Search Results

Search found 20401 results on 817 pages for 'null coalescing operator'.

Page 416/817 | < Previous Page | 412 413 414 415 416 417 418 419 420 421 422 423  | Next Page >

  • PCF shadow shader math causing artifacts

    - by user2971069
    For a while now I used PCSS for my shadow technique of choice until I discovered a type of percentage closer filtering. This method creates really smooth shadows and with hopes of improving performance, with only a fraction of texture samples, I tried to implement PCF into my shader. This is the relevant code: float c0, c1, c2, c3; float f = blurFactor; float2 coord = ProjectedTexCoords; if (receiverDistance - tex2D(lightSampler, coord + float2(0, 0)).x > 0.0007) c0 = 1; if (receiverDistance - tex2D(lightSampler, coord + float2(f, 0)).x > 0.0007) c1 = 1; if (receiverDistance - tex2D(lightSampler, coord + float2(0, f)).x > 0.0007) c2 = 1; if (receiverDistance - tex2D(lightSampler, coord + float2(f, f)).x > 0.0007) c3 = 1; coord = (coord % f) / f; return 1 - (c0 * (1 - coord.x) * (1 - coord.y) + c1 * coord.x * (1 - coord.y) + c2 * (1 - coord.x) * coord.y + c3 * coord.x * coord.y); This is a very basic implementation. blurFactor is initialized with 1 / LightTextureSize. So the if statements fetch the occlusion values for the four adjacent texels. I now want to weight each value based on the actual position of the texture coordinate. If it's near the bottom-right pixel, that occlusion value should be preferred. The weighting itself is done with a simple bilinear interpolation function, however this function takes a 2d vector in the range [0..1] so I have to convert my texture coordinate to get the distance from my first pixel to the second one in range [0..1]. For that I used the mod operator to get it into [0..f] range and then divided by f. This code makes sense to me, and for specific blurFactors it works, producing really smooth one pixel wide shadows, but not for all blurFactors. Initially blurFactor is (1 / LightTextureSize) to sample the 4 adjacent texels. I now want to increase the blurFactor by factor x to get a smooth interpolation across maybe 4 or so pixels. But that is when weird artifacts show up. Here is an image: Using a 1x on blurFactor produces a good result, 0.5 is as expected not so smooth. 2x however doesn't work at all. I found that only a factor of 1/2^n produces an good result, every other factor produces artifacts. I'm pretty sure the error lies here: coord = (coord % f) / f; Maybe the modulo is not calculated correctly? I have no idea how to fix that. Is it even possible for pixel that are further than 1 pixel away?

    Read the article

  • java: how to get a string representation of a compressed byte array ?

    - by Guillaume
    I want to put some compressed data into a remote repository. To put data on this repository I can only use a method that take the name of the resource and its content as a String. (like data.txt + "hello world"). The repository is moking a filesystem but is not, so I can not use File directly. I want to be able to do the following: client send to server a file 'data.txt' server compress 'data.txt' into a compressed file 'data.zip' server send a string representation of data.zip to the repository repository store data.zip client download from repository data.zip and his able to open it with its favorite zip tool The problem arise at step 3 when I try to get a string representation of my compressed file. Here is a sample class, using the zip*stream and that emulate the repository showcasing my problem. The created zip file is working, but after its 'serialization' it's get corrupted. (the sample class use jakarta commons.io ) Many thanks for your help. package zip; import java.io.File; import java.io.FileInputStream; import java.io.FileOutputStream; import java.io.IOException; import java.io.InputStream; import java.util.zip.ZipEntry; import java.util.zip.ZipInputStream; import java.util.zip.ZipOutputStream; import org.apache.commons.io.FileUtils; /** * Date: May 19, 2010 - 6:13:07 PM * * @author Guillaume AME. */ public class ZipMe { public static void addOrUpdate(File zipFile, File ... files) throws IOException { File tempFile = File.createTempFile(zipFile.getName(), null); // delete it, otherwise you cannot rename your existing zip to it. tempFile.delete(); boolean renameOk = zipFile.renameTo(tempFile); if (!renameOk) { throw new RuntimeException("could not rename the file " + zipFile.getAbsolutePath() + " to " + tempFile.getAbsolutePath()); } byte[] buf = new byte[1024]; ZipInputStream zin = new ZipInputStream(new FileInputStream(tempFile)); ZipOutputStream out = new ZipOutputStream(new FileOutputStream(zipFile)); ZipEntry entry = zin.getNextEntry(); while (entry != null) { String name = entry.getName(); boolean notInFiles = true; for (File f : files) { if (f.getName().equals(name)) { notInFiles = false; break; } } if (notInFiles) { // Add ZIP entry to output stream. out.putNextEntry(new ZipEntry(name)); // Transfer bytes from the ZIP file to the output file int len; while ((len = zin.read(buf)) > 0) { out.write(buf, 0, len); } } entry = zin.getNextEntry(); } // Close the streams zin.close(); // Compress the files if (files != null) { for (File file : files) { InputStream in = new FileInputStream(file); // Add ZIP entry to output stream. out.putNextEntry(new ZipEntry(file.getName())); // Transfer bytes from the file to the ZIP file int len; while ((len = in.read(buf)) > 0) { out.write(buf, 0, len); } // Complete the entry out.closeEntry(); in.close(); } // Complete the ZIP file } tempFile.delete(); out.close(); } public static void main(String[] args) throws IOException { final String zipArchivePath = "c:/temp/archive.zip"; final String tempFilePath = "c:/temp/data.txt"; final String resultZipFile = "c:/temp/resultingArchive.zip"; File zipArchive = new File(zipArchivePath); FileUtils.touch(zipArchive); File tempFile = new File(tempFilePath); FileUtils.writeStringToFile(tempFile, "hello world"); addOrUpdate(zipArchive, tempFile); //archive.zip exists and contains a compressed data.txt that can be read using winrar //now simulate writing of the zip into a in memory cache String archiveText = FileUtils.readFileToString(zipArchive); FileUtils.writeStringToFile(new File(resultZipFile), archiveText); //resultingArchive.zip exists, contains a compressed data.txt, but it can not //be read using winrar: CRC failed in data.txt. The file is corrupt } }

    Read the article

  • Jquery Live Function

    - by marharépa
    Hi! I want to make this script to work as LIVE() function. Please help me! $(".img img").each(function() { $(this).cjObjectScaler({ destElem: $(this).parent(), method: "fit" }); }); the cjObjectScaler script (called in the html header) is this: (thanks for Doug Jones) (function ($) { jQuery.fn.imagesLoaded = function (callback) { var elems = this.filter('img'), len = elems.length; elems.bind('load', function () { if (--len <= 0) { callback.call(elems, this); } }).each(function () { // cached images don't fire load sometimes, so we reset src. if (this.complete || this.complete === undefined) { var src = this.src; // webkit hack from http://groups.google.com/group/jquery-dev/browse_thread/thread/eee6ab7b2da50e1f this.src = '#'; this.src = src; } }); }; })(jQuery); /* CJ Object Scaler */ (function ($) { jQuery.fn.cjObjectScaler = function (options) { /* user variables (settings) ***************************************/ var settings = { // must be a jQuery object method: "fill", // the parent object to scale our object into destElem: null, // fit|fill fade: 0 // if positive value, do hide/fadeIn }; /* system variables ***************************************/ var sys = { // function parameters version: '2.1.1', elem: null }; /* scale the image ***************************************/ function scaleObj(obj) { // declare some local variables var destW = jQuery(settings.destElem).width(), destH = jQuery(settings.destElem).height(), ratioX, ratioY, scale, newWidth, newHeight, borderW = parseInt(jQuery(obj).css("borderLeftWidth"), 10) + parseInt(jQuery(obj).css("borderRightWidth"), 10), borderH = parseInt(jQuery(obj).css("borderTopWidth"), 10) + parseInt(jQuery(obj).css("borderBottomWidth"), 10), objW = jQuery(obj).width(), objH = jQuery(obj).height(); // check for valid border values. IE takes in account border size when calculating width/height so just set to 0 borderW = isNaN(borderW) ? 0 : borderW; borderH = isNaN(borderH) ? 0 : borderH; // calculate scale ratios ratioX = destW / jQuery(obj).width(); ratioY = destH / jQuery(obj).height(); // Determine which algorithm to use if (!jQuery(obj).hasClass("cf_image_scaler_fill") && (jQuery(obj).hasClass("cf_image_scaler_fit") || settings.method === "fit")) { scale = ratioX < ratioY ? ratioX : ratioY; } else if (!jQuery(obj).hasClass("cf_image_scaler_fit") && (jQuery(obj).hasClass("cf_image_scaler_fill") || settings.method === "fill")) { scale = ratioX < ratioY ? ratioX : ratioY; } // calculate our new image dimensions newWidth = parseInt(jQuery(obj).width() * scale, 10) - borderW; newHeight = parseInt(jQuery(obj).height() * scale, 10) - borderH; // Set new dimensions & offset jQuery(obj).css({ "width": newWidth + "px", "height": newHeight + "px"//, // "position": "absolute", // "top": (parseInt((destH - newHeight) / 2, 10) - parseInt(borderH / 2, 10)) + "px", // "left": (parseInt((destW - newWidth) / 2, 10) - parseInt(borderW / 2, 10)) + "px" }).attr({ "width": newWidth, "height": newHeight }); // do our fancy fade in, if user supplied a fade amount if (settings.fade > 0) { jQuery(obj).fadeIn(settings.fade); } } /* set up any user passed variables ***************************************/ if (options) { jQuery.extend(settings, options); } /* main ***************************************/ return this.each(function () { sys.elem = this; // if they don't provide a destObject, use parent if (settings.destElem === null) { settings.destElem = jQuery(sys.elem).parent(); } // need to make sure the user set the parent's position. Things go bonker's if not set. // valid values: absolute|relative|fixed if (jQuery(settings.destElem).css("position") === "static") { jQuery(settings.destElem).css({ "position": "relative" }); } // if our object to scale is an image, we need to make sure it's loaded before we continue. if (typeof sys.elem === "object" && typeof settings.destElem === "object" && typeof settings.method === "string") { // if the user supplied a fade amount, hide our image if (settings.fade > 0) { jQuery(sys.elem).hide(); } if (sys.elem.nodeName === "IMG") { // to fix the weird width/height caching issue we set the image dimensions to be auto; jQuery(sys.elem).width("auto"); jQuery(sys.elem).height("auto"); // wait until the image is loaded before scaling jQuery(sys.elem).imagesLoaded(function () { scaleObj(this); }); } else { scaleObj(jQuery(sys.elem)); } } else { console.debug("CJ Object Scaler could not initialize."); return; } }); }; })(jQuery);

    Read the article

  • Problems in php coding

    - by anwar
    Hi there everyone im new to PHP and Joomla and I have developed a component in Joomla but my code is giving me errors. I have tried to solve the problem but I’am unable to solve it. So can anyone suggest me what is the problem with my code? Thanks in advance. Here are my two files: 1st view.html.php defined('_JEXEC') or die('=;)'); jimport('joomla.application.component.view'); class namnamViewlistrestaurant extends JView { function display($tpl = null) { $item = 'item'; RestUser::RestrictDirectAccess(); //-- Custom css JHTML::stylesheet( 'style.css', 'components/com_namnam/assets/css/' ); $cuisine=Lookups::getLookup('cuisine'); $lists['cuisine'] = JHTML::_('select.genericlist', $cuisine, 'idcuisine[]', 'class="inputbox" size="7"', 'value', 'text', $item->idcuisine); $category=Lookups::getLookup('restcategory'); $lists['category'] = JHTML::_('select.genericlist', $category, 'idcategory[]', 'class="inputbox" multiple="multiple" size="7"', 'value', 'text', $item->idcategory); $items = & $this->get('Data'); $pagination =& $this->get('Pagination'); $lists = & $this->get('List'); $this->assignRef('items', $items); $this->assignRef('pagination', $pagination); $this->assignRef('lists', $lists); parent::display($tpl); }//function }//class And 2nd is listrestaurant.php defined('_JEXEC') or die('=;)'); jimport('joomla.application.component.model'); class namnamModellistrestaurant extends JModel { var $_data; var $_total = null; var $_pagination = null; function __construct() { parent::__construct(); global $mainframe, $option; $limit = $mainframe->getUserStateFromRequest( 'global.list.limit', 'limit', $mainframe->getCfg('list_limit'), 'int' ); $limitstart = $mainframe->getUserStateFromRequest( $option.'.limitstart', 'limitstart', 0, 'int' ); $limitstart = ($limit != 0 ? (floor($limitstart / $limit) * $limit) : 0); $this->setState('limit', $limit); $this->setState('limitstart', $limitstart); } function _buildQuery() { $where = array(); $where[]=" idowner=".RestUser::getUserID()." "; if ($this->search) { $where[] = 'LOWER(name) LIKE \''. $this->search. '\''; } $where =( count($where) ) ? ' WHERE ' . implode( ' AND ', $where ) : ''; $orderby = ''; #_ECR_MAT_FILTER_MODEL1_ if (($this->filter_order) && ($this->filter_order_Dir)) { $orderby = ' ORDER BY '. $this->filter_order .' '. $this->filter_order_Dir; } $this->_query = ' SELECT *' . ' FROM #__namnam_restaurants ' . $where . $orderby ; return $this->_query; } function getData() { if (empty($this->_data)) { $query = $this->_buildQuery(); $this->_data = $this->_getList($query, $this->getState('limitstart'), $this->getState('limit')); } return $this->_data; } function getList() { // table ordering $lists['order_Dir'] = $this->filter_order_Dir; $lists['order'] = $this->filter_order; // search filter $lists['search']= $this->search; return $lists; } function getTotal() { // Load the content if it doesn't already exist if (empty($this->_total)) { $query = $this->_buildQuery(); $this->_total = $this->_getListCount($query); } return $this->_total; } function getPagination() { // Load the content if it doesn't already exist if (empty($this->_pagination)) { jimport('joomla.html.pagination'); $this->_pagination = new JPagination($this->getTotal(), $this->getState('limitstart'), $this->getState('limit') ); } return $this->_pagination; } }//class And the errors are: Notice: Trying to get property of non-object in C:\wamp\www\namnam.com\components\com_namnam\views\listrestaurant\view.html.php on line 26 Notice: Trying to get property of non-object in C:\wamp\www\namnam.com\components\com_namnam\views\listrestaurant\view.html.php on line 29 Notice: Undefined property: namnamModellistrestaurant::$search in C:\wamp\www\namnam.com\components\com_namnam\models\listrestaurant.php on line 38 Notice: Undefined property: namnamModellistrestaurant::$filter_order in C:\wamp\www\namnam.com\components\com_namnam\models\listrestaurant.php on line 48 Notice: Undefined property: namnamModellistrestaurant::$search in C:\wamp\www\namnam.com\components\com_namnam\models\listrestaurant.php on line 38 Notice: Undefined property: namnamModellistrestaurant::$filter_order in C:\wamp\www\namnam.com\components\com_namnam\models\listrestaurant.php on line 48 Notice: Undefined property: namnamModellistrestaurant::$filter_order_Dir in C:\wamp\www\namnam.com\components\com_namnam\models\listrestaurant.php on line 76 Notice: Undefined property: namnamModellistrestaurant::$filter_order in C:\wamp\www\namnam.com\components\com_namnam\models\listrestaurant.php on line 77 Notice: Undefined property: namnamModellistrestaurant::$search in C:\wamp\www\namnam.com\components\com_namnam\models\listrestaurant.php on line 80

