models\listrestaurant.php on line 77 Notice: Undefined property: namnamModellistrestaurant::$search in C:\wamp\www\namnam.com\components\com_namnam\models\listrestaurant.php on line 80

    Read the article

  • Connecting SceneBuilder edited FXML to Java code

    - by daniel
    Recently I had to answer several questions regarding how to connect an UI built with the JavaFX SceneBuilder 1.0 Developer Preview to Java Code. So I figured out that a short overview might be helpful. But first, let me state the obvious. What is FXML? To make it short, FXML is an XML based declaration format for JavaFX. JavaFX provides an FXML loader which will parse FXML files and from that construct a graph of Java object. It may sound complex when stated like that but it is actually quite simple. Here is an example of FXML file, which instantiate a StackPane and puts a Button inside it: -- <?xml version="1.0" encoding="UTF-8"?> <?import java.lang.*?> <?import java.util.*?> <?import javafx.scene.control.*?> <?import javafx.scene.layout.*?> <?import javafx.scene.paint.*?> <StackPane prefHeight="150.0" prefWidth="200.0" xmlns:fx="http://javafx.com/fxml"> <children> <Button mnemonicParsing="false" text="Button" /> </children> </StackPane> ... and here is the code I would have had to write if I had chosen to do the same thing programatically: import javafx.scene.control.*; import javafx.scene.layout.*; ... final Button button = new Button("Button"); button.setMnemonicParsing(false); final StackPane stackPane = new StackPane(); stackPane.setPrefWidth(200.0); stackPane.setPrefHeight(150.0); stacPane.getChildren().add(button); As you can see - FXML is rather simple to understand - as it is quite close to the JavaFX API. So OK FXML is simple, but why would I use it?Well, there are several answers to that - but my own favorite is: because you can make it with SceneBuilder. What is SceneBuilder? In short SceneBuilder is a layout tool that will let you graphically build JavaFX user interfaces by dragging and dropping JavaFX components from a library, and save it as an FXML file. SceneBuilder can also be used to load and modify JavaFX scenegraphs declared in FXML. Here is how I made the small FXML file above: Start the JavaFX SceneBuilder 1.0 Developer Preview In the Library on the left hand side, click on 'StackPane' and drag it on the content view (the white rectangle) In the Library, select a Button and drag it onto the StackPane on the content view. In the Hierarchy Panel on the left hand side - select the StackPane component, then invoke 'Edit > Trim To Selected' from the menubar That's it - you can now save, and you will obtain the small FXML file shown above. Of course this is only a trivial sample, made for the sake of the example - and SceneBuilder will let you create much more complex UIs. So, I have now an FXML file. But what do I do with it? How do I include it in my program? How do I write my main class? Loading an FXML file with JavaFX Well, that's the easy part - because the piece of code you need to write never changes. You can download and look at the SceneBuilder samples if you need to get convinced, but here is the short version: Create a Java class (let's call it 'Main.java') which extends javafx.application.Application In the same directory copy/save the FXML file you just created using SceneBuilder. Let's name it "simple.fxml" Now here is the Java code for the Main class, which simply loads the FXML file and puts it as root in a stage's scene. /* * Copyright (c) 2012, Oracle and/or its affiliates. All rights reserved. */ package simple; import java.util.logging.Level; import java.util.logging.Logger; import javafx.application.Application; import javafx.fxml.FXMLLoader; import javafx.scene.Scene; import javafx.scene.layout.StackPane; import javafx.stage.Stage; public class Main extends Application { /** * @param args the command line arguments */ public static void main(String[] args) { Application.launch(Main.class, (java.lang.String[])null); } @Override public void start(Stage primaryStage) { try { StackPane page = (StackPane) FXMLLoader.load(Main.class.getResource("simple.fxml")); Scene scene = new Scene(page); primaryStage.setScene(scene); primaryStage.setTitle("FXML is Simple"); primaryStage.show(); } catch (Exception ex) { Logger.getLogger(Main.class.getName()).log(Level.SEVERE, null, ex); } } } Great! Now I only have to use my favorite IDE to compile the class and run it. But... wait... what does it do? Well nothing. It just displays a button in the middle of a window. There's no logic attached to it. So how do we do that? How can I connect this button to my application logic? Here is how: Connection to code First let's define our application logic. Since this post is only intended to give a very brief overview - let's keep things simple. Let's say that the only thing I want to do is print a message on System.out when the user clicks on my button. To do that, I'll need to register an action handler with my button. And to do that, I'll need to somehow get a handle on my button. I'll need some kind of controller logic that will get my button and add my action handler to it. So how do I get a handle to my button and pass it to my controller? Once again - this is easy: I just need to write a controller class for my FXML. With each FXML file, it is possible to associate a controller class defined for that FXML. That controller class will make the link between the UI (the objects defined in the FXML) and the application logic. To each object defined in FXML we can associate an fx:id. The value of the id must be unique within the scope of the FXML, and is the name of an instance