Search Results

Search found 45696 results on 1828 pages for 'system componentmodel'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 428/1828 | < Previous Page | 424 425 426 427 428 429 430 431 432 433 434 435  | Next Page >

  • MSSQL Search Proper Names Full Text Index vs LIKE + SOUNDEX

    - by Matthew Talbert
    I have a database of names of people that has (currently) 35 million rows. I need to know what is the best method for quickly searching these names. The current system (not designed by me), simply has the first and last name columns indexed and uses "LIKE" queries with the additional option of using SOUNDEX (though I'm not sure this is actually used much). Performance has always been a problem with this system, and so currently the searches are limited to 200 results (which still takes too long to run). So, I have a few questions: Does full text index work well for proper names? If so, what is the best way to query proper names? (CONTAINS, FREETEXT, etc) Is there some other system (like Lucene.net) that would be better? Just for reference, I'm using Fluent NHibernate for data access, so methods that work will with that will be preferred. I'm using MS SQL 2008 currently.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Should I worry about the integrity of my linux software RAID5 after a crash or kernel panic?

    - by Josh
    I have a dual core Intel i5 Ubuntu Server 10.04 LTS system running kernel 2.6.32-22-server #33-Ubuntu SMP with three 1TB SATA hard drives set up in a RAID5 array using linux md devices. I have read about the RAID5 write hole and am concerned: if my linux system locks up or kernel panics, should I be assume that the integrety of my data has been compromised and restore from backup? How can I know if the data on the RAID5 array is "safe"?

    Read the article

  • How to take a screenshot with Mono C#?

    - by vagabond
    I'm trying to use use code get a screenshot in Mono C# but I'm getting a System.NotImplementedException when I call CopyFromScreen. My code works with .NET, so is there an alternate way of getting a screenshot using Mono? Bitmap bitmap = new Bitmap(Screen.PrimaryScreen.Bounds.Width, Screen.PrimaryScreen.Bounds.Height); Graphics graphics = Graphics.FromImage(bitmap as Image); graphics.CopyFromScreen(0, 0, 0, 0, bitmap.Size); System.IO.MemoryStream memoryStream = new System.IO.MemoryStream(); bitmap.Save(memoryStream, imageFormat); bitmap.Save(@"\tmp\screenshot.png", ImageFormat.Png); I am using Mono JIT compiler version 2.4.2.3 (Debian 2.4.2.3+dfsg-2)

    Read the article

  • WxPython Incompatible With Snow Leopard?

    - by Alex
    Hello all, Recently I upgraded to Snow Leopard, and now I can't run programs built with wxPython. The errors I get are (from Eclipse + PyDev): import wx File "/var/tmp/wxWidgets/wxWidgets-13~231/2.6/DSTROOT/System/Library/Frameworks /Python.framework/Versions/2.6/Extras/lib/ python/wx-2.8-mac-unicode/wx/__init__.py", line 45, in <module> File "/var/tmp/wxWidgets/wxWidgets-13~231/2.6/DSTROOT /System/Library/Frameworks/Python.framework/Versions/2.6/Extras/lib /python/wx-2.8-mac-unicode/wx/_core.py", line 4, in <module> ImportError:/System/Library/Frameworks /Python.framework/Versions/2.6/Extras/lib/python /wx-2.8-mac-unicode/wx/_core_.so: no appropriate 64-bit architecture (see "man python" for running in 32-bit mode) I don't really understand them and would appreciate if you could help me to do so, also, if you do know what's going on, how can I go about fixing them? Maybe this has something to do with the fact that Snow Leopard is 64-bit? Thanks!!