    Read the article

  • HttpTransportSE requestDump gives NullPointerException

    - by Chamila
    Hi, I'm trying to access a webservice in Android via Ksoap2 for android. The SoapObject is created ok, the S.o.p of the bodyOut outputs the desired strings. But when I do a requestDump of the HttpTransportSE object I create to make the call, a NullPointerException happens. In other words, the transport object is null. How can this happen? Web Service is at http://srilanka.lk:9080/services/CropServiceProxy?wsdl This service works very well with SoapUI. SoapUI Request <soap:Envelope xmlns:soap="http://www.w3.org/2003/05/soap-envelope" xmlns:v1="http://schemas.icta.lk/xsd/crop/handler/v1/"> <soap:Header/> <soap:Body> <v1:getCropDataList> <v1:code>ABK</v1:code> </v1:getCropDataList> </soap:Body> </soap:Envelope> SoapUI Response <soapenv:Envelope xmlns:soapenv="http://www.w3.org/2003/05/soap-envelope"> <soapenv:Body> <ns1:getCropDataListResponse xmlns:ns1="http://schemas.icta.lk/xsd/crop/handler/v1/"> <ns1:cropInfo> <ns1:name>Ambul Kesel</ns1:name> <ns1:price>35.0</ns1:price> <ns1:location>Dambulla</ns1:location> </ns1:cropInfo> <ns1:cropInfo> <ns1:name>Ambul Kesel</ns1:name> <ns1:price>40.0</ns1:price> <ns1:location>Dambulla</ns1:location> </ns1:cropInfo> </ns1:getCropDataListResponse> </soapenv:Body> </soapenv:Envelope> Client Side Complex Type KvmSerializable implementation public class CropInfo implements KvmSerializable { private String name; private float price; private String location; @Override public Object getProperty(int arg0) { switch (arg0){ case 0: return name; case 1: return price; case 2: return location; default: return null; } } @Override public int getPropertyCount() { return 3; } @Override public void getPropertyInfo(int arg0, Hashtable arg1, PropertyInfo arg2) { switch (arg0){ case 0: arg2.type = PropertyInfo.STRING_CLASS; arg2.name = "Name"; break; case 1: arg2.type = Float.class; arg2.name = "Price"; break; case 2: arg2.type = PropertyInfo.STRING_CLASS; arg2.name = "Location"; break; default: break; } } @Override public void setProperty(int arg0, Object arg1) { switch(arg0){ case 0: name = arg1.toString(); break; case 1: price = Float.parseFloat(arg1.toString()); case 2: location = arg1.toString(); default: break; } } } Web Service Call public void btnOnClick(View v){ String NAMESPACE = "http://schemas.icta.lk/xsd/crop/handler/v1/"; String URL = "http://220.247.225.202:9080/services/CropServiceProxy.CropServiceProxyHttpSoap12Endpoint"; String method_name = "getCropDataList"; String SOAP_ACTION = "http://schemas.icta.lk/xsd/crop/handler/v1/getCropDataList"; SoapObject soap_request = new SoapObject(NAMESPACE, method_name); soap_request.addProperty("code", "ABK" ); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope(SoapEnvelope.VER12); envelope.setOutputSoapObject(soap_request); envelope.addMapping(NAMESPACE, "cropInfo", CropInfo.class); //envelope.dotNet=true; Marshal floatMarshal = new MarshalFloat(); floatMarshal.register(envelope); System.out.println("body out : " + envelope.bodyOut.toString()); //AndroidHttpTransport http_transport = new AndroidHttpTransport(URL); HttpTransportSE http_transport = new HttpTransportSE(URL); try { //NullPointerException HERE System.out.println(http_transport.requestDump); http_transport.call(SOAP_ACTION, envelope); //because we should expect a vector, two kinds of prices are given Vector<CropInfo> result_array = (Vector<CropInfo>)envelope.getResponse(); if(result_array != null){ for (CropInfo current_crop: result_array){ System.out.println(current_crop.getName()); System.out.println(Float.toString(current_crop.getPrice())); } } } catch (Exception e) { e.printStackTrace(); answer.setText("error caught"); //System.out.println(http_transport.responseDump); } // String result_string[] = (String[])result; //answer.setText("returned"); } Can anyone explain this?

    Read the article

  • PHP submit problem

    - by TaG
    I'm trying to check if the username is available and display it for the user to see when they check there account settings, which I have done. BUT when the user tries to fill out another field I get the Your username is unavailable! which should not pop up because its the users username already. I want to know how can I fix this problem using PHP so that the users name is displayed every time the user views their account settings and it wont cause problems when a user submits additional info? Here is the PHP code. if (isset($_POST['submitted'])) { require_once '../htmlpurifier/library/HTMLPurifier.auto.php'; $config = HTMLPurifier_Config::createDefault(); $config->set('Core.Encoding', 'UTF-8'); $config->set('HTML.Doctype', 'XHTML 1.0 Strict'); $config->set('HTML.TidyLevel', 'heavy'); $config->set('HTML.SafeObject', true); $config->set('HTML.SafeEmbed', true); $purifier = new HTMLPurifier($config); $mysqli = mysqli_connect("localhost", "root", "", "sitename"); $dbc = mysqli_query($mysqli,"SELECT users.* FROM users WHERE user_id=3"); $first_name = mysqli_real_escape_string($mysqli, $purifier->purify(htmlentities(strip_tags($_POST['first_name'])))); $username = mysqli_real_escape_string($mysqli, $purifier->purify(htmlentities(strip_tags($_POST['username'])))); if($_POST['username']) { $u = "SELECT user_id FROM users WHERE username = '$username'"; $r = mysqli_query ($mysqli, $u) or trigger_error("Query: $q\n<br />MySQL Error: " . mysqli_error($mysqli)); if (mysqli_num_rows($r) == TRUE) { $username = NULL; echo '<p class="error">Your username is unavailable!</p>'; } else if(mysqli_num_rows($r) == 0) { $username = mysqli_real_escape_string($mysqli, $purifier->purify(htmlentities(strip_tags($_POST['username'])))); if ($_POST['password1'] == $_POST['password2']) { $sha512 = hash('sha512', $_POST['password1']); $password = mysqli_real_escape_string($mysqli, $purifier->purify(strip_tags($sha512))); } else { $password = NULL; } if($password == NULL) { echo '<p class="error">Your password did not match the confirmed password!</p>'; } else { if (mysqli_num_rows($dbc) == 0) { $mysqli = mysqli_connect("localhost", "root", "", "sitename"); $dbc = mysqli_query($mysqli,"INSERT INTO users (user_id, first_name, username, password) VALUES ('$user_id', '$first_name', '$username', '$password')"); } if ($dbc == TRUE) { $dbc = mysqli_query($mysqli,"UPDATE users SET first_name = '$first_name', username = '$username', password = '$password' WHERE user_id = '$user_id'"); echo '<p class="changes-saved">Your changes have been saved!</p>'; } if (!$dbc) { print mysqli_error($mysqli); return; } } } } } Here is the html form. <form method="post" action="index.php"> <fieldset> <ul> <li><label for="first_name">First Name: </label><input type="text" name="first_name" id="first_name" size="25" class="input-size" value="<?php if (isset($_POST['first_name'])) { echo stripslashes(htmlentities(strip_tags($_POST['first_name']))); } else if(!empty($first_name)) { echo stripslashes(htmlentities(strip_tags($first_name))); } ?>" /></li> <li><label for="username">UserName: </label><input type="text" name="username" id="username" size="25" class="input-size" value="<?php if (isset($_POST['username'])) { echo stripslashes(htmlentities(strip_tags($_POST['username']))); } else if(!empty($username)) { echo stripslashes(htmlentities(strip_tags($username))); } ?>" /><br /><span>(ex: CSSKing, butterball)</span></li> <li><label for="password1">Password: </label><input type="password" name="password1" id="password1" size="25" class="input-size" value="<?php if (isset($_POST['password1'])) { echo stripslashes(htmlentities(strip_tags($_POST['password1']))); } ?>" /></li> <li><label for="password2">Confirm Password: </label><input type="password" name="password2" id="password2" size="25" class="input-size" value="<?php if (isset($_POST['password2'])) { echo stripslashes(htmlentities(strip_tags($_POST['password2']))); } ?>" /></li> <li><input type="submit" name="submit" value="Save Changes" class="save-button" /> <input type="hidden" name="submitted" value="true" /> <input type="submit" name="submit" value="Preview Changes" class="preview-changes-button" /></li> </ul> </fieldset> </form>

    Read the article

  • problem in displaying list using array adapters

    - by Rahul Varma
    Hi, I am trying to display the list of songs using array adapters. But the problem is i couldnt display the list and only empty screen with preset background is showing up. Here's the code...All the thee are seperate classes... Plz help me... public class SongsAdapter extends ArrayAdapter<SongsList>{ private Context context; TextView tvTitle; TextView tvMovie; TextView tvSinger; String s; public SongsAdapter(Context context, int resource, int textViewResourceId, String title) { super(context, resource, textViewResourceId); this.context=context; } public View getView(int position, View convertView, ViewGroup parent) { final int i=position; List<SongsList> listSongs = new ArrayList<SongsList>(); String title = listSongs.get(i).gettitleName().toString(); String album = listSongs.get(i).getmovieName().toString(); String artist = listSongs.get(i).getsingerName().toString(); String imgal = listSongs.get(i).gettitleName().toString(); LayoutInflater inflater = ((Activity) context).getLayoutInflater(); View v = inflater.inflate(R.layout.row, null); tvTitle=(TextView)v.findViewById(R.id.text2); tvMovie=(TextView)v.findViewById(R.id.text3); tvSinger=(TextView)v.findViewById(R.id.text1); tvTitle.setText(title); tvMovie.setText(album); tvSinger.setText(artist); final ImageView im=(ImageView)v.findViewById(R.id.image); s="http://www.gorinka.com/"+imgal; String imgPath=s; AsyncImageLoaderv asyncImageLoaderv=new AsyncImageLoaderv(); Bitmap cachedImage = asyncImageLoaderv.loadDrawable(imgPath, new AsyncImageLoaderv.ImageCallback() { public void imageLoaded(Bitmap imageDrawable, String imageUrl) { im.setImageBitmap(imageDrawable); } }); im.setImageBitmap(cachedImage); return v; } public class imageloader implements Runnable{ private String ss; private ImageView im; public imageloader(String s, ImageView im) { this.ss=s; this.im=im; Thread thread = new Thread(this); thread.start(); } public void run(){ try { HttpGet httpRequest = null; httpRequest = new HttpGet(ss); HttpClient httpclient = new DefaultHttpClient(); HttpResponse response = (HttpResponse) httpclient.execute(httpRequest); HttpEntity entity = response.getEntity(); BufferedHttpEntity bufHttpEntity = new BufferedHttpEntity(entity); InputStream is = bufHttpEntity.getContent(); Bitmap bm = BitmapFactory.decodeStream(is); Log.d("img","img"); is.close(); im.setImageBitmap(bm); } catch (Exception t) { Log.e("bitmap url", "Exception in updateStatus()", t); } } } } public class SongsList { private String titleName; private String movieName; private String singerName; private String imagePath; private String mediaPath; // Constructor for the SongsList class public SongsList(String titleName, String movieName, String singerName,String imagePath,String mediaPath ) { super(); this.titleName = titleName; this.movieName = movieName; this.singerName = singerName; this.imagePath = imagePath; this.mediaPath = mediaPath; } public String gettitleName() { return titleName; } public void settitleName(String titleName) { this.titleName = titleName; } public String getmovieName() { return movieName; } public void setmovieName(String movieName) { this.movieName = movieName; } public String getsingerName() { return singerName; } public void setsingerName(String singerName) { this.singerName = singerName; } public String getimagePath() { return imagePath; } public void setimagePath(String imagePath) { this.imagePath = imagePath; } public String getmediaPath() { return mediaPath; } public void setmediaPath(String mediaPath) { this.mediaPath = mediaPath; } } public class MusicListActivity extends Activity { @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.openadiuofile); ListView list = (ListView)findViewById(R.id.list1); SongsAdapter adapter = new SongsAdapter(this,R.layout.row, R.id.text2, null); list.setAdapter(adapter); } }