variable inside the controller class, in which the object will be injected. Since I want to have access to my button, I will need to add an fx:id to my button in FXML, and declare an @FXML variable in my controller class with the same name. In other words - I will need to add fx:id="myButton" to my button in FXML: -- <Button fx:id="myButton" mnemonicParsing="false" text="Button" /> and declare @FXML private Button myButton in my controller class @FXML private Button myButton; // value will be injected by the FXMLLoader Let's see how to do this. Add an fx:id to the Button object Load "simple.fxml" in SceneBuilder - if not already done In the hierarchy panel (bottom left), or directly on the content view, select the Button object. Open the Properties sections of the inspector (right panel) for the button object At the top of the section, you will see a text field labelled fx:id. Enter myButton in that field and validate. Associate a controller class with the FXML file Still in SceneBuilder, select the top root object (in our case, that's the StackPane), and open the Code section of the inspector (right hand side) At the top of the section you should see a text field labelled Controller Class. In the field, type simple.SimpleController. This is the name of the class we're going to create manually. If you save at this point, the FXML will look like this: -- <?xml version="1.0" encoding="UTF-8"?> <?import java.lang.*?> <?import java.util.*?> <?import javafx.scene.control.*?> <?import javafx.scene.layout.*?> <?import javafx.scene.paint.*?> <StackPane prefHeight="150.0" prefWidth="200.0" xmlns:fx="http://javafx.com/fxml" fx:controller="simple.SimpleController"> <children> <Button fx:id="myButton" mnemonicParsing="false" text="Button" /> </children> </StackPane> As you can see, the name of the controller class has been added to the root object: fx:controller="simple.SimpleController" Coding the controller class In your favorite IDE, create an empty SimpleController.java class. Now what does a controller class looks like? What should we put inside? Well - SceneBuilder will help you there: it will show you an example of controller skeleton tailored for your FXML. In the menu bar, invoke View > Show Sample Controller Skeleton. A popup appears, displaying a suggestion for the controller skeleton: copy the code displayed there, and paste it into your SimpleController.java: /** * Sample Skeleton for "simple.fxml" Controller Class * Use copy/paste to copy paste this code into your favorite IDE **/ package simple; import java.net.URL; import java.util.ResourceBundle; import javafx.fxml.FXML; import javafx.fxml.Initializable; import javafx.scene.control.Button; public class SimpleController implements Initializable { @FXML // fx:id="myButton" private Button myButton; // Value injected by FXMLLoader @Override // This method is called by the FXMLLoader when initialization is complete public void initialize(URL fxmlFileLocation, ResourceBundle resources) { assert myButton != null : "fx:id=\"myButton\" was not injected: check your FXML file 'simple.fxml'."; // initialize your logic here: all @FXML variables will have been injected } } Note that the code displayed by SceneBuilder is there only for educational purpose: SceneBuilder does not create and does not modify Java files. This is simply a hint of what you can use, given the fx:id present in your FXML file. You are free to copy all or part of the displayed code and paste it into your own Java class. Now at this point, there only remains to add our logic to the controller class. Quite easy: in the initialize method, I will register an action handler with my button: () { @Override public void handle(ActionEvent event) { System.out.println("That was easy, wasn't it?"); } }); ... -- ... // initialize your logic here: all @FXML variables will have been injected myButton.setOnAction(new EventHandler<ActionEvent>() { @Override public void handle(ActionEvent event) { System.out.println("That was easy, wasn't it?"); } }); ... That's it - if you now compile everything in your IDE, and run your application, clicking on the button should print a message on the console! Summary What happens is that in Main.java, the FXMLLoader will load simple.fxml from the jar/classpath, as specified by 'FXMLLoader.load(Main.class.getResource("simple.fxml"))'. When loading simple.fxml, the loader will find the name of the controller class, as specified by 'fx:controller="simple.SimpleController"' in the FXML. Upon finding the name of the controller class, the loader will create an instance of that class, in which it will try to inject all the objects that have an fx:id in the FXML. Thus, after having created '<Button fx:id="myButton" ... />', the FXMLLoader will inject the button instance into the '@FXML private Button myButton;' instance variable found on the controller instance. This is because The instance variable has an @FXML annotation, The name of the variable exactly matches the value of the fx:id Finally, when the whole FXML has been loaded, the FXMLLoader will call the controller's initialize method, and our code that registers an action handler with the button will be executed. For a complete example, take a look at the HelloWorld SceneBuilder sample. Also make sure to follow the SceneBuilder Get Started guide, which will guide you through a much more complete example. Of course, there are more elegant ways to set up an Event Handler using FXML and SceneBuilder. There are also many different ways to work with the FXMLLoader. But since it's starting to be very late here, I think it will have to wait for another post. I hope you have enjoyed the tour! --daniel