    Read the article

  • Loop doesn't update listboxes until it is done iterating

    - by Justen
    I have a loop that takes file name from a listbox, performs a system() call, then moves that filename to another listbox. Problem is, it doesn't move the filenames over one at a time, but waits until the entire loop is finished and moves them all at once. What would I do to get it to perform how I want it to? the loop: for each( String^% file in filename ) { int x = convert( file ); lbComplete->Items->Add( lbFiles->Items[0] ); // place the completed file lbFiles->Items->Remove( lbFiles->Items[0] ); // in the other listbox } The function convert() that contains the system call: int convert( String^ file ) { std::stringstream ss; std::string dir, fileAddress, fileName, outputDir; ... return system( ss.str().c_str() ); }

    Read the article

  • Why its not working?

    - by Andrew Hoffmann
    BinaryReader br = new BinaryReader(Console.OpenStandardInput()); BinaryWriter bw = new BinaryWriter(Console.OpenStandardOutput()); int n = br.ReadInt32(); bw.Write(n); always getting this error: Unhandled Exception: System.IO.EndOfStreamException: Failed to read past end of stream. at System.IO.BinaryReader.FillBuffer (Int32 numBytes) [0x00000] in <filename unknown>:0 at System.IO.BinaryReader.ReadInt32 () [0x00000] in <filename unknown>:0 at Program.Main () [0x00025] in /home/skydos/ACM/Csharp/Csharp/Main.cs:24 Is there any way to make reading data in C# faster from Console?

    Read the article

  • C# LINQ Where Predicate Type Arguments

    - by blu
    I have an XElement with values for mock data. I have an expression to query the xml: Expression<Func<XElement, bool>> simpleXmlFunction = b => int.Parse(b.Element("FooId").Value) == 12; used in: var simpleXml = xml.Elements("Foo").Where(simpleXmlFunction).First(); The design time error is: The type arguments for method 'System.Linq.Enumerable.Where(System.Collections.Generic.IEnumerable, System.Func)' cannot be inferred from the usage. Try specifying the type arguments explicitly' The delegate supplied to Where should take in an XElement and return a bool, marking if the item matches the query, I am not sure how to add anything more to the delegate or the where clause to mark the type. Also, the parallel method for the real function against the Entity Framework does not have this issue. What is not correct with the LINQ-to-XML version?

    Read the article

  • Build Systems for PHP Web Apps

    - by macinjosh
    I want to start automating more of my web development process so I'm looking for a build system. I write mostly PHP apps on Mac OS X and deploy Linux servers over FTP. A lot of my clients have basic hosting providers so shell access to their servers is typically not available, however remote MySQL access is usually present. Here is what I want to do with a build system: When Building: Lint JavaScript Files Validate CSS Files Validate HTML Files Minify and concatenate JS and CSS files Verify PHP Syntax Set Debug/Production flags When Deploying Checkout latest version from SVN Run build process Upload files to server via FTP Run SQL scripts on remote DB I realize this is a lot of work to automate but I think it would be worth it. So what is the best way to start down this path? Is there a system that can handle builds and deploys, or should I search for separate solutions? What systems would you recommend?

    Read the article

  • Why do some games randomly turn my screen a random solid color?