    Read the article

  • Spritebatch drawing sprite with jagged borders

    - by Mutoh
    Alright, I've been on the making of a sprite class and a sprite sheet manager, but have come across this problem. Pretty much, the project is acting like so; for example: Let's take this .png image, with a transparent background. Note how it has alpha-transparent pixels around it in the lineart. Now, in the latter link's image, in the left (with CornflowerBlue background) it is shown the image drawn in another project (let's call it "Project1") with a simpler sprite class - there, it works. The right (with Purple background for differentiating) shows it drawn with a different class in "Project2" - where the problem manifests itself. This is the Sprite class of Project1: using System; using System.Collections.Generic; using System.Linq; using System.Text; using Microsoft.Xna.Framework; using Microsoft.Xna.Framework.Content; using Microsoft.Xna.Framework.Graphics; namespace WindowsGame2 { class Sprite { Vector2 pos = new Vector2(0, 0); Texture2D image; Rectangle size; float scale = 1.0f; // --- public float X { get { return pos.X; } set { pos.X = value; } } public float Y { get { return pos.Y; } set { pos.Y = value; } } public float Width { get { return size.Width; } } public float Height { get { return size.Height; } } public float Scale { get { return scale; } set { if (value < 0) value = 0; scale = value; if (image != null) { size.Width = (int)(image.Width * scale); size.Height = (int)(image.Height * scale); } } } // --- public void Load(ContentManager Man, string filename) { image = Man.Load<Texture2D>(filename); size = new Rectangle( 0, 0, (int)(image.Width * scale), (int)(image.Height * scale) ); } public void Become(Texture2D frame) { image = frame; size = new Rectangle( 0, 0, (int)(image.Width * scale), (int)(image.Height * scale) ); } public void Draw(SpriteBatch Desenhista) { // Desenhista.Draw(image, pos, Color.White); Desenhista.Draw( image, pos, new Rectangle( 0, 0, image.Width, image.Height ), Color.White, 0.0f, Vector2.Zero, scale, SpriteEffects.None, 0 ); } } } And this is the code in Project2, a rewritten, pretty much, version of the previous class. In this one I added sprite sheet managing and, in particular, removed Load and Become, to allow for static resources and only actual Sprites to be instantiated. using System; using System.Collections.Generic; using System.Linq; using System.Text; using Microsoft.Xna.Framework; using Microsoft.Xna.Framework.Content; using Microsoft.Xna.Framework.Graphics; namespace Mobby_s_Adventure { // Actually, I might desconsider this, and instead use static AnimationLocation[] and instanciated ID and Frame; // For determining the starting frame of an animation in a sheet and being able to iterate through // the Rectangles vector of the Sheet; class AnimationLocation { public int Location; public int FrameCount; // --- public AnimationLocation(int StartingRow, int StartingColumn, int SheetWidth, int NumberOfFrames) { Location = (StartingRow * SheetWidth) + StartingColumn; FrameCount = NumberOfFrames; } public AnimationLocation(int PositionInSheet, int NumberOfFrames) { Location = PositionInSheet; FrameCount = NumberOfFrames; } public static int CalculatePosition(int StartingRow, int StartingColumn, SheetManager Sheet) { return ((StartingRow * Sheet.Width) + StartingColumn); } } class Sprite { // The general stuff; protected SheetManager Sheet; protected Vector2 Position; public Vector2 Axis; protected Color _Tint; public float Angle; public float Scale; protected SpriteEffects _Effect; // --- // protected AnimationManager Animation; // For managing the animations; protected AnimationLocation[] Animation; public int AnimationID; protected int Frame; // --- // Properties for easy accessing of the position of the sprite; public float X { get { return Position.X; } set { Position.X = Axis.X + value; } } public float Y { get { return Position.Y; } set { Position.Y = Axis.Y + value; } } // --- // Properties for knowing the size of the sprite's frames public float Width { get { return Sheet.FrameWidth * Scale; } } public float Height { get { return Sheet.FrameHeight * Scale; } } // --- // Properties for more stuff; public Color Tint { set { _Tint = value; } } public SpriteEffects Effect { set { _Effect = value; } } public int FrameID { get { return Frame; } set { if (value >= (Animation[AnimationID].FrameCount)) value = 0; Frame = value; } } // --- // The only things that will be constantly modified will be AnimationID and FrameID, anything else only // occasionally; public Sprite(SheetManager SpriteSheet, AnimationLocation[] Animations, Vector2 Location, Nullable<Vector2> Origin = null) { // Assign the sprite's sprite sheet; // (Passed by reference! To allow STATIC sheets!) Sheet = SpriteSheet; // Define the animations that the sprite has available; // (Passed by reference! To allow STATIC animation boundaries!) Animation = Animations; // Defaulting some numerical values; Angle = 0.0f; Scale = 1.0f; _Tint = Color.White; _Effect = SpriteEffects.None; // If the user wants a default Axis, it is set in the middle of the frame; if (Origin != null) Axis = Origin.Value; else Axis = new Vector2( Sheet.FrameWidth / 2, Sheet.FrameHeight / 2 ); // Now that we have the axis, we can set the position with no worries; X = Location.X; Y = Location.Y; } // Simply put, draw the sprite with all its characteristics; public void Draw(SpriteBatch Drafter) { Drafter.Draw( Sheet.Texture, Position, Sheet.Rectangles[Animation[AnimationID].Location + FrameID], // Find the rectangle which frames the wanted image; _Tint, Angle, Axis, Scale, _Effect, 0.0f ); } } } And, in any case, this is the SheetManager class found in the previous code: using System; using System.Collections.Generic; using System.Linq; using System.Text; using Microsoft.Xna.Framework; using Microsoft.Xna.Framework.Content; using Microsoft.Xna.Framework.Graphics; namespace Mobby_s_Adventure { class SheetManager { protected Texture2D SpriteSheet; // For storing the sprite sheet; // Number of rows and frames in each row in the SpriteSheet; protected int NumberOfRows; protected int NumberOfColumns; // Size of a single frame; protected int _FrameWidth; protected int _FrameHeight; public Rectangle[] Rectangles; // For storing each frame; // --- public int Width { get { return NumberOfColumns; } } public int Height { get { return NumberOfRows; } } // --- public int FrameWidth { get { return _FrameWidth; } } public int FrameHeight { get { return _FrameHeight; } } // --- public Texture2D Texture { get { return SpriteSheet; } } // --- public SheetManager (Texture2D Texture, int Rows, int FramesInEachRow) { // Normal assigning SpriteSheet = Texture; NumberOfRows = Rows; NumberOfColumns = FramesInEachRow; _FrameHeight = Texture.Height / NumberOfRows; _FrameWidth = Texture.Width / NumberOfColumns; // Framing everything Rectangles = new Rectangle[NumberOfRows * NumberOfColumns]; int ID = 0; for (int i = 0; i < NumberOfRows; i++) { for (int j = 0; j < NumberOfColumns; j++) { Rectangles[ID] = new Rectangle ( _FrameWidth * j, _FrameHeight * i, _FrameWidth, _FrameHeight ); ID++; } } } public SheetManager (Texture2D Texture, int NumberOfFrames): this(Texture, 1, NumberOfFrames) { } } } For even more comprehending, if needed, here is how the main code looks like (it's just messing with the class' capacities, nothing actually; the result is a disembodied feet walking in place animation on the top-left of the screen and a static axe nearby): using System; using System.Collections.Generic; using System.Linq; using Microsoft.Xna.Framework; using Microsoft.Xna.Framework.Audio; using Microsoft.Xna.Framework.Content; using Microsoft.Xna.Framework.GamerServices; using Microsoft.Xna.Framework.Graphics; using Microsoft.Xna.Framework.Input; using Microsoft.Xna.Framework.Media; using System.Threading; namespace Mobby_s_Adventure { /// <summary> /// This is the main type for your game /// </summary> public class Game1 : Microsoft.Xna.Framework.Game { GraphicsDeviceManager graphics; SpriteBatch spriteBatch; static List<Sprite> ToDraw; static Texture2D AxeSheet; static Texture2D FeetSheet; static SheetManager Axe; static Sprite Jojora; static AnimationLocation[] Hack = new AnimationLocation[1]; static SheetManager Feet; static Sprite Mutoh; static AnimationLocation[] FeetAnimations = new AnimationLocation[2]; public Game1() { graphics = new GraphicsDeviceManager(this); Content.RootDirectory = "Content"; this.TargetElapsedTime = TimeSpan.FromMilliseconds(100); this.IsFixedTimeStep = true; } /// <summary> /// Allows the game to perform any initialization it needs to before starting to run. /// This is where it can query for any required services and load any non-graphic /// related content. Calling base.Initialize will enumerate through any components /// and initialize them as well. /// </summary> protected override void Initialize() { // TODO: Add your initialization logic here base.Initialize(); } /// <summary> /// LoadContent will be called once per game and is the place to load /// all of your content. /// </summary> protected override void LoadContent() { // Create a new SpriteBatch, which can be used to draw textures. spriteBatch = new SpriteBatch(GraphicsDevice); // Loading logic ToDraw = new List<Sprite>(); AxeSheet = Content.Load<Texture2D>("Sheet"); FeetSheet = Content.Load<Texture2D>("Feet Sheet"); Axe = new SheetManager(AxeSheet, 1); Hack[0] = new AnimationLocation(0, 1); Jojora = new Sprite(Axe, Hack, new Vector2(100, 100), new Vector2(5, 55)); Jojora.AnimationID = 0; Jojora.FrameID = 0; Feet = new SheetManager(FeetSheet, 8); FeetAnimations[0] = new AnimationLocation(1, 7); FeetAnimations[1] = new AnimationLocation(0, 1); Mutoh = new Sprite(Feet, FeetAnimations, new Vector2(0, 0)); Mutoh.AnimationID = 0; Mutoh.FrameID = 0; } /// <summary> /// UnloadContent will be called once per game and is the place to unload /// all content. /// </summary> protected override void UnloadContent() { // TODO: Unload any non ContentManager content here } /// <summary> /// Allows the game to run logic such as updating the world, /// checking for collisions, gathering input, and playing audio. /// </summary> /// <param name="gameTime">Provides a snapshot of timing values.</param> protected override void Update(GameTime gameTime) { // Allows the game to exit if (GamePad.GetState(PlayerIndex.One).Buttons.Back == ButtonState.Pressed) this.Exit(); // Update logic Mutoh.FrameID++; ToDraw.Add(Mutoh); ToDraw.Add(Jojora); base.Update(gameTime); } /// <summary> /// This is called when the game should draw itself. /// </summary> /// <param name="gameTime">Provides a snapshot of timing values.</param> protected override void Draw(GameTime gameTime) { GraphicsDevice.Clear(Color.Purple); // Drawing logic spriteBatch.Begin(); foreach (Sprite Element in ToDraw) { Element.Draw(spriteBatch); } spriteBatch.Draw(Content.Load<Texture2D>("Sheet"), new Rectangle(50, 50, 55, 60), Color.White); spriteBatch.End(); base.Draw(gameTime); } } } Please help me find out what I'm overlooking! One thing that I have noticed and could aid is that, if inserted the equivalent of this code spriteBatch.Draw( Content.Load<Texture2D>("Image Location"), new Rectangle(X, Y, images width, height), Color.White ); in Project2's Draw(GameTime) of the main loop, it works. EDIT Ok, even if the matter remains unsolved, I have made some more progress! As you see, I managed to get the two kinds of rendering in the same project (the aforementioned Project2, with the more complex Sprite class). This was achieved by adding the following code to Draw(GameTime): protected override void Draw(GameTime gameTime) { GraphicsDevice.Clear(Color.Purple); // Drawing logic spriteBatch.Begin(); foreach (Sprite Element in ToDraw) { Element.Draw(spriteBatch); } // Starting here spriteBatch.Draw( Axe.Texture, new Vector2(65, 100), new Rectangle ( 0, 0, Axe.FrameWidth, Axe.FrameHeight ), Color.White, 0.0f, new Vector2(0, 0), 1.0f, SpriteEffects.None, 0.0f ); // Ending here spriteBatch.End(); base.Draw(gameTime); } (Supposing that Axe is the SheetManager containing the texture, sorry if the "jargons" of my code confuse you :s) Thus, I have noticed that the problem is within the Sprite class. But I only get more clueless, because even after modifying its Draw function to this: public void Draw(SpriteBatch Drafter) { /*Drafter.Draw( Sheet.Texture, Position, Sheet.Rectangles[Animation[AnimationID].Location + FrameID], // Find the rectangle which frames the wanted image; _Tint, Angle, Axis, Scale, _Effect, 0.0f );*/ Drafter.Draw( Sheet.Texture, Position, new Rectangle( 0, 0, Sheet.FrameWidth, Sheet.FrameHeight ), Color.White, 0.0f, Vector2.Zero, Scale, SpriteEffects.None, 0 ); } to make it as simple as the patch of code that works, it still draws the sprite jaggedly!

    Read the article

  • Developing for 2005 using VS2008!