    Read the article

  • Spritebatch drawing sprite with jagged borders

    - by Mutoh
    Alright, I've been on the making of a sprite class and a sprite sheet manager, but have come across this problem. Pretty much, the project is acting like so; for example: Let's take this .png image, with a transparent background. Note how it has alpha-transparent pixels around it in the lineart. Now, in the latter link's image, in the left (with CornflowerBlue background) it is shown the image drawn in another project (let's call it "Project1") with a simpler sprite class - there, it works. The right (with Purple background for differentiating) shows it drawn with a different class in "Project2" - where the problem manifests itself. This is the Sprite class of Project1: using System; using System.Collections.Generic; using System.Linq; using System.Text; using Microsoft.Xna.Framework; using Microsoft.Xna.Framework.Content; using Microsoft.Xna.Framework.Graphics; namespace WindowsGame2 { class Sprite { Vector2 pos = new Vector2(0, 0); Texture2D image; Rectangle size; float scale = 1.0f; // --- public float X { get { return pos.X; } set { pos.X = value; } } public float Y { get { return pos.Y; } set { pos.Y = value; } } public float Width { get { return size.Width; } } public float Height { get { return size.Height; } } public float Scale { get { return scale; } set { if (value < 0) value = 0; scale = value; if (image != null) { size.Width = (int)(image.Width * scale); size.Height = (int)(image.Height * scale); } } } // --- public void Load(ContentManager Man, string filename) { image = Man.Load<Texture2D>(filename); size = new Rectangle( 0, 0, (int)(image.Width * scale), (int)(image.Height * scale) ); } public void Become(Texture2D frame) { image = frame; size = new Rectangle( 0, 0, (int)(image.Width * scale), (int)(image.Height * scale) ); } public void Draw(SpriteBatch Desenhista) { // Desenhista.Draw(image, pos, Color.White); Desenhista.Draw( image, pos, new Rectangle( 0, 0, image.Width, image.Height ), Color.White, 0.0f, Vector2.Zero, scale, SpriteEffects.None, 0 ); } } } And this is the code in Project2, a rewritten, pretty much, version of the previous class. In this one I added sprite sheet managing and, in particular, removed Load and Become, to allow for static resources and only actual Sprites to be instantiated. using System; using System.Collections.Generic; using System.Linq; using System.Text; using Microsoft.Xna.Framework; using Microsoft.Xna.Framework.Content; using Microsoft.Xna.Framework.Graphics; namespace Mobby_s_Adventure { // Actually, I might desconsider this, and instead use static AnimationLocation[] and instanciated ID and Frame; // For determining the starting frame of an animation in a sheet and being able to iterate through // the Rectangles vector of the Sheet; class AnimationLocation { public int Location; public int FrameCount; // --- public AnimationLocation(int StartingRow, int StartingColumn, int SheetWidth, int NumberOfFrames) { Location = (StartingRow * SheetWidth) + StartingColumn; FrameCount = NumberOfFrames; } public AnimationLocation(int PositionInSheet, int NumberOfFrames) { Location = PositionInSheet; FrameCount = NumberOfFrames; } public static int CalculatePosition(int StartingRow, int StartingColumn, SheetManager Sheet) { return ((StartingRow * Sheet.Width) + StartingColumn); } } class Sprite { // The general stuff; protected SheetManager Sheet; protected Vector2 Position; public Vector2 Axis; protected Color _Tint; public float Angle; public float Scale; protected SpriteEffects _Effect; // --- // protected AnimationManager Animation; // For managing the animations; protected AnimationLocation[] Animation; public int AnimationID; protected int Frame; // --- // Properties for easy accessing of the position of the sprite; public float X { get { return Position.X; } set { Position.X = Axis.X + value; } } public float Y { get { return Position.Y; } set { Position.Y = Axis.Y + value; } } // --- // Properties for knowing the size of the sprite's frames public float Width { get { return Sheet.FrameWidth * Scale; } } public float Height { get { return Sheet.FrameHeight * Scale; } } // --- // Properties for more stuff; public Color Tint { set { _Tint = value; } } public SpriteEffects Effect { set { _Effect = value; } } public int FrameID { get { return Frame; } set { if (value >= (Animation[AnimationID].FrameCount)) value = 0; Frame = value; } } // --- // The only things that will be constantly modified will be AnimationID and FrameID, anything else only // occasionally; public Sprite(SheetManager SpriteSheet, AnimationLocation[] Animations, Vector2 Location, Nullable<Vector2> Origin = null) { // Assign the sprite's sprite sheet; // (Passed by reference! To allow STATIC sheets!) Sheet = SpriteSheet; // Define the animations that the sprite has available; // (Passed by reference! To allow STATIC animation boundaries!) Animation = Animations; // Defaulting some numerical values; Angle = 0.0f; Scale = 1.0f; _Tint = Color.White; _Effect = SpriteEffects.None; // If the user wants a default Axis, it is set in the middle of the frame; if (Origin != null) Axis = Origin.Value; else Axis = new Vector2( Sheet.FrameWidth / 2, Sheet.FrameHeight / 2 ); // Now that we have the axis, we can set the position with no worries; X = Location.X; Y = Location.Y; } // Simply put, draw the sprite with all its characteristics; public void Draw(SpriteBatch Drafter) { Drafter.Draw( Sheet.Texture, Position, Sheet.Rectangles[Animation[AnimationID].Location + FrameID], // Find the rectangle which frames the wanted image; _Tint, Angle, Axis, Scale, _Effect, 0.0f ); } } } And, in any case, this is the SheetManager class found in the previous code: using System; using System.Collections.Generic; using System.Linq; using System.Text; using Microsoft.Xna.Framework; using Microsoft.Xna.Framework.Content; using Microsoft.Xna.Framework.Graphics; namespace Mobby_s_Adventure { class SheetManager { protected Texture2D SpriteSheet; // For storing the sprite sheet; // Number of rows and frames in each row in the SpriteSheet; protected int NumberOfRows; protected int NumberOfColumns; // Size of a single frame; protected int _FrameWidth; protected int _FrameHeight; public Rectangle[] Rectangles; // For storing each frame; // --- public int Width { get { return NumberOfColumns; } } public int Height { get { return NumberOfRows; } } // --- public