    - by Vincent Grondin
    I joined a fairly large project recently and it has a particularity… Once finished, everything has to be sent to the client under VS2005 using VB.Net and can target either framework 2.0 or 3.0… A long time ago, the decision to use VS2008 and to target framework 3.0 was taken but people knew they would need to establish a few rules to ensure that each dev would use VS2008 as if it was VS2005… Why is that so? Well simply because the compiler in VS2005 is different from the compiler inside VS2008…  I thought it might be a good idea to note the things that you cannot use in VS2008 if you plan on going back to VS2005. Who knows, this might save someone the headache of going over all their code to fix errors… -        Do not use LinQ keywords (from, in, select, orderby…).   -        Do not use LinQ standard operators under the form of extension methods.   -        Do not use type inference (in VB.Net you can switch it OFF in each project properties). o   This means you cannot use XML Literals.   -        Do not use nullable types under the following declarative form:    Dim myInt as Integer? But using:   Dim myInt as Nullable(Of Integer)     is perfectly fine.   -        Do not test nullable types with     Is Nothing    use    myInt.HasValue     instead.   -        Do not use Lambda expressions (there is no Lambda statements in VB9) so you cannot use the keyword “Function”.   -        Pay attention not to use relaxed delegates because this one is easy to miss in VS2008   -        Do not use Object Initializers   -        Do not use the “ternary If operator” … not the IIf method but this one     If(confition, truepart, falsepart).   As a side note, I talked about not using LinQ keyword nor the extension methods but, this doesn’t mean not to use LinQ in this scenario. LinQ is perfectly accessible from inside VS2005. All you need to do is reference System.Core, use namespace System.Linq and use class “Enumerable” as a helper class… This is one of the many classes containing various methods that VS2008 sees as extensions. The trick is you can use them too! Simply remember that the first parameter of the method is the object you want to query on and then pass in the other parameters needed… That’s pretty much all I see but I could have missed a few… If you know other things that are specific to the VS2008 compiler and which do not work under VS2005, feel free to leave a comment and I’ll modify my list accordingly (and notify our team here…) ! Happy coding all!

    Read the article

  • Animation issue caused by C# parameters passed by reference rather than value, but where?

    - by Jordan Roher
    I'm having trouble with sprite animation in XNA that appears to be caused by a struct passed as a reference value. But I'm not using the ref keyword anywhere. I am, admittedly, a C# noob, so there may be some shallow bonehead error in here, but I can't see it. I'm creating 10 ants or bees and animating them as they move across the screen. I have an array of animation structs, and each time I create an ant or bee, I send it the animation array value it requires (just [0] or [1] at this time). Deep inside the animation struct is a timer that is used to change frames. The ant/bee class stores the animation struct as a private variable. What I'm seeing is that each ant or bee uses the same animation struct, the one I thought I was passing in and copying by value. So during Update(), when I advance the animation timer for each ant/bee, the next ant/bee has its animation timer advanced by that small amount. If there's 1 ant on screen, it animates properly. 2 ants, it runs twice as fast, and so on. Obviously, not what I want. Here's an abridged version of the code. How is BerryPicking's ActorAnimationGroupData[] getting shared between the BerryCreatures? class BerryPicking { private ActorAnimationGroupData[] animations; private BerryCreature[] creatures; private Dictionary<string, Texture2D> creatureTextures; private const int maxCreatures = 5; public BerryPickingExample() { this.creatures = new BerryCreature[maxCreatures]; this.creatureTextures = new Dictionary<string, Texture2D>(); } public void LoadContent() { // Returns data from an XML file Reader reader = new Reader(); animations = reader.LoadAnimations(); CreateCreatures(); } // This is called from another function I'm not including because it's not relevant to the problem. // In it, I remove any creature that passes outside the viewport by setting its creatures[] spot to null. // Hence the if(creatures[i] == null) test is used to recreate "dead" creatures. Inelegant, I know. private void CreateCreatures() { for (int i = 0; i < creatures.Length; i++) { if (creatures[i] == null) { // In reality, the name selection is randomized creatures[i] = new BerryCreature("ant"); // Load content and texture (which I create elsewhere) creatures[i].LoadContent( FindAnimation(creatures[i].Name), creatureTextures[creatures[i].Name]); } } } private ActorAnimationGroupData FindAnimation(string animationName) { int yourAnimation = -1; for (int i = 0; i < animations.Length; i++) { if (animations[i].name == animationName) { yourAnimation = i; break; } } return animations[yourAnimation]; } public void Update(GameTime gameTime) { for (int i = 0; i < creatures.Length; i++) { creatures[i].Update(gameTime); } } } class Reader { public ActorAnimationGroupData[] LoadAnimations() { ActorAnimationGroupData[] animationGroup; XmlReader file = new XmlTextReader(filename); // Do loading... // Then later file.Close(); return animationGroup; } } class BerryCreature { private ActorAnimation animation; private string name; public BerryCreature(string name) { this.name = name; } public void LoadContent(ActorAnimationGroupData animationData, Texture2D sprite) { animation = new ActorAnimation(animationData); animation.LoadContent(sprite); } public void Update(GameTime gameTime) { animation.Update(gameTime); } } class ActorAnimation { private ActorAnimationGroupData animation; public ActorAnimation(ActorAnimationGroupData animation) { this.animation = animation; } public void LoadContent(Texture2D sprite) { this.sprite = sprite; } public void Update(GameTime gameTime) { animation.Update(gameTime); } } struct ActorAnimationGroupData { // There are lots of other members of this struct, but the timer is the only one I'm worried about. // TimerData is another struct private TimerData timer; public ActorAnimationGroupData() { timer = new TimerData(2); } public void Update(GameTime gameTime) { timer.Update(gameTime); } } struct TimerData { public float currentTime; public float maxTime; public TimerData(float maxTime) { this.currentTime = 0; this.maxTime = maxTime; } public void Update(GameTime gameTime) { currentTime += (float)gameTime.ElapsedGameTime.TotalSeconds; if (currentTime >= maxTime) { currentTime = maxTime; } } }

    Read the article

  • Connecting SceneBuilder edited FXML to Java code

    - by daniel
    Recently I had to answer several questions regarding how to connect an UI built with the JavaFX SceneBuilder 1.0 Developer Preview to Java Code. So I figured out that a short overview might be helpful. But first, let me state the obvious. What is FXML? To make it short, FXML is an XML based declaration format for JavaFX. JavaFX provides an FXML loader which will parse FXML files and from that construct a graph of Java object. It may sound complex when stated like that but it is actually quite simple. Here is an example of FXML file, which instantiate a StackPane and puts a Button inside it: -- <?xml version="1.0" encoding="UTF-8"?> <?import java.lang.*?> <?import java.util.*?> <?import javafx.scene.control.*?> <?import javafx.scene.layout.*?> <?import javafx.scene.paint.*?> <StackPane prefHeight="150.0" prefWidth="200.0" xmlns:fx="http://javafx.com/fxml"> <children> <Button mnemonicParsing="false" text="Button" /> </children> </StackPane> ... and here is the code I would have had to write if I had chosen to do the same thing programatically: import javafx.scene.control.*; import javafx.scene.layout.*; ... final Button button = new Button("Button"); button.setMnemonicParsing(false); final StackPane stackPane = new StackPane(); stackPane.setPrefWidth(200.0); stackPane.setPrefHeight(150.0); stacPane.getChildren().add(button); As you can see - FXML is rather simple to understand - as it is quite close to the JavaFX API. So OK FXML is simple, but why would I use it?Well, there are several answers to that - but my own favorite is: because you can make it with SceneBuilder. What is SceneBuilder? In short SceneBuilder is a layout tool that will let you graphically build JavaFX user interfaces by dragging and dropping JavaFX components from a library, and save it as an FXML file. SceneBuilder can also be used to load and modify JavaFX scenegraphs declared in FXML. Here is how I made the small FXML file above: Start the JavaFX SceneBuilder 1.0 Developer Preview In the Library on the left hand side, click on 'StackPane' and drag it on the content view (the white rectangle) In the Library, select a Button and drag it onto the StackPane on the content view. In the Hierarchy Panel on the left hand side - select the StackPane component, then invoke 'Edit > Trim To Selected' from the menubar That's it - you can now save, and you will obtain the small FXML file shown above. Of course this is only a trivial sample, made for the sake of the example - and SceneBuilder will let you create much more complex UIs. So, I have now an FXML file. But what do I do with it? How do I include it in my program? How do I write my main class? Loading an FXML file with JavaFX Well, that's the easy part - because the piece of code you need to write never changes. You can download and look at the SceneBuilder samples if you need to get convinced, but here is the short version: Create a Java class (let's call it 'Main.java') which extends javafx.application.Application In the same directory copy/save the FXML file you just created using SceneBuilder. Let's name it "simple.fxml" Now here is the Java code for the Main class, which simply loads the FXML file and puts it as root in a stage's scene. /* * Copyright (c) 2012, Oracle and/or its affiliates. All rights reserved. */ package simple; import java.util.logging.Level; import java.util.logging.Logger; import javafx.application.Application; import javafx.fxml.FXMLLoader; import javafx.scene.Scene; import javafx.scene.layout.StackPane; import javafx.stage.Stage; public class Main extends Application { /** * @param args the command line arguments */ public static void main(String[] args) { Application.launch(Main.class, (java.lang.String[])null); } @Override public void start(Stage primaryStage) { try { StackPane page = (StackPane) FXMLLoader.load(Main.class.getResource("simple.fxml")); Scene scene = new Scene(page); primaryStage.setScene(scene); primaryStage.setTitle("FXML is Simple"); primaryStage.show(); } catch (Exception ex) { Logger.getLogger(Main.class.getName()).log(Level.SEVERE, null, ex); } } } Great! Now I only have to use my favorite IDE to compile the class and run it. But... wait... what does it do? Well nothing. It just displays a button in the middle of a window. There's no logic attached to it. So how do we do that? How can I connect this button to my application logic? Here is how: Connection to code First let's define our application logic. Since this post is only intended to give a very brief overview - let's keep things simple. Let's say that the only thing I want to do is print a message on System.out when the user clicks on my button. To do that, I'll need to register an action handler with my button. And to do that, I'll need to somehow get a handle on my button. I'll need some kind of controller logic that will get my button and add my action handler to it. So how do I get a handle to my button and pass it to my controller? Once again - this is easy: I just need to write a controller class for my FXML. With each FXML file, it is possible to associate a controller class defined for that FXML. That controller class will make the link between the UI (the objects defined in the FXML) and the application logic. To each object defined in FXML we can associate an fx:id. The value of the id must be unique within the scope of the FXML, and is the name of an instance variable inside the controller class, in which the object will be injected. Since I want to have access to my button, I will need to add an fx:id to my button in FXML, and declare an @FXML variable in my controller class with the same name. In other words - I will need to add fx:id="myButton" to my button in FXML: -- <Button fx:id="myButton" mnemonicParsing="false" text="Button" /> and declare @FXML private Button myButton in my controller class @FXML private Button myButton; // value will be injected by the FXMLLoader Let's see how to do this. Add an fx:id to the Button object Load "simple.fxml" in SceneBuilder - if not already done In the hierarchy panel (bottom left), or directly on the content view, select the Button object. Open the Properties sections of the inspector (right panel) for the button object At the top of the section, you will see a text field labelled fx:id. Enter myButton in that field and validate. Associate a controller class with the FXML file Still in SceneBuilder, select the top root object (in our case, that's the StackPane), and open the Code section of the inspector (right hand side) At the top of the section you should see a text field labelled Controller Class. In the field, type simple.SimpleController. This is the name of the class we're going to create manually. If you save at this point, the FXML will look like this: -- <?xml version="1.0" encoding="UTF-8"?> <?import java.lang.*?> <?import java.util.*?> <?import javafx.scene.control.*?> <?import javafx.scene.layout.*?> <?import javafx.scene.paint.*?> <StackPane prefHeight="150.0" prefWidth="200.0" xmlns:fx="http://javafx.com/fxml" fx:controller="simple.SimpleController"> <children> <Button fx:id="myButton" mnemonicParsing="false" text="Button" /> </children> </StackPane> As you can see, the name of the controller class has been added to the root object: fx:controller="simple.SimpleController" Coding the controller class In your favorite IDE, create an empty SimpleController.java class. Now what does a controller class looks like? What should we put inside? Well - SceneBuilder will help you there: it will show you an example of controller skeleton tailored for your FXML. In the menu bar, invoke View > Show Sample Controller Skeleton. A popup appears, displaying a suggestion for the controller skeleton: copy the code displayed there, and paste it into your SimpleController.java: /** * Sample Skeleton for "simple.fxml" Controller Class * Use copy/paste to copy paste this code into your favorite IDE **/ package simple; import java.net.URL; import java.util.ResourceBundle; import javafx.fxml.FXML; import javafx.fxml.Initializable; import javafx.scene.control.Button; public class SimpleController implements Initializable { @FXML // fx:id="myButton" private Button myButton; // Value injected by FXMLLoader @Override // This method is called by the FXMLLoader when initialization is complete public void initialize(URL fxmlFileLocation, ResourceBundle resources) { assert myButton != null : "fx:id=\"myButton\" was not injected: check your FXML file 'simple.fxml'."; // initialize your logic here: all @FXML variables will have been injected } } Note that the code displayed by SceneBuilder is there only for educational purpose: SceneBuilder does not create and does not modify Java files. This is simply a hint of what you can use, given the fx:id present in your FXML file. You are free to copy all or part of the displayed code and paste it into your own Java class. Now at this point, there only remains to add our logic to the controller class. Quite easy: in the initialize method, I will register an action handler with my button: () { @Override public void handle(ActionEvent event) { System.out.println("That was easy, wasn't it?"); } }); ... -- ... // initialize your logic here: all @FXML variables will have been injected myButton.setOnAction(new EventHandler<ActionEvent>() { @Override public void handle(ActionEvent event) { System.out.println("That was easy, wasn't it?"); } }); ... That's it - if you now compile everything in your IDE, and run your application, clicking on the button should print a message on the console! Summary What happens is that in Main.java, the FXMLLoader will load simple.fxml from the jar/classpath, as specified by 'FXMLLoader.load(Main.class.getResource("simple.fxml"))'. When loading simple.fxml, the loader will find the name of the controller class, as specified by 'fx:controller="simple.SimpleController"' in the FXML. Upon finding the name of the controller class, the loader will create an instance of that class, in which it will try to inject all the objects that have an fx:id in the FXML. Thus, after having created '<Button fx:id="myButton" ... />', the FXMLLoader will inject the button instance into the '@FXML private Button myButton;' instance variable found on the controller instance. This is because The instance variable has an @FXML annotation, The name of the variable exactly matches the value of the fx:id Finally, when the whole FXML has been loaded, the FXMLLoader will call the controller's initialize method, and our code that registers an action handler with the button will be executed. For a complete example, take a look at the HelloWorld SceneBuilder sample. Also make sure to follow the SceneBuilder Get Started guide, which will guide you through a much more complete example. Of course, there are more elegant ways to set up an Event Handler using FXML and SceneBuilder. There are also many different ways to work with the FXMLLoader. But since it's starting to be very late here, I think it will have to wait for another post. I hope you have enjoyed the tour! --daniel

    Read the article

  • Anyone succeeded at injecting Interfaces into Entity Framework 4 Entities, using T4?