int FrameWidth { get { return _FrameWidth; } } public int FrameHeight { get { return _FrameHeight; } } // --- public Texture2D Texture { get { return SpriteSheet; } } // --- public SheetManager (Texture2D Texture, int Rows, int FramesInEachRow) { // Normal assigning SpriteSheet = Texture; NumberOfRows = Rows; NumberOfColumns = FramesInEachRow; _FrameHeight = Texture.Height / NumberOfRows; _FrameWidth = Texture.Width / NumberOfColumns; // Framing everything Rectangles = new Rectangle[NumberOfRows * NumberOfColumns]; int ID = 0; for (int i = 0; i < NumberOfRows; i++) { for (int j = 0; j < NumberOfColumns; j++) { Rectangles[ID] = new Rectangle ( _FrameWidth * j, _FrameHeight * i, _FrameWidth, _FrameHeight ); ID++; } } } public SheetManager (Texture2D Texture, int NumberOfFrames): this(Texture, 1, NumberOfFrames) { } } } For even more comprehending, if needed, here is how the main code looks like (it's just messing with the class' capacities, nothing actually; the result is a disembodied feet walking in place animation on the top-left of the screen and a static axe nearby): using System; using System.Collections.Generic; using System.Linq; using Microsoft.Xna.Framework; using Microsoft.Xna.Framework.Audio; using Microsoft.Xna.Framework.Content; using Microsoft.Xna.Framework.GamerServices; using Microsoft.Xna.Framework.Graphics; using Microsoft.Xna.Framework.Input; using Microsoft.Xna.Framework.Media; using System.Threading; namespace Mobby_s_Adventure { /// <summary> /// This is the main type for your game /// </summary> public class Game1 : Microsoft.Xna.Framework.Game { GraphicsDeviceManager graphics; SpriteBatch spriteBatch; static List<Sprite> ToDraw; static Texture2D AxeSheet; static Texture2D FeetSheet; static SheetManager Axe; static Sprite Jojora; static AnimationLocation[] Hack = new AnimationLocation[1]; static SheetManager Feet; static Sprite Mutoh; static AnimationLocation[] FeetAnimations = new AnimationLocation[2]; public Game1() { graphics = new GraphicsDeviceManager(this); Content.RootDirectory = "Content"; this.TargetElapsedTime = TimeSpan.FromMilliseconds(100); this.IsFixedTimeStep = true; } /// <summary> /// Allows the game to perform any initialization it needs to before starting to run. /// This is where it can query for any required services and load any non-graphic /// related content. Calling base.Initialize will enumerate through any components /// and initialize them as well. /// </summary> protected override void Initialize() { // TODO: Add your initialization logic here base.Initialize(); } /// <summary> /// LoadContent will be called once per game and is the place to load /// all of your content. /// </summary> protected override void LoadContent() { // Create a new SpriteBatch, which can be used to draw textures. spriteBatch = new SpriteBatch(GraphicsDevice); // Loading logic ToDraw = new List<Sprite>(); AxeSheet = Content.Load<Texture2D>("Sheet"); FeetSheet = Content.Load<Texture2D>("Feet Sheet"); Axe = new SheetManager(AxeSheet, 1); Hack[0] = new AnimationLocation(0, 1); Jojora = new Sprite(Axe, Hack, new Vector2(100, 100), new Vector2(5, 55)); Jojora.AnimationID = 0; Jojora.FrameID = 0; Feet = new SheetManager(FeetSheet, 8); FeetAnimations[0] = new AnimationLocation(1, 7); FeetAnimations[1] = new AnimationLocation(0, 1); Mutoh = new Sprite(Feet, FeetAnimations, new Vector2(0, 0)); Mutoh.AnimationID = 0; Mutoh.FrameID = 0; } /// <summary> /// UnloadContent will be called once per game and is the place to unload /// all content. /// </summary> protected override void UnloadContent() { // TODO: Unload any non ContentManager content here } /// <summary> /// Allows the game to run logic such as updating the world, /// checking for collisions, gathering input, and playing audio. /// </summary> /// <param name="gameTime">Provides a snapshot of timing values.</param> protected override void Update(GameTime gameTime) { // Allows the game to exit if (GamePad.GetState(PlayerIndex.One).Buttons.Back == ButtonState.Pressed) this.Exit(); // Update logic Mutoh.FrameID++; ToDraw.Add(Mutoh); ToDraw.Add(Jojora); base.Update(gameTime); } /// <summary> /// This is called when the game should draw itself. /// </summary> /// <param name="gameTime">Provides a snapshot of timing values.</param> protected override void Draw(GameTime gameTime) { GraphicsDevice.Clear(Color.Purple); // Drawing logic spriteBatch.Begin(); foreach (Sprite Element in ToDraw) { Element.Draw(spriteBatch); } spriteBatch.Draw(Content.Load<Texture2D>("Sheet"), new Rectangle(50, 50, 55, 60), Color.White); spriteBatch.End(); base.Draw(gameTime); } } } Please help me find out what I'm overlooking! One thing that I have noticed and could aid is that, if inserted the equivalent of this code spriteBatch.Draw( Content.Load<Texture2D>("Image Location"), new Rectangle(X, Y, images width, height), Color.White ); in Project2's Draw(GameTime) of the main loop, it works. EDIT Ok, even if the matter remains unsolved, I have made some more progress! As you see, I managed to get the two kinds of rendering in the same project (the aforementioned Project2, with the more complex Sprite class). This was achieved by adding the following code to Draw(GameTime): protected override void Draw(GameTime gameTime) { GraphicsDevice.Clear(Color.Purple); // Drawing logic spriteBatch.Begin(); foreach (Sprite Element in ToDraw) { Element.Draw(spriteBatch); } // Starting here spriteBatch.Draw( Axe.Texture, new Vector2(65, 100), new Rectangle ( 0, 0, Axe.FrameWidth, Axe.FrameHeight ), Color.White, 0.0f, new Vector2(0, 0), 1.0f, SpriteEffects.None, 0.0f ); // Ending here spriteBatch.End(); base.Draw(gameTime); } (Supposing that Axe is the SheetManager containing the texture, sorry if the "jargons" of my code confuse you :s) Thus, I have noticed that the problem is within the Sprite class. But I only get more clueless, because even after modifying its Draw function to this: public void Draw(SpriteBatch Drafter) { /*Drafter.Draw( Sheet.Texture, Position, Sheet.Rectangles[Animation[AnimationID].Location + FrameID], // Find the rectangle which frames the wanted image; _Tint, Angle, Axis, Scale, _Effect, 0.0f );*/ Drafter.Draw( Sheet.Texture, Position, new Rectangle( 0, 0, Sheet.FrameWidth, Sheet.FrameHeight ), Color.White, 0.0f, Vector2.Zero, Scale, SpriteEffects.None, 0 ); } to make it as simple as the patch of code that works, it still draws the sprite jaggedly!