    - by Ciel
    Hello: POCO sort of leaves me wanting: (how can I say I use DI/IoC, if the Repository is not the only place that is creating the entities?)...hence my desire to lock it down, get rid of the temptation of newing up POCOs or EntityObjects anywhere in the code, and just allowing entity interfaces above the Repository/Factory layer. For a second there, I nearly thought I had it...was editing EF4's T4 in order to inject in an Interface def. Was going swimmingly, compiled and worked, until I got to the Associations... I wrapped them with a ICollection, and renamed the underlying original collection with a prefix of Wrapped. Unfortunately, when run, throws an error: //The Member 'WrappedSubExamples' in the CLR type 'XAct.App.Data.Model.EF4.Example' is not present in the conceptual model type 'XAct.App.Data.Model.Entity.Example'. var examples = context2.CreateObjectSet(); My T4 segment I used was (this may not work, as it's the longest code snippet I've ever posted here...sorry): #region Generic Property Abstraction <# if (navProperty.ToEndMember.RelationshipMultiplicity == RelationshipMultiplicity.Many) {#> //XAct.App Generic Wrapper: <#=code.SpaceAfter(NewModifier(navProperty))#><#=Accessibility.ForProperty(navProperty)#> ICollection<I<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>> <#=code.Escape(navProperty)#> { get { if (_X<#=code.Escape(navProperty)# == null){ _X<#=code.Escape(navProperty)# = new WrappedCollection,<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#(this.<#=(navProperty.ToEndMember.RelationshipMultiplicity == RelationshipMultiplicity.Many)?"Wrapped":""#<#=code.Escape(navProperty)#); } return _X<#=code.Escape(navProperty)#; } } private ICollection _X<#=code.Escape(navProperty)#; <# } else { # <#=code.SpaceAfter(NewModifier(navProperty))#<#=Accessibility.ForProperty(navProperty)# I<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)# <#=code.Escape(navProperty)# { get { return (I<#=code.Escape(navProperty)#)this.Wrapped<#=code.Escape(navProperty)#; } set { this.Wrapped<#=code.Escape(navProperty)# = value as <#=code.Escape(navProperty)#; } } <# } # #endregion which then wraps the original collection, renamed with the prefix 'Wrapped': /// <summary> /// <#=SummaryComment(navProperty)#> /// </summary><#=LongDescriptionCommentElement(navProperty, region.CurrentIndentLevel) #> [XmlIgnoreAttribute()] [SoapIgnoreAttribute()] [DataMemberAttribute()] [EdmRelationshipNavigationPropertyAttribute("<#=navProperty.RelationshipType.NamespaceName#>", "<#=navProperty.RelationshipType.Name#>", "<#=navProperty.ToEndMember.Name#>")] <# if (navProperty.ToEndMember.RelationshipMultiplicity == RelationshipMultiplicity.Many) { #> <#=code.SpaceAfter(NewModifier(navProperty))#><#=Accessibility.ForProperty(navProperty)#> EntityCollection<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>> Wrapped<#=code.Escape(navProperty)#> { <#=code.SpaceAfter(Accessibility.ForGetter(navProperty))#>get { return ((IEntityWithRelationships)this).RelationshipManager.GetRelatedCollection<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>"); } <#=code.SpaceAfter(Accessibility.ForSetter(navProperty))#>set { if ((value != null)) { ((IEntityWithRelationships)this).RelationshipManager.InitializeRelatedCollection<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>", value); } } } <# } else { #> <#=code.SpaceAfter(NewModifier(navProperty))#><#=Accessibility.ForProperty(navProperty)#> <#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#> Wrapped<#=code.Escape(navProperty)#> { <#=code.SpaceAfter(Accessibility.ForGetter(navProperty))#>get { return ((IEntityWithRelationships)this).RelationshipManager.GetRelatedReference<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>").Value; } <#=code.SpaceAfter(Accessibility.ForSetter(navProperty))#>set { ((IEntityWithRelationships)this).RelationshipManager.GetRelatedReference<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>").Value = value; } } <# string refPropertyName = navProperty.Name + "Reference"; if (entity.Members.Any(m => m.Name == refPropertyName)) { // 6017 is the same error number that EntityClassGenerator uses. Errors.Add(new System.CodeDom.Compiler.CompilerError(SourceCsdlPath, -1, -1, "6017", String.Format(CultureInfo.CurrentCulture, GetResourceString("Template_ConflictingGeneratedNavPropName"), navProperty.Name, entity.FullName, refPropertyName))); } #> /// <summary> /// <#=SummaryComment(navProperty)#> /// </summary><#=LongDescriptionCommentElement(navProperty, region.CurrentIndentLevel)#> [BrowsableAttribute(false)] [DataMemberAttribute()] <#=Accessibility.ForProperty(navProperty)#> EntityReference<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>> <#=refPropertyName#> { <#=code.SpaceAfter(Accessibility.ForGetter(navProperty))#>get { return ((IEntityWithRelationships)this).RelationshipManager.GetRelatedReference<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>"); } <#=code.SpaceAfter(Accessibility.ForSetter(navProperty))#>set { if ((value != null)) { ((IEntityWithRelationships)this).RelationshipManager.InitializeRelatedReference<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>", value); } } } <# } The point is...it bugs out. I've tried various solutions...none worked. Any ideas -- or is this just a wild goose chase, and time to give it up?

    Read the article

  • Trying to draw 2 objects on screen and store the selected item names in an array

    - by thefonso
    Ok...this is a homework question, here is what i'm asked to do.... "Allow the user to draw two Shapes, which when instantiated, get put into the array myShapes...(store the shapes in the createShape() method." I want to know if I'm going in the right direction. Do I need to modify only Model.java or GUIDemo.java as well? Am I sufficient in thinking of only storing the values for the array via a loop inside my createShape() method? How do I go a bout checking to see if things work so far. There are many steps for this homework project after this one but i'm stuck here. Please point me in the right direction. The array myShapes lives inside my model class inside Model.java: package model; import java.awt.Color; import java.awt.Container; import shapes.Line; import shapes.Oval; import shapes.Rectangle; import shapes.Shape; import shapes.Triangle; import interfaces.Resettable; public class Model implements Resettable { private Container container; private String message; public final static String DRAW = "Draw"; public final static String MOVE = "Move"; public final static String REMOVE = "Remove"; public final static String RESIZE = "Resize"; public final static String FILL = "Fill"; public final static String CHANGE = "Change"; public final static String RECTANGLE = "Rectangle"; public final static String OVAL = "Oval"; public final static String LINE = "Line"; public final static String TRIANGLE = "Triangle"; private String action = DRAW; private boolean fill = false; public static String[] selections = {"Rectangle", "Oval", "Line", "Triangle"}; //project 9 begin public Shape[] myShapes = new Shape[2]; //project 9 stop private String currentShapeType; private Shape currentShape; public Color lineColor; private Color fillColor = Color.gray; public Shape createShape() { if(currentShapeType == RECTANGLE){ currentShape = new Rectangle(0, 0, 0, 0, lineColor, fillColor, fill); } if(currentShapeType == OVAL) { currentShape = new Oval(0,0,0,0, lineColor, fillColor, fill); } if(currentShapeType == LINE) { currentShape = new Line(0,0,0,0, lineColor, fillColor, fill); } if(currentShapeType == TRIANGLE) { currentShape = new Triangle(0,0,0,0, lineColor, fillColor, fill); } //project 9 start if(myShapes[0] == null) { myShapes[0]=currentShape; } else { myShapes[1]=currentShape; } //project 9 stop return currentShape; } public Shape getCurrentShape() { return currentShape; } public String getCurrentShapeType(){ return currentShapeType; } public void setCurrentShapeType(String shapeType){ currentShapeType = shapeType; } public Model(Container container) { this.container = container; } public void repaint() { container.repaint(); } public void resetComponents() { action = DRAW; currentShape = null; if (container instanceof Resettable) { ((Resettable) container).resetComponents(); } } public String getAction() { return action; } public void setAction(String action) { this.action = action; } public boolean isFill() { return fill; } public void setFill(boolean fill) { this.fill = fill; } public void setMessage(String msg) { this.message = msg; } public String getMessage() { return this.message; } public Color getLineColor() { return this.lineColor; } public void setLineColor(Color c) { this.lineColor = c; } public String toString() { return "Model:\n\tAction: " + action + "\n\tFill: " + fill; } } The application is run from GUIDemo.java: package ui.applet; import interfaces.Resettable; import java.applet.Applet; import java.awt.Graphics; import event.ShapeMouseHandler; import shapes.Shape; //import ui.panels.ButtonPanel; import ui.panels.ChoicePanel; import ui.panels.MainPanel; import model.Model; @SuppressWarnings("serial") public class GUIDemo extends Applet implements Resettable { MainPanel mainPanel; Model model; ChoicePanel choicePanel; public void init() { resize(600,400); model = new Model(this); choicePanel = new ChoicePanel(model); mainPanel = new MainPanel(model); this.add(choicePanel);//this is the drop down list this.add(mainPanel);//these are the radio buttons and reset button ShapeMouseHandler mouseHandler = new ShapeMouseHandler(model); addMouseListener(mouseHandler); addMouseMotionListener(mouseHandler); } public void paint(Graphics g) { Shape shape; shape = model.getCurrentShape(); if(shape != null) { shape.draw(g); } System.out.println(model); System.out.println(shape); } public void resetComponents() { mainPanel.resetComponents(); choicePanel.resetComponents(); } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Fluent NHibernate/SQL Server 2008 insert query problem

    - by Mark
    Hi all, I'm new to Fluent NHibernate and I'm running into a problem. I have a mapping defined as follows: public PersonMapping() { Id(p => p.Id).GeneratedBy.HiLo("1000"); Map(p => p.FirstName).Not.Nullable().Length(50); Map(p => p.MiddleInitial).Nullable().Length(1); Map(p => p.LastName).Not.Nullable().Length(50); Map(p => p.Suffix).Nullable().Length(3); Map(p => p.SSN).Nullable().Length(11); Map(p => p.BirthDate).Nullable(); Map(p => p.CellPhone).Nullable().Length(12); Map(p => p.HomePhone).Nullable().Length(12); Map(p => p.WorkPhone).Nullable().Length(12); Map(p => p.OtherPhone).Nullable().Length(12); Map(p => p.EmailAddress).Nullable().Length(50); Map(p => p.DriversLicenseNumber).Nullable().Length(50); Component<Address>(p => p.CurrentAddress, m => { m.Map(p => p.Line1, "Line1").Length(50); m.Map(p => p.Line2, "Line2").Length(50); m.Map(p => p.City, "City").Length(50); m.Map(p => p.State, "State").Length(50); m.Map(p => p.Zip, "Zip").Length(2); }); Map(p => p.EyeColor).Nullable().Length(3); Map(p => p.HairColor).Nullable().Length(3); Map(p => p.Gender).Nullable().Length(1); Map(p => p.Height).Nullable(); Map(p => p.Weight).Nullable(); Map(p => p.Race).Nullable().Length(1); Map(p => p.SkinTone).Nullable().Length(3); HasMany(p => p.PriorAddresses).Cascade.All(); } public PreviousAddressMapping() { Table("PriorAddress"); Id(p => p.Id).GeneratedBy.HiLo("1000"); Map(p => p.EndEffectiveDate).Not.Nullable(); Component<Address>(p => p.Address, m => { m.Map(p => p.Line1, "Line1").Length(50); m.Map(p => p.Line2, "Line2").Length(50); m.Map(p => p.City, "City").Length(50); m.Map(p => p.State, "State").Length(50); m.Map(p => p.Zip, "Zip").Length(2); }); } My test is [Test] public void can_correctly_map_Person_with_Addresses() { var myPerson = new Person("Jane", "", "Doe"); var priorAddresses = new[] { new PreviousAddress(ObjectMother.GetAddress1(), DateTime.Parse("05/13/2010")), new PreviousAddress(ObjectMother.GetAddress2(), DateTime.Parse("05/20/2010")) }; new PersistenceSpecification<Person>(Session) .CheckProperty(c => c.FirstName, myPerson.FirstName) .CheckProperty(c => c.LastName, myPerson.LastName) .CheckProperty(c => c.MiddleInitial, myPerson.MiddleInitial) .CheckList(c => c.PriorAddresses, priorAddresses) .VerifyTheMappings(); } GetAddress1() (yeah, horrible name) has Line2 == null The tables seem to be created correctly in sql server 2008, but the test fails with a SQLException "String or binary data would be truncated." When I grab the sql statement in SQL Profiler, I get exec sp_executesql N'INSERT INTO PriorAddress (Line1, Line2, City, State, Zip, EndEffectiveDate, Id) VALUES (@p0, @p1, @p2, @p3, @p4, @p5, @p6)',N'@p0 nvarchar(18),@p1 nvarchar(4000),@p2 nvarchar(10),@p3 nvarchar(2),@p4 nvarchar(5),@p5 datetime,@p6 int',@p0=N'6789 Somewhere Rd.',@p1=NULL,@p2=N'Hot Coffee',@p3=N'MS',@p4=N'09876',@p5='2010-05-13 00:00:00',@p6=1001 Notice the @p1 parameter is being set to nvarchar(4000) and being passed a NULL value. Why is it setting the parameter to nvarchar(4000)? How can I fix it? Thanks!