    Read the article

  • HttpTransportSE requestDump gives NullPointerException

    - by Chamila
    Hi, I'm trying to access a webservice in Android via Ksoap2 for android. The SoapObject is created ok, the S.o.p of the bodyOut outputs the desired strings. But when I do a requestDump of the HttpTransportSE object I create to make the call, a NullPointerException happens. In other words, the transport object is null. How can this happen? Web Service is at http://srilanka.lk:9080/services/CropServiceProxy?wsdl This service works very well with SoapUI. SoapUI Request <soap:Envelope xmlns:soap="http://www.w3.org/2003/05/soap-envelope" xmlns:v1="http://schemas.icta.lk/xsd/crop/handler/v1/"> <soap:Header/> <soap:Body> <v1:getCropDataList> <v1:code>ABK</v1:code> </v1:getCropDataList> </soap:Body> </soap:Envelope> SoapUI Response <soapenv:Envelope xmlns:soapenv="http://www.w3.org/2003/05/soap-envelope"> <soapenv:Body> <ns1:getCropDataListResponse xmlns:ns1="http://schemas.icta.lk/xsd/crop/handler/v1/"> <ns1:cropInfo> <ns1:name>Ambul Kesel</ns1:name> <ns1:price>35.0</ns1:price> <ns1:location>Dambulla</ns1:location> </ns1:cropInfo> <ns1:cropInfo> <ns1:name>Ambul Kesel</ns1:name> <ns1:price>40.0</ns1:price> <ns1:location>Dambulla</ns1:location> </ns1:cropInfo> </ns1:getCropDataListResponse> </soapenv:Body> </soapenv:Envelope> Client Side Complex Type KvmSerializable implementation public class CropInfo implements KvmSerializable { private String name; private float price; private String location; @Override public Object getProperty(int arg0) { switch (arg0){ case 0: return name; case 1: return price; case 2: return location; default: return null; } } @Override public int getPropertyCount() { return 3; } @Override public void getPropertyInfo(int arg0, Hashtable arg1, PropertyInfo arg2) { switch (arg0){ case 0: arg2.type = PropertyInfo.STRING_CLASS; arg2.name = "Name"; break; case 1: arg2.type = Float.class; arg2.name = "Price"; break; case 2: arg2.type = PropertyInfo.STRING_CLASS; arg2.name = "Location"; break; default: break; } } @Override public void setProperty(int arg0, Object arg1) { switch(arg0){ case 0: name = arg1.toString(); break; case 1: price = Float.parseFloat(arg1.toString()); case 2: location = arg1.toString(); default: break; } } } Web Service Call public void btnOnClick(View v){ String NAMESPACE = "http://schemas.icta.lk/xsd/crop/handler/v1/"; String URL = "http://220.247.225.202:9080/services/CropServiceProxy.CropServiceProxyHttpSoap12Endpoint"; String method_name = "getCropDataList"; String SOAP_ACTION = "http://schemas.icta.lk/xsd/crop/handler/v1/getCropDataList"; SoapObject soap_request = new SoapObject(NAMESPACE, method_name); soap_request.addProperty("code", "ABK" ); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope(SoapEnvelope.VER12); envelope.setOutputSoapObject(soap_request); envelope.addMapping(NAMESPACE, "cropInfo", CropInfo.class); //envelope.dotNet=true; Marshal floatMarshal = new MarshalFloat(); floatMarshal.register(envelope); System.out.println("body out : " + envelope.bodyOut.toString()); //AndroidHttpTransport http_transport = new AndroidHttpTransport(URL); HttpTransportSE http_transport = new HttpTransportSE(URL); try { //NullPointerException HERE System.out.println(http_transport.requestDump); http_transport.call(SOAP_ACTION, envelope); //because we should expect a vector, two kinds of prices are given Vector<CropInfo> result_array = (Vector<CropInfo>)envelope.getResponse(); if(result_array != null){ for (CropInfo current_crop: result_array){ System.out.println(current_crop.getName()); System.out.println(Float.toString(current_crop.getPrice())); } } } catch (Exception e) { e.printStackTrace(); answer.setText("error caught"); //System.out.println(http_transport.responseDump); } // String result_string[] = (String[])result; //answer.setText("returned"); } Can anyone explain this?

    Read the article

  • Animation issue caused by C# parameters passed by reference rather than value, but where?

    - by Jordan Roher
    I'm having trouble with sprite animation in XNA that appears to be caused by a struct passed as a reference value. But I'm not using the ref keyword anywhere. I am, admittedly, a C# noob, so there may be some shallow bonehead error in here, but I can't see it. I'm creating 10 ants or bees and animating them as they move across the screen. I have an array of animation structs, and each time I create an ant or bee, I send it the animation array value it requires (just [0] or [1] at this time). Deep inside the animation struct is a timer that is used to change frames. The ant/bee class stores the animation struct as a private variable. What I'm seeing is that each ant or bee uses the same animation struct, the one I thought I was passing in and copying by value. So during Update(), when I advance the animation timer for each ant/bee, the next ant/bee has its animation timer advanced by that small amount. If there's 1 ant on screen, it animates properly. 2 ants, it runs twice as fast, and so on. Obviously, not what I want. Here's an abridged version of the code. How is BerryPicking's ActorAnimationGroupData[] getting shared between the BerryCreatures? class BerryPicking { private ActorAnimationGroupData[] animations; private BerryCreature[] creatures; private Dictionary<string, Texture2D> creatureTextures; private const int maxCreatures = 5; public BerryPickingExample() { this.creatures = new BerryCreature[maxCreatures]; this.creatureTextures = new Dictionary<string, Texture2D>(); } public void LoadContent() { // Returns data from an XML file Reader reader = new Reader(); animations = reader.LoadAnimations(); CreateCreatures(); } // This is called from another function I'm not including because it's not relevant to the problem. // In it, I remove any creature that passes outside the viewport by setting its creatures[] spot to null. // Hence the if(creatures[i] == null) test is used to recreate "dead" creatures. Inelegant, I know. private void CreateCreatures() { for (int i = 0; i < creatures.Length; i++) { if (creatures[i] == null) { // In reality, the name selection is randomized creatures[i] = new BerryCreature("ant"); // Load content and texture (which I create elsewhere) creatures[i].LoadContent( FindAnimation(creatures[i].Name), creatureTextures[creatures[i].Name]); } } } private ActorAnimationGroupData FindAnimation(string animationName) { int yourAnimation = -1; for (int i = 0; i < animations.Length; i++) { if (animations[i].name == animationName) { yourAnimation = i; break; } } return animations[yourAnimation]; } public void Update(GameTime gameTime) { for (int i = 0; i < creatures.Length; i++) { creatures[i].Update(gameTime); } } } class Reader { public ActorAnimationGroupData[] LoadAnimations() { ActorAnimationGroupData[] animationGroup; XmlReader file = new XmlTextReader(filename); // Do loading... // Then later file.Close(); return animationGroup; } } class BerryCreature { private ActorAnimation animation; private string name; public BerryCreature(string name) { this.name = name; } public void LoadContent(ActorAnimationGroupData animationData, Texture2D sprite) { animation = new ActorAnimation(animationData); animation.LoadContent(sprite); } public void Update(GameTime gameTime) { animation.Update(gameTime); } } class ActorAnimation { private ActorAnimationGroupData animation; public ActorAnimation(ActorAnimationGroupData animation) { this.animation = animation; } public void LoadContent(Texture2D sprite) { this.sprite = sprite; } public void Update(GameTime gameTime) { animation.Update(gameTime); } } struct ActorAnimationGroupData { // There are lots of other members of this struct, but the timer is the only one I'm worried about. // TimerData is another struct private TimerData timer; public ActorAnimationGroupData() { timer = new TimerData(2); } public void Update(GameTime gameTime) { timer.Update(gameTime); } } struct TimerData { public float currentTime; public float maxTime; public TimerData(float maxTime) { this.currentTime = 0; this.maxTime = maxTime; } public void Update(GameTime gameTime) { currentTime += (float)gameTime.ElapsedGameTime.TotalSeconds; if (currentTime >= maxTime) { currentTime = maxTime; } } }