    Read the article

  • migrating from Prototype to jQuery in Rails, having trouble with duplicate get request

    - by aressidi
    I'm in the process of migrating from Prototype to jQuery and moving all JS outside of the view files. All is going fairly well with one exception. Here's what I'm trying to do, and the problem I'm having. I have a diary where users can update records in-line in the page like so: user clicks 'edit' link to edit an entry in the diary a get request is performed via jQuery and an edit form is displayed allowing the user to modify the record user updates the record, the form disappears and the updated record is shown in place of the form All of that works so far. The problem arises when: user updates a record user clicks 'edit' to update another record in this case, the edit form is shown twice! In firebug I get a status code 200 when the form shows, and then moments later, another edit form shows again with a status code of 304 I only want the form to show once, not twice. The form shows twice only after I update a record, otherwise everything works fine. Here's the code, any ideas? I think this might have to do with the fact that in food_item_update.js I call the editDiaryEntry() after a record is updated, but if I don't call that function and try and update the record after it's been modified, then it just spits up the .js.erb response on the screen. That's also why I have the editDiaryEntry() in the add_food.js.erb file. Any help would be greatly appreciated. diary.js jQuery(document).ready(function() { postFoodEntry(); editDiaryEntry(); initDatePicker(); }); function postFoodEntry() { jQuery('form#add_entry').submit(function(e) { e.preventDefault(); jQuery.post(this.action, jQuery(this).serialize(), null, "script"); // return this }); } function editDiaryEntry() { jQuery('.edit_link').click(function(e) { e.preventDefault(); // This should look to see if one version of this is open... if (jQuery('#edit_container_' + this.id).length == 0 ) { jQuery.get('/diary/entry/edit', {id: this.id}, null, "script"); } }); } function closeEdit () { jQuery('.close_edit').click(function(e) { e.preventDefault(); jQuery('.entry_edit_container').remove(); jQuery("#entry_" + this.id).show(); }); } function updateDiaryEntry() { jQuery('.edit_entry_form').submit(function(e) { e.preventDefault(); jQuery.post(this.action, $(this).serialize(), null, "script"); }); } function initDatePicker() { jQuery("#date, #edit_date").datepicker(); }; add_food.js.erb jQuery("#entry_alert").show(); jQuery('#add_entry')[ 0 ].reset(); jQuery('#diary_entries').html("<%= escape_javascript(render :partial => 'members/diary/diary_entries', :object => @diary, :locals => {:record_counter => 0, :date_header => 0, :edit_mode => @diary_edit}, :layout => false ) %>"); jQuery('#entry_alert').html("<%= escape_javascript(render :partial => 'members/diary/entry_alert', :locals => {:type => @type, :message => @alert_message}) %>"); jQuery('#entry_alert').show(); setTimeout(function() { jQuery('#entry_alert').fadeOut('slow'); }, 5000); editDiaryEntry(); food_item_edit.js.erb jQuery("#entry_<%= @entry.id %>").hide(); jQuery("#entry_<%= @entry.id %>").after("<%= escape_javascript(render :partial => 'members/diary/food_item_edit', :locals => {:user_food_profile => @entry}) %>"); closeEdit(); updateDiaryEntry(); initDatePicker(); food_item_update.js jQuery("#entry_<%= @entry.id %>").replaceWith("<%= escape_javascript(render :partial => 'members/diary/food_item', :locals => {:entry => @entry, :total_calories => 0}) %>"); jQuery('.entry_edit_container').remove(); editDiaryEntry();

    Read the article

  • login form whith java/sqlite

    - by tuxou
    hi I would like to create a login form for my application with the possibility to add or remove users for an sqlite database, i have created the table users(nam, pass) but i can't unclud it in my login form, it someone could help me this is my login code: import java.awt.*; import java.awt.event.*; import javax.swing.*; public class login extends JFrame { // Variables declaration private JLabel jLabel1; private JLabel jLabel2; private JTextField jTextField1; private JPasswordField jPasswordField1; private JButton jButton1; private JPanel contentPane; // End of variables declaration public login() { super(); create(); this.setVisible(true); } private void create() { jLabel1 = new JLabel(); jLabel2 = new JLabel(); jTextField1 = new JTextField(); jPasswordField1 = new JPasswordField(); jButton1 = new JButton(); contentPane = (JPanel)this.getContentPane(); // // jLabel1 // jLabel1.setHorizontalAlignment(SwingConstants.LEFT); jLabel1.setForeground(new Color(0, 0, 255)); jLabel1.setText("username:"); // // jLabel2 // jLabel2.setHorizontalAlignment(SwingConstants.LEFT); jLabel2.setForeground(new Color(0, 0, 255)); jLabel2.setText("password:"); // // jTextField1 // jTextField1.setForeground(new Color(0, 0, 255)); jTextField1.setSelectedTextColor(new Color(0, 0, 255)); jTextField1.setToolTipText("Enter your username"); jTextField1.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { jTextField1_actionPerformed(e); } }); // // jPasswordField1 // jPasswordField1.setForeground(new Color(0, 0, 255)); jPasswordField1.setToolTipText("Enter your password"); jPasswordField1.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { jPasswordField1_actionPerformed(e); } }); // // jButton1 // jButton1.setBackground(new Color(204, 204, 204)); jButton1.setForeground(new Color(0, 0, 255)); jButton1.setText("Login"); jButton1.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { jButton1_actionPerformed(e); } }); // // contentPane // contentPane.setLayout(null); contentPane.setBorder(BorderFactory.createEtchedBorder()); contentPane.setBackground(new Color(204, 204, 204)); addComponent(contentPane, jLabel1, 5,10,106,18); addComponent(contentPane, jLabel2, 5,47,97,18); addComponent(contentPane, jTextField1, 110,10,183,22); addComponent(contentPane, jPasswordField1, 110,45,183,22); addComponent(contentPane, jButton1, 150,75,83,28); // // login // this.setTitle("Login To Members Area"); this.setLocation(new Point(76, 182)); this.setSize(new Dimension(335, 141)); this.setDefaultCloseOperation(WindowConstants.EXIT_ON_CLOSE); this.setResizable(false); } /** Add Component Without a Layout Manager (Absolute Positioning) */ private void addComponent(Container container,Component c,int x,int y,int width,int height) { c.setBounds(x,y,width,height); container.add(c); } private void jTextField1_actionPerformed(ActionEvent e) { } private void jPasswordField1_actionPerformed(ActionEvent e) { } private void jButton1_actionPerformed(ActionEvent e) { System.out.println("\njButton1_actionPerformed(ActionEvent e) called."); String username = new String(jTextField1.getText()); String password = new String(jPasswordField1.getText()); if(username.equals("") || password.equals("")) // If password and username is empty Do this { jButton1.setEnabled(false); JLabel errorFields = new JLabel("You must enter a username and password to login."); JOptionPane.showMessageDialog(null,errorFields); jTextField1.setText(""); jPasswordField1.setText(""); jButton1.setEnabled(true); this.setVisible(true); } else { JLabel optionLabel = new JLabel("You entered "+username+" as your username. Is this correct?"); int confirm =JOptionPane.showConfirmDialog(null,optionLabel); switch(confirm){ // Switch Case case JOptionPane.YES_OPTION: // Attempt to Login user jButton1.setEnabled(false); // Set button enable to false to prevent 2 login attempts break; case JOptionPane.NO_OPTION: // No Case.(Go back. Set text to 0) jButton1.setEnabled(false); jTextField1.setText(""); jPasswordField1.setText(""); jButton1.setEnabled(true); break; case JOptionPane.CANCEL_OPTION: // Cancel Case.(Go back. Set text to 0) jButton1.setEnabled(false); jTextField1.setText(""); jPasswordField1.setText(""); jButton1.setEnabled(true); break; } // End Switch Case } } public static void main(String[] args) { JFrame.setDefaultLookAndFeelDecorated(true); JDialog.setDefaultLookAndFeelDecorated(true); try { UIManager.setLookAndFeel("com.sun.java.swing.plaf.windows.WindowsLookAndFeel"); } catch (Exception ex) { System.out.println("Failed loading L&F: "); System.out.println(ex); } new login(); }; }

    Read the article

  • Access Violation

    - by Justin
    I've been learning how to NOP functions in C++ or even C but there are very few tutorials online about it. I've been googling for the past few hours now and I'm just stuck. Here is my code. #include <iostream> #include <windows.h> #include <tlhelp32.h> using namespace std; //#define NOP 0x90 byte NOP[] = {0x90}; void enableDebugPrivileges() { HANDLE hcurrent=GetCurrentProcess(); HANDLE hToken; BOOL bret=OpenProcessToken(hcurrent,40,&hToken); LUID luid; bret=LookupPrivilegeValue(NULL,"SeDebugPrivilege",&luid); TOKEN_PRIVILEGES NewState,PreviousState; DWORD ReturnLength; NewState.PrivilegeCount =1; NewState.Privileges[0].Luid =luid; NewState.Privileges[0].Attributes=2; AdjustTokenPrivileges(hToken,FALSE,&NewState,28,&PreviousState,&ReturnLength); } DWORD GetProcId(char* ProcName) { PROCESSENTRY32 pe32; HANDLE hSnapshot = NULL; pe32.dwSize = sizeof( PROCESSENTRY32 ); hSnapshot = CreateToolhelp32Snapshot( TH32CS_SNAPPROCESS, 0 ); if( Process32First( hSnapshot, &pe32 ) ) { do{ if( strcmp( pe32.szExeFile, ProcName ) == 0 ) break; }while( Process32Next( hSnapshot, &pe32 ) ); } if( hSnapshot != INVALID_HANDLE_VALUE ) CloseHandle( hSnapshot ); return pe32.th32ProcessID; } void WriteMem(DWORD Address, void* Value, size_t Size) { DWORD Protect = NULL; VirtualProtect((LPVOID)Address, 3, PAGE_READWRITE, &Protect); memcpy((void*)Address, Value, 3); VirtualProtect((LPVOID)Address, 3, Protect, &Protect); } void nop_(PVOID address, int bytes){ DWORD d, ds; VirtualProtect(address, bytes, PAGE_EXECUTE_READWRITE, &d); memset(address, 144, bytes); VirtualProtect(address,bytes,d,&ds); } void MemCopy(HANDLE pHandle, void* Dest, const void* Src, int Len) { DWORD OldProtect; DWORD OldProtect2; VirtualProtect(Dest, Len, PAGE_EXECUTE_READWRITE, &OldProtect); memcpy(Dest, Src, Len); VirtualProtect(Dest, Len, OldProtect, &OldProtect2); FlushInstructionCache(pHandle, Dest, Len); } int main() { enableDebugPrivileges(); DWORD pid; HANDLE phandle; // Obtain the process ID pid = GetProcId("gr.exe"); if(GetLastError()) { cout << "Error_PID_: " << GetLastError() << endl; system("pause"); return -1; } // Obtain the process handle phandle = OpenProcess(PROCESS_ALL_ACCESS,0,pid); if(GetLastError()) { cout << "Error_HANDLE_: " << GetLastError() << endl; system("pause"); return -1; } // Debug info, 0 = bad cout <<"pid : " << pid << endl; cout <<"HANDLE: " << phandle << endl << endl; system("pause"); // Change value to short iValue = -1; int choice = 0; BYTE * bGodMode = (BYTE *) (0x409A7E); // Lives Address bool hack = true; while(hack) { system("cls"); cout << "What hack?\n0. Exit\n1. Lives\n\n!> "; cin >> choice; switch(choice) { case 0: { hack=false; break; } case 1: // Modify Time cout << "God Mode On\n!> "; // cin >> iValue; // nop_((PVOID)(0x409A7E), 3); // MemCopy(phandle, (PVOID)0x409A7E, &NOP, 1); WriteMem((DWORD)(0x00409A7E), (void*)NOP, sizeof NOP); if(GetLastError()) { cout << "Error: " << GetLastError() << endl; system("pause"); } break; default: cout << "ERROR!\n"; break; } Sleep(100); } system("pause"); return 0; } This is suppose to NOP the DEC function that is 3 bytes long preventing me from losing lives. However each time I try it, it crashes the hack and says I had a access violation. I tried to look up the reasons and most of them dealt with with the size of the location I'm writing to and what I'm copying from. Otherwise, I have absolutely no idea. Any help would be nice. The game is GunRoar and the base address "0x409A7E" is where the DEC function is.

    Read the article

  • Javascript: Can't control parent of descendant nodes.