    Read the article

  • PHP submit problem

    - by TaG
    I'm trying to check if the username is available and display it for the user to see when they check there account settings, which I have done. BUT when the user tries to fill out another field I get the Your username is unavailable! which should not pop up because its the users username already. I want to know how can I fix this problem using PHP so that the users name is displayed every time the user views their account settings and it wont cause problems when a user submits additional info? Here is the PHP code. if (isset($_POST['submitted'])) { require_once '../htmlpurifier/library/HTMLPurifier.auto.php'; $config = HTMLPurifier_Config::createDefault(); $config->set('Core.Encoding', 'UTF-8'); $config->set('HTML.Doctype', 'XHTML 1.0 Strict'); $config->set('HTML.TidyLevel', 'heavy'); $config->set('HTML.SafeObject', true); $config->set('HTML.SafeEmbed', true); $purifier = new HTMLPurifier($config); $mysqli = mysqli_connect("localhost", "root", "", "sitename"); $dbc = mysqli_query($mysqli,"SELECT users.* FROM users WHERE user_id=3"); $first_name = mysqli_real_escape_string($mysqli, $purifier->purify(htmlentities(strip_tags($_POST['first_name'])))); $username = mysqli_real_escape_string($mysqli, $purifier->purify(htmlentities(strip_tags($_POST['username'])))); if($_POST['username']) { $u = "SELECT user_id FROM users WHERE username = '$username'"; $r = mysqli_query ($mysqli, $u) or trigger_error("Query: $q\n<br />MySQL Error: " . mysqli_error($mysqli)); if (mysqli_num_rows($r) == TRUE) { $username = NULL; echo '<p class="error">Your username is unavailable!</p>'; } else if(mysqli_num_rows($r) == 0) { $username = mysqli_real_escape_string($mysqli, $purifier->purify(htmlentities(strip_tags($_POST['username'])))); if ($_POST['password1'] == $_POST['password2']) { $sha512 = hash('sha512', $_POST['password1']); $password = mysqli_real_escape_string($mysqli, $purifier->purify(strip_tags($sha512))); } else { $password = NULL; } if($password == NULL) { echo '<p class="error">Your password did not match the confirmed password!</p>'; } else { if (mysqli_num_rows($dbc) == 0) { $mysqli = mysqli_connect("localhost", "root", "", "sitename"); $dbc = mysqli_query($mysqli,"INSERT INTO users (user_id, first_name, username, password) VALUES ('$user_id', '$first_name', '$username', '$password')"); } if ($dbc == TRUE) { $dbc = mysqli_query($mysqli,"UPDATE users SET first_name = '$first_name', username = '$username', password = '$password' WHERE user_id = '$user_id'"); echo '<p class="changes-saved">Your changes have been saved!</p>'; } if (!$dbc) { print mysqli_error($mysqli); return; } } } } } Here is the html form. <form method="post" action="index.php"> <fieldset> <ul> <li><label for="first_name">First Name: </label><input type="text" name="first_name" id="first_name" size="25" class="input-size" value="<?php if (isset($_POST['first_name'])) { echo stripslashes(htmlentities(strip_tags($_POST['first_name']))); } else if(!empty($first_name)) { echo stripslashes(htmlentities(strip_tags($first_name))); } ?>" /></li> <li><label for="username">UserName: </label><input type="text" name="username" id="username" size="25" class="input-size" value="<?php if (isset($_POST['username'])) { echo stripslashes(htmlentities(strip_tags($_POST['username']))); } else if(!empty($username)) { echo stripslashes(htmlentities(strip_tags($username))); } ?>" /><br /><span>(ex: CSSKing, butterball)</span></li> <li><label for="password1">Password: </label><input type="password" name="password1" id="password1" size="25" class="input-size" value="<?php if (isset($_POST['password1'])) { echo stripslashes(htmlentities(strip_tags($_POST['password1']))); } ?>" /></li> <li><label for="password2">Confirm Password: </label><input type="password" name="password2" id="password2" size="25" class="input-size" value="<?php if (isset($_POST['password2'])) { echo stripslashes(htmlentities(strip_tags($_POST['password2']))); } ?>" /></li> <li><input type="submit" name="submit" value="Save Changes" class="save-button" /> <input type="hidden" name="submitted" value="true" /> <input type="submit" name="submit" value="Preview Changes" class="preview-changes-button" /></li> </ul> </fieldset> </form>

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Anyone succeeded at injecting Interfaces into Entity Framework 4 Entities, using T4?

    - by Ciel
    Hello: POCO sort of leaves me wanting: (how can I say I use DI/IoC, if the Repository is not the only place that is creating the entities?)...hence my desire to lock it down, get rid of the temptation of newing up POCOs or EntityObjects anywhere in the code, and just allowing entity interfaces above the Repository/Factory layer. For a second there, I nearly thought I had it...was editing EF4's T4 in order to inject in an Interface def. Was going swimmingly, compiled and worked, until I got to the Associations... I wrapped them with a ICollection, and renamed the underlying original collection with a prefix of Wrapped. Unfortunately, when run, throws an error: //The Member 'WrappedSubExamples' in the CLR type 'XAct.App.Data.Model.EF4.Example' is not present in the conceptual model type 'XAct.App.Data.Model.Entity.Example'. var examples = context2.CreateObjectSet(); My T4 segment I used was (this may not work, as it's the longest code snippet I've ever posted here...sorry): #region Generic Property Abstraction <# if (navProperty.ToEndMember.RelationshipMultiplicity == RelationshipMultiplicity.Many) {#> //XAct.App Generic Wrapper: <#=code.SpaceAfter(NewModifier(navProperty))#><#=Accessibility.ForProperty(navProperty)#> ICollection<I<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>> <#=code.Escape(navProperty)#> { get { if (_X<#=code.Escape(navProperty)# == null){ _X<#=code.Escape(navProperty)# = new WrappedCollection,<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#(this.<#=(navProperty.ToEndMember.RelationshipMultiplicity == RelationshipMultiplicity.Many)?"Wrapped":""#<#=code.Escape(navProperty)#); } return _X<#=code.Escape(navProperty)#; } } private ICollection _X<#=code.Escape(navProperty)#; <# } else { # <#=code.SpaceAfter(NewModifier(navProperty))#<#=Accessibility.ForProperty(navProperty)# I<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)# <#=code.Escape(navProperty)# { get { return (I<#=code.Escape(navProperty)#)this.Wrapped<#=code.Escape(navProperty)#; } set { this.Wrapped<#=code.Escape(navProperty)# = value as <#=code.Escape(navProperty)#; } } <# } # #endregion which then wraps the original collection, renamed with the prefix 'Wrapped': /// <summary> /// <#=SummaryComment(navProperty)#> /// </summary><#=LongDescriptionCommentElement(navProperty, region.CurrentIndentLevel) #> [XmlIgnoreAttribute()] [SoapIgnoreAttribute()] [DataMemberAttribute()] [EdmRelationshipNavigationPropertyAttribute("<#=navProperty.RelationshipType.NamespaceName#>", "<#=navProperty.RelationshipType.Name#>", "<#=navProperty.ToEndMember.Name#>")] <# if (navProperty.ToEndMember.RelationshipMultiplicity == RelationshipMultiplicity.Many) { #> <#=code.SpaceAfter(NewModifier(navProperty))#><#=Accessibility.ForProperty(navProperty)#> EntityCollection<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>> Wrapped<#=code.Escape(navProperty)#> { <#=code.SpaceAfter(Accessibility.ForGetter(navProperty))#>get { return ((IEntityWithRelationships)this).RelationshipManager.GetRelatedCollection<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>"); } <#=code.SpaceAfter(Accessibility.ForSetter(navProperty))#>set { if ((value != null)) { ((IEntityWithRelationships)this).RelationshipManager.InitializeRelatedCollection<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>", value); } } } <# } else { #> <#=code.SpaceAfter(NewModifier(navProperty))#><#=Accessibility.ForProperty(navProperty)#> <#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#> Wrapped<#=code.Escape(navProperty)#> { <#=code.SpaceAfter(Accessibility.ForGetter(navProperty))#>get { return ((IEntityWithRelationships)this).RelationshipManager.GetRelatedReference<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>").Value; } <#=code.SpaceAfter(Accessibility.ForSetter(navProperty))#>set { ((IEntityWithRelationships)this).RelationshipManager.GetRelatedReference<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>").Value = value; } } <# string refPropertyName = navProperty.Name + "Reference"; if (entity.Members.Any(m => m.Name == refPropertyName)) { // 6017 is the same error number that EntityClassGenerator uses. Errors.Add(new System.CodeDom.Compiler.CompilerError(SourceCsdlPath, -1, -1, "6017", String.Format(CultureInfo.CurrentCulture, GetResourceString("Template_ConflictingGeneratedNavPropName"), navProperty.Name, entity.FullName, refPropertyName))); } #> /// <summary> /// <#=SummaryComment(navProperty)#> /// </summary><#=LongDescriptionCommentElement(navProperty, region.CurrentIndentLevel)#> [BrowsableAttribute(false)] [DataMemberAttribute()] <#=Accessibility.ForProperty(navProperty)#> EntityReference<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>> <#=refPropertyName#> { <#=code.SpaceAfter(Accessibility.ForGetter(navProperty))#>get { return ((IEntityWithRelationships)this).RelationshipManager.GetRelatedReference<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>"); } <#=code.SpaceAfter(Accessibility.ForSetter(navProperty))#>set { if ((value != null)) { ((IEntityWithRelationships)this).RelationshipManager.InitializeRelatedReference<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>", value); } } } <# } The point is...it bugs out. I've tried various solutions...none worked. Any ideas -- or is this just a wild goose chase, and time to give it up?

    Read the article

< Previous Page | 409 410 411 412 413 414 415 416 417 418 419 420  | Next Page >