    - by .phjasper
    I'm creating elements (level 1) dynamically which in turn create elements (level 2) themselves. However, the children of level 2 elements have "body" as their parent. In the HTML code below, the content if spotAd2 is created by my function createNode(). It's a Google Ad Sense tag. However, the Google Ad Sense tag create elements that went directly under "body". I need them to by under spotAd2. function createNode( t, // type. tn, // if type is element, tag name. a, // if type is element, attributes. v, // node value or text content p, // parent f ) // whether to make dist the first child or not. { n = null; switch( t ) { case "element": n = document.createElement( tn ); if( a ) { for( k in a ) { n.setAttribute( k, a[ k ] ); } } break; case "text": case "cdata_section": case "comment": n = document.createTextNode(v); break; } if ( p ) { if( f ) { p.insertBefore( n, p.firstChild ); } else { p.appendChild( n ); } } return n; } spotAd2 = document.getElementById("spotAd2"); n1 = createNode("element", "div", {"id":"tnDiv1"}, "\n" , null, true); n2 = createNode("element", "script", {"type":"text\/javascript"}, "\n" , n1, false); n3 = createNode("comment", "", null, "\n" + "google_ad_client = \"pub-0321943928525350\";\n" + "/* 728x90 (main top) */\n" + "google_ad_slot = \"2783893649\";\n" + "google_ad_width = 728;\n" + "google_ad_height = 90;\n" + "//\n" , n2, false); n4 = createNode("element", "script", {"type":"text\/javascript","src":"http:\/\/pagead2.googlesyndication.com\/pagead\/show_ads.js"}, "\n" , n1, false); --- Result: <body> <table cellspacing="2" cellpadding="2" border="1"> <tbody><tr> <td>Oel ngati kemeie</td> <td>Kamakto niwin</td> </tr> <tr> <td>The ad:</td> <td> <div id="spotAd2"> <!-- Created by createNode() --> <div id="tnDiv1"> <script type="text/javascript"> google_ad_client = "pub-0321943928525350"; /* 728x90 (main top) */ google_ad_slot = "2783893649"; google_ad_width = 728; google_ad_height = 90; </script> <script type="text/javascript" src="http://pagead2.googlesyndication.com/pagead/show_ads.js"></script> </div> <!-- Created by createNode() --> </div> </td> </tr> <tr> <td>txopu ra'a tsi, tsamsiyu</td> <td>teyrakup skxawng</td> </tr> </tbody></table> <!-- Created by adsense tag, need these to be under tnDiv1 --> <script src="http://pagead2.googlesyndication.com/pagead/expansion_embed.js"></script> <script src="http://googleads.g.doubleclick.net/pagead/test_domain.js"></script> <script>google_protectAndRun("ads_core.google_render_ad", google_handleError, google_render_ad);</script> <ins style="border: medium none ; margin: 0pt; padding: 0pt; display: inline-table; height: 90px; position: relative; visibility: visible; width: 728px;"> <ins style="border: medium none ; margin: 0pt; padding: 0pt; display: block; height: 90px; position: relative; visibility: visible; width: 728px;"> <iframe width="728" scrolling="no" height="90" frameborder="0" vspace="0" style="left: 0pt; position: absolute; top: 0pt;" src="http://googleads.g.doubleclick.net/pagead/ads?client=ca-pub-0321943928525350&amp;output=html&amp;h=90&amp;slotname=2783893649&amp;w=728&amp;lmt=1273708979&amp;flash=10.0.45&amp;url=http%3A%2F%2Fkenshin.katanatechworks.com%2Ftest%2FadsBrowserSide.php&amp;dt=1273708980294&amp;shv=r20100422&amp;correlator=1273708980298&amp;frm=0&amp;ga_vid=695691836.1273708981&amp;ga_sid=1273708981&amp;ga_hid=1961182006&amp;ga_fc=0&amp;u_tz=480&amp;u_his=2&amp;u_java=1&amp;u_h=1080&amp;u_w=1920&amp;u_ah=1052&amp;u_aw=1920&amp;u_cd=24&amp;u_nplug=5&amp;u_nmime=38&amp;biw=1394&amp;bih=324&amp;fu=0&amp;ifi=1&amp;dtd=955&amp;xpc=Jl67G4xiq6&amp;p=http%3A//kenshin.katanatechworks.com" name="google_ads_frame" marginwidth="0" marginheight="0" id="google_ads_frame1" hspace="0" allowtransparency="true"> </iframe> </ins> </ins> <!-- Created by adsense tag, need these to be under tnDiv1 --> </body>

    Read the article

  • Why would I learn C++11, having known C and C++?

    - by Shahbaz
    I am a programmer in C and C++, although I don't stick to either language and write a mixture of the two. Sometimes having code in classes, possibly with operator overloading, or templates and the oh so great STL is obviously a better way. Sometimes use of a simple C function pointer is much much more readable and clear. So I find beauty and practicality in both languages. I don't want to get into the discussion of "If you mix them and compile with a C++ compiler, it's not a mix anymore, it's all C++" I think we all understand what I mean by mixing them. Also, I don't want to talk about C vs C++, this question is all about C++11. C++11 introduces what I think are significant changes to how C++ works, but it has introduced many special cases that change how different features behave in different circumstances, placing restrictions on multiple inheritance, adding lambda functions, etc. I know that at some point in the future, when you say C++ everyone would assume C++11. Much like when you say C nowadays, you most probably mean C99. That makes me consider learning C++11. After all, if I want to continue writing code in C++, I may at some point need to start using those features simply because my colleagues have. Take C for example. After so many years, there are still many people learning and writing code in C. Why? Because the language is good. What good means is that, it follows many of the rules to create a good programming language. So besides being powerful (which easy or hard, almost all programming languages are), C is regular and has few exceptions, if any. C++11 however, I don't think so. I'm not sure that the changes introduced in C++11 are making the language better. So the question is: Why would I learn C++11? Update: My original question in short was: "I like C++, but the new C++11 doesn't look good because of this and this and this. However, deep down something tells me I need to learn it. So, I asked this question here so that someone would help convince me to learn it." However, the zealous people here can't tolerate pointing out a flaw in their language and were not at all constructive in this manner. After the moderator edited the question, it became more like a "So, how about this new C++11?" which was not at all my question. Therefore, in a day or too I am going to delete this question if no one comes up with an actual convincing argument. P.S. If you are interested in knowing what flaws I was talking about, you can edit my question and see the previous edits.

    Read the article

  • SetWindowHookEx and execution blocking

    - by Kalaz
    Hello, I just wonder... I mainly use .NET but now I started to investigate WINAPI calls. For example I am using this piece of code to hook to the API functions. It starts freezing, when I try to debug the application... using System; using System.Diagnostics; using System.Runtime.InteropServices; using System.Threading; using System.Windows.Forms; public class Keyboard { private const int WH_KEYBOARD_LL = 13; private const int WM_KEYDOWN = 0x0100; private static LowLevelKeyboardProc _proc = HookCallback; private static IntPtr _hookID = IntPtr.Zero; public static event Action<Keys,bool, bool> KeyDown; public static void Hook() { new Thread(new ThreadStart(()=> { _hookID = SetHook(_proc); Application.Run(); })).Start(); } public static void Unhook() { UnhookWindowsHookEx(_hookID); } private static IntPtr SetHook(LowLevelKeyboardProc proc) { using (Process curProcess = Process.GetCurrentProcess()) using (ProcessModule curModule = curProcess.MainModule) { return SetWindowsHookEx(WH_KEYBOARD_LL, proc, GetModuleHandle(curModule.ModuleName), 0); } } private delegate IntPtr LowLevelKeyboardProc( int nCode, IntPtr wParam, IntPtr lParam); private static IntPtr HookCallback( int nCode, IntPtr wParam, IntPtr lParam) { if (nCode >= 0 && wParam == (IntPtr)WM_KEYDOWN) { int vkCode = Marshal.ReadInt32(lParam); Keys k = (Keys) vkCode; if (KeyDown != null) { KeyDown.BeginInvoke(k, IsKeyPressed(VirtualKeyStates.VK_CONTROL), IsKeyPressed(VirtualKeyStates.VK_SHIFT),null,null); } } return CallNextHookEx(_hookID, nCode, wParam, lParam); } private static bool IsKeyPressed(VirtualKeyStates virtualKeyStates) { return (GetKeyState(virtualKeyStates) & (1 << 7))==128; } [DllImport("user32.dll", CharSet = CharSet.Auto, SetLastError = true)] private static extern IntPtr SetWindowsHookEx(int idHook, LowLevelKeyboardProc lpfn, IntPtr hMod, uint dwThreadId); [DllImport("user32.dll", CharSet = CharSet.Auto, SetLastError = true)] [return: MarshalAs(UnmanagedType.Bool)] private static extern bool UnhookWindowsHookEx(IntPtr hhk); [DllImport("user32.dll", CharSet = CharSet.Auto, SetLastError = true)] private static extern IntPtr CallNextHookEx(IntPtr hhk, int nCode, IntPtr wParam, IntPtr lParam); [DllImport("kernel32.dll", CharSet = CharSet.Auto, SetLastError = true)] private static extern IntPtr GetModuleHandle(string lpModuleName); [DllImport("user32.dll")] static extern short GetKeyState(VirtualKeyStates nVirtKey); } enum VirtualKeyStates : int { VK_LBUTTON = 0x01, VK_RBUTTON = 0x02, VK_CANCEL = 0x03, VK_MBUTTON = 0x04, // VK_XBUTTON1 = 0x05, VK_XBUTTON2 = 0x06, // VK_BACK = 0x08, VK_TAB = 0x09, // VK_CLEAR = 0x0C, VK_RETURN = 0x0D, // VK_SHIFT = 0x10, VK_CONTROL = 0x11, VK_MENU = 0x12, VK_PAUSE = 0x13, VK_CAPITAL = 0x14, // VK_KANA = 0x15, VK_HANGEUL = 0x15, /* old name - should be here for compatibility */ VK_HANGUL = 0x15, VK_JUNJA = 0x17, VK_FINAL = 0x18, VK_HANJA = 0x19, VK_KANJI = 0x19, // VK_ESCAPE = 0x1B, // VK_CONVERT = 0x1C, VK_NONCONVERT = 0x1D, VK_ACCEPT = 0x1E, VK_MODECHANGE = 0x1F, // VK_SPACE = 0x20, VK_PRIOR = 0x21, VK_NEXT = 0x22, VK_END = 0x23, VK_HOME = 0x24, VK_LEFT = 0x25, VK_UP = 0x26, VK_RIGHT = 0x27, VK_DOWN = 0x28, VK_SELECT = 0x29, VK_PRINT = 0x2A, VK_EXECUTE = 0x2B, VK_SNAPSHOT = 0x2C, VK_INSERT = 0x2D, VK_DELETE = 0x2E, VK_HELP = 0x2F, // VK_LWIN = 0x5B, VK_RWIN = 0x5C, VK_APPS = 0x5D, // VK_SLEEP = 0x5F, // VK_NUMPAD0 = 0x60, VK_NUMPAD1 = 0x61, VK_NUMPAD2 = 0x62, VK_NUMPAD3 = 0x63, VK_NUMPAD4 = 0x64, VK_NUMPAD5 = 0x65, VK_NUMPAD6 = 0x66, VK_NUMPAD7 = 0x67, VK_NUMPAD8 = 0x68, VK_NUMPAD9 = 0x69, VK_MULTIPLY = 0x6A, VK_ADD = 0x6B, VK_SEPARATOR = 0x6C, VK_SUBTRACT = 0x6D, VK_DECIMAL = 0x6E, VK_DIVIDE = 0x6F, VK_F1 = 0x70, VK_F2 = 0x71, VK_F3 = 0x72, VK_F4 = 0x73, VK_F5 = 0x74, VK_F6 = 0x75, VK_F7 = 0x76, VK_F8 = 0x77, VK_F9 = 0x78, VK_F10 = 0x79, VK_F11 = 0x7A, VK_F12 = 0x7B, VK_F13 = 0x7C, VK_F14 = 0x7D, VK_F15 = 0x7E, VK_F16 = 0x7F, VK_F17 = 0x80, VK_F18 = 0x81, VK_F19 = 0x82, VK_F20 = 0x83, VK_F21 = 0x84, VK_F22 = 0x85, VK_F23 = 0x86, VK_F24 = 0x87, // VK_NUMLOCK = 0x90, VK_SCROLL = 0x91, // VK_OEM_NEC_EQUAL = 0x92, // '=' key on numpad // VK_OEM_FJ_JISHO = 0x92, // 'Dictionary' key VK_OEM_FJ_MASSHOU = 0x93, // 'Unregister word' key VK_OEM_FJ_TOUROKU = 0x94, // 'Register word' key VK_OEM_FJ_LOYA = 0x95, // 'Left OYAYUBI' key VK_OEM_FJ_ROYA = 0x96, // 'Right OYAYUBI' key // VK_LSHIFT = 0xA0, VK_RSHIFT = 0xA1, VK_LCONTROL = 0xA2, VK_RCONTROL = 0xA3, VK_LMENU = 0xA4, VK_RMENU = 0xA5, // VK_BROWSER_BACK = 0xA6, VK_BROWSER_FORWARD = 0xA7, VK_BROWSER_REFRESH = 0xA8, VK_BROWSER_STOP = 0xA9, VK_BROWSER_SEARCH = 0xAA, VK_BROWSER_FAVORITES = 0xAB, VK_BROWSER_HOME = 0xAC, // VK_VOLUME_MUTE = 0xAD, VK_VOLUME_DOWN = 0xAE, VK_VOLUME_UP = 0xAF, VK_MEDIA_NEXT_TRACK = 0xB0, VK_MEDIA_PREV_TRACK = 0xB1, VK_MEDIA_STOP = 0xB2, VK_MEDIA_PLAY_PAUSE = 0xB3, VK_LAUNCH_MAIL = 0xB4, VK_LAUNCH_MEDIA_SELECT = 0xB5, VK_LAUNCH_APP1 = 0xB6, VK_LAUNCH_APP2 = 0xB7, // VK_OEM_1 = 0xBA, // ';:' for US VK_OEM_PLUS = 0xBB, // '+' any country VK_OEM_COMMA = 0xBC, // ',' any country VK_OEM_MINUS = 0xBD, // '-' any country VK_OEM_PERIOD = 0xBE, // '.' any country VK_OEM_2 = 0xBF, // '/?' for US VK_OEM_3 = 0xC0, // '`~' for US // VK_OEM_4 = 0xDB, // '[{' for US VK_OEM_5 = 0xDC, // '\|' for US VK_OEM_6 = 0xDD, // ']}' for US VK_OEM_7 = 0xDE, // ''"' for US VK_OEM_8 = 0xDF, // VK_OEM_AX = 0xE1, // 'AX' key on Japanese AX kbd VK_OEM_102 = 0xE2, // "<>" or "\|" on RT 102-key kbd. VK_ICO_HELP = 0xE3, // Help key on ICO VK_ICO_00 = 0xE4, // 00 key on ICO // VK_PROCESSKEY = 0xE5, // VK_ICO_CLEAR = 0xE6, // VK_PACKET = 0xE7, // VK_OEM_RESET = 0xE9, VK_OEM_JUMP = 0xEA, VK_OEM_PA1 = 0xEB, VK_OEM_PA2 = 0xEC, VK_OEM_PA3 = 0xED, VK_OEM_WSCTRL = 0xEE, VK_OEM_CUSEL = 0xEF, VK_OEM_ATTN = 0xF0, VK_OEM_FINISH = 0xF1, VK_OEM_COPY = 0xF2, VK_OEM_AUTO = 0xF3, VK_OEM_ENLW = 0xF4, VK_OEM_BACKTAB = 0xF5, // VK_ATTN = 0xF6, VK_CRSEL = 0xF7, VK_EXSEL = 0xF8, VK_EREOF = 0xF9, VK_PLAY = 0xFA, VK_ZOOM = 0xFB, VK_NONAME = 0xFC, VK_PA1 = 0xFD, VK_OEM_CLEAR = 0xFE } It works well even if you put messagebox into the event or something that blocks execution. But it gets bad if you try to put breakpoint into the event. Why? I mean event is not run in the same thread that the windows hook is. That means that It shouldn't block HookCallback. It does however... I would really like to know why is this happening. My theory is that Visual Studio when breaking execution temporarily stops all threads and that means that HookCallback is blocked... Is there any book or valuable resource that would explain concepts behind all of this threading?

    Read the article

  • Application is crash..

    - by user338322
    Below is my crash Report. 0 0x326712f8 in prepareForMethodLookup () 1 0x3266cf5c in lookUpMethod () 2 0x32668f28 in objc_msgSend_uncached () 3 0x33f70996 in NSPopAutoreleasePool () 4 0x33f82a6c in -[NSAutoreleasePool drain] () 5 0x00003d3e in -[CameraViewcontroller save:] (self=0x811400, _cmd=0x319c00d4, number=0x11e210) at /Users/hardikrathore/Desktop/LiveVideoRecording/Classes/CameraViewcontroller.m:266 6 0x33f36f8a in __NSFireDelayedPerform () 7 0x32da44c2 in CFRunLoopRunSpecific () 8 0x32da3c1e in CFRunLoopRunInMode () 9 0x31bb9374 in GSEventRunModal () 10 0x30bf3c30 in -[UIApplication _run] () 11 0x30bf2230 in UIApplicationMain () 12 0x00002650 in main (argc=1, argv=0x2ffff474) at /Users/hardikrathore/Desktop/LiveVideoRecording/main.m:14 And this is the code. lines, where I am getting the error. -(void)save:(id)number { NSAutoreleasePool *pool = [[NSAutoreleasePool alloc] init]; j =[number intValue]; while(screens[j] != NULL){ NSLog(@" image made : %d",j); UIImage * image = [UIImage imageWithCGImage:screens[j]]; image=[self imageByCropping:image toRect:CGRectMake(0, 0, 320, 240)]; NSData *imgdata = UIImageJPEGRepresentation(image,0.3); [image release]; CGImageRelease(screens[j]); screens[j] = NULL; UIImage * image1 = [UIImage imageWithCGImage:screens[j+1]]; image1=[self imageByCropping:image1 toRect:CGRectMake(0, 0, 320, 240)]; NSData *imgdata1 = UIImageJPEGRepresentation(image1,0.3); [image1 release]; CGImageRelease(screens[j+1]); screens[j+1] = NULL; NSString *urlString=@"http://www.test.itmate4.com/iPhoneToServerTwice.php"; // setting up the request object now NSMutableURLRequest *request = [[NSMutableURLRequest alloc]init]; [request setURL:[NSURL URLWithString:urlString]]; [request setHTTPMethod:@"POST"]; NSString *fileName=[VideoID stringByAppendingString:@"_"]; fileName=[fileName stringByAppendingString:[NSString stringWithFormat:@"%d",k]]; NSString *fileName2=[VideoID stringByAppendingString:@"_"]; fileName2=[fileName2 stringByAppendingString:[NSString stringWithFormat:@"%d",k+1]]; /* add some header info now we always need a boundary when we post a file also we need to set the content type You might want to generate a random boundary.. this is just the same as my output from wireshark on a valid html post */ NSString *boundary = [NSString stringWithString:@"---------------------------14737809831466499882746641449"]; NSString *contentType = [NSString stringWithFormat:@"multipart/form-data; boundary=%@",boundary]; [request addValue:contentType forHTTPHeaderField: @"Content-Type"]; /* now lets create the body of the post */ //NSString *count=[NSString stringWithFormat:@"%d",front];; NSMutableData *body = [NSMutableData data]; [body appendData:[[NSString stringWithFormat:@"\r\n--%@\r\n",boundary] dataUsingEncoding:NSUTF8StringEncoding]]; //[body appendData:[[NSString stringWithFormat:@"Content-Disposition: form-data; name=\"userfile\"; count=\"@\"";filename=\"%@.jpg\"\r\n",count,fileName] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[[NSString stringWithFormat:@"Content-Disposition: form-data; name=\"userfile\"; filename=\"%@.jpg\"\r\n",fileName] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[[NSString stringWithString:@"Content-Type: application/octet-stream\r\n\r\n"] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[NSData dataWithData:imgdata]]; [body appendData:[[NSString stringWithFormat:@"\r\n--%@--\r\n",boundary] dataUsingEncoding:NSUTF8StringEncoding]]; //second boundary NSString *string1 = [[NSString alloc] initWithFormat:@"\r\n--%@\r\n",boundary]; NSString *string2 =[[NSString alloc] initWithFormat:@"Content-Disposition: form-data; name=\"userfile2\"; filename=\"%@.jpg\"\r\n",fileName2]; NSString *string3 =[[NSString alloc] initWithFormat:@"\r\n--%@--\r\n",boundary]; [body appendData:[string1 dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[string2 dataUsingEncoding:NSUTF8StringEncoding]]; //experiment //[body appendData:[[NSString stringWithFormat:@"Content-Disposition: form-data; name=\"userfile2\"; filename=\"%@.jpg\"\r\n",fileName2] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[[NSString stringWithString:@"Content-Type: application/octet-stream\r\n\r\n"] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[NSData dataWithData:imgdata1]]; //[body appendData:[[NSString stringWithFormat:@"\r\n--%@--\r\n",boundary] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[string3 dataUsingEncoding:NSUTF8StringEncoding]]; // setting the body of the post to the reqeust [request setHTTPBody:body]; // now lets make the connection to the web NSData *returnData = [NSURLConnection sendSynchronousRequest:request returningResponse:nil error:nil]; NSString *returnString = [[NSString alloc] initWithData:returnData encoding:NSUTF8StringEncoding]; if([returnString isEqualToString:@"SUCCESS"]) { NSLog(returnString); k=k+2; j=j+2; [self performSelectorInBackground:@selector(save:) withObject:(id)[NSNumber numberWithInt:j]]; } //k=k+2; [imgdata release]; [imgdata1 release]; [NSThread sleepForTimeInterval:.01]; } [pool drain]; <-------------Line 266 } As you can see in log report. I am getting the error, Line 266. Some autorelease problem Any help !!!? coz I am not getting why its happening.

    Read the article

  • 12c - Silly little trick with invisibility...

    - by noreply(at)blogger.com (Thomas Kyte)
    This is interesting, if you hide and then unhide a column - it will end up at the "end" of the table.  Consider:ops$tkyte%ORA12CR1> create table t ( a int, b int, c int );Table created.ops$tkyte%ORA12CR1>ops$tkyte%ORA12CR1> desc t; Name                                                  Null?    Type ----------------------------------------------------- -------- ------------------------------------ A                                                              NUMBER(38) B                                                              NUMBER(38) C                                                              NUMBER(38)ops$tkyte%ORA12CR1> alter table t modify (a invisible);Table altered.ops$tkyte%ORA12CR1> alter table t modify (a visible);Table altered.ops$tkyte%ORA12CR1> desc t; Name                                                  Null?    Type ----------------------------------------------------- -------- ------------------------------------ B                                                              NUMBER(38) C                                                              NUMBER(38) A                                                              NUMBER(38)Now, that means you can add a column or shuffle them around.  What if we had just added A to the table and really really wanted A to be first.  My first approach would be "that is what editioning views are great at".  If I couldn't use an editioning view for whatever reason - we could shuffle the columns:ops$tkyte%ORA12CR1> alter table t modify (b invisible);Table altered.ops$tkyte%ORA12CR1> alter table t modify (c invisible);Table altered.ops$tkyte%ORA12CR1> alter table t modify (b visible);Table altered.ops$tkyte%ORA12CR1> alter table t modify (c visible);Table altered.ops$tkyte%ORA12CR1>ops$tkyte%ORA12CR1> desc t; Name                                                  Null?    Type ----------------------------------------------------- -------- ------------------------------------ A                                                              NUMBER(38) B                                                              NUMBER(38) C                                                              NUMBER(38)Note: that could cause some serious invalidations in your database - so make sure you are a) aware of that b) willing to pay that penalty and c) really really really want A to be first in the table!

    Read the article

  • Create a kind of Interface c++ [migrated]

    - by Liuka
    I'm writing a little 2d rendering framework with managers for input and resources like textures and meshes (for 2d geometry models, like quads) and they are all contained in a class "engine" that interacts with them and with a directX class. So each class have some public methods like init or update. They are called by the engine class to render the resources, create them, but a lot of them should not be called by the user: //in pseudo c++ //the textures manager class class TManager { private: vector textures; .... public: init(); update(); renderTexture(); //called by the "engine class" loadtexture(); gettexture(); //called by the user } class Engine { private: Tmanager texManager; public: Init() { //initialize all the managers } Render(){...} Update(){...} Tmanager* GetTManager(){return &texManager;} //to get a pointer to the manager //if i want to create or get textures } In this way the user, calling Engine::GetTmanager will have access to all the public methods of Tmanager, including init update and rendertexture, that must be called only by Engine inside its init, render and update functions. So, is it a good idea to implement a user interface in the following way? //in pseudo c++ //the textures manager class class TManager { private: vector textures; .... public: init(); update(); renderTexture(); //called by the "engine class" friend class Tmanager_UserInterface; operator Tmanager_UserInterface*(){return reinterpret_cast<Tmanager_UserInterface*>(this)} } class Tmanager_UserInterface : private Tmanager { //delete constructor //in this class there will be only methods like: loadtexture(); gettexture(); } class Engine { private: Tmanager texManager; public: Init() Render() Update() Tmanager_UserInterface* GetTManager(){return texManager;} } //in main function //i need to load a texture //i always have access to Engine class engine-GetTmanger()-LoadTexture(...) //i can just access load and get texture; In this way i can implement several interface for each object, keeping visible only the functions i (and the user) will need. There are better ways to do the same?? Or is it just useless(i dont hide the "framework private functions" and the user will learn to dont call them)? Before i have used this method: class manager { public: //engine functions userfunction(); } class engine { private: manager m; public: init(){//call manager init function} manageruserfunciton() { //call manager::userfunction() } } in this way i have no access to the manager class but it's a bad way because if i add a new feature to the manager i need to add a new method in the engine class and it takes a lot of time. sorry for the bad english.

    Read the article

  • returning a heap block by reference in c++

    - by basicR
    I was trying to brush up my c++ skills. I got 2 functions: concat_HeapVal() returns the output heap variable by value concat_HeapRef() returns the output heap variable by reference When main() runs it will be on stack,s1 and s2 will be on stack, I pass the value by ref only and in each of the below functions, I create a variable on heap and concat them. When concat_HeapVal() is called it returns me the correct output. When concat_HeapRef() is called it returns me some memory address (wrong output). Why? I use new operator in both the functions. Hence it allocates on heap. So when I return by reference, heap will still be VALID even when my main() stack memory goes out of scope. So it's left to OS to cleanup the memory. Right? string& concat_HeapRef(const string& s1, const string& s2) { string *temp = new string(); temp->append(s1); temp->append(s2); return *temp; } string* concat_HeapVal(const string& s1, const string& s2) { string *temp = new string(); temp->append(s1); temp->append(s2); return temp; } int main() { string s1,s2; string heapOPRef; string *heapOPVal; cout<<"String Conact Experimentations\n"; cout<<"Enter s-1 : "; cin>>s1; cout<<"Enter s-2 : "; cin>>s2; heapOPRef = concat_HeapRef(s1,s2); heapOPVal = concat_HeapVal(s1,s2); cout<<heapOPRef<<" "<<heapOPVal<<" "<<endl; return -9; }

    Read the article

< Previous Page | 412 413 414 415 416 417 418 419 420 421 422 423  | Next Page >