    - by Emlena.PhD
    When playing some games my computer will randomly have an error that I cannot fix without turning it off and back on again. The screen changes to one solid color, which varies (off the top of my head I can remember seeing solid green, magenta, etc..) and the sound blares a single tone. The sound sometimes briefly restores and I can still hear the game sounds and even hear and still be heard by people in my Mumble channel, but the screen doesn't right itself so I'm still blind. What's more is this happens in some games but not in others. While the game is actually running, not while I'm still in the menu. However, it does happen if I'm afk or idle but the game world is still rendering. Games where the error occurs: League of Legends World of Warcraft Trine The Sims 2 Dungeon Defenders Safe games: games where it has never occurred: Tribes: Ascend Star Wars: the Old Republic Battlefield 3 So relatively older games cause the problem while newer games do not? I cannot predict when it will happen, it just seems random. However, if it happens and I try playing the same game further after restart it does appear to occur more frequently after the first time. But if I switch to a safe game it doesn't continue happening. Both of my RAM sticks appear fine, flipped position or either one on their own and games still run, computer still boots. I would think over-heating, but then why not all games? ALso, sometimes it happens immediately after I start playing, within seconds of the 3D world booting up. I'm looking to upgrade very soon so I want to figure out what component or software is fubar and replace/repair it. Any suggestions or recommendations of tools would be helpful. Below is some system information. Dxdiag does not detect any problems. Operating System: Windows 7 Home Premium 64-bit (6.1, Build 7601) Service Pack 1 (7601.win7sp1_gdr.120305-1505) System Manufacturer: Gigabyte Technology Co., Ltd. System Model: EP45-UD3R BIOS: Award Modular BIOS v6.00PG Processor: Intel(R) Core(TM)2 Duo CPU E8500 @ 3.16GHz (2 CPUs), ~3.2GHz Memory: 4096MB RAM DirectX Version: DirectX 11 DxDiag Version: 6.01.7601.17514 64bit Unicode Graphics card name: NVIDIA GeForce GTX 285 Driver Version: 8.17.12.9610 (error has occurred w/several driver versions) Sound: I do not have a sound card, been using motherboard's built in sound)

    Read the article

  • Upgrade from .NET 2.0 to .NET 3.5 problems

    - by Bashir Magomedov
    I’m trying to upgrade our solution from VS2005 .NET 2.0 to VS2008 .NET 3.5. I converted the solution using VS2008 conversion wizard. All the projects (about 50) remained targeting to .NET Framework 2.0., moreover if I’m changing target framework manually for one of the projects, all referenced dll (i.e. System, System.Core, System.Data, etc. are still pointing to Framework 2.0. The only way to completely change targeting framework I found is to remove these references and refer them again using proper version of framework. Doing it manually is not best choice I think. 50 projects ~ 10 references each ~ 0.5 minutes for changing each reference is about 5 hours to complete. Am I missing something? Are there any other ways of converting full solution from .NET 2.0 to .NET 3.5? Thank you.

    Read the article

  • Chrome won't start - Windows 7 x64 is complaining about compatibility

    - by WooYek
    Suddenly Chrome browser does not start, my Windows 7 x64 is complaining: The version of this file is not compatible with the version of Windows you’re running. Check your computer’s system information to see whether you need an x86 (32-bit) or x64 (64-bit) version of the program, and then contact the software publisher. Reinstalling did not help. The things that changed and I have noticed are system updates and Java update. Any ideas, what to do to resolve the issue or troubleshoot it?

    Read the article

  • three out of five file streams wont open, i believe its a problem with my ifstreams.

    - by user320950
    #include<iostream> #include<fstream> #include<cstdlib> #include<iomanip> using namespace std; int main() { ifstream in_stream; // reads itemlist.txt ofstream out_stream1; // writes in items.txt ifstream in_stream2; // reads pricelist.txt ofstream out_stream3;// writes in plist.txt ifstream in_stream4;// read recipt.txt ofstream out_stream5;// write display.txt int wrong=0; in_stream.open("ITEMLIST.txt", ios::in); // list of avaliable items if( in_stream.fail() )// check to see if itemlist.txt is open { wrong++; cout << " the error occured here0, you have " << wrong++ << " errors" << endl; cout << "Error opening the file\n" << endl; exit(1); } else{ cout << " System ran correctly " << endl; out_stream1.open("ITEMLIST.txt", ios::out); // list of avaliable items if(out_stream1.fail() )// check to see if itemlist.txt is open { wrong++; cout << " the error occured here1, you have " << wrong++ << " errors" << endl; cout << "Error opening the file\n"; exit(1); } else{ cout << " System ran correctly " << endl; } in_stream2.open("PRICELIST.txt", ios::in); if( in_stream2.fail() ) { wrong++; cout << " the error occured here2, you have " << wrong++ << " errors" << endl; cout << "Error opening the file\n"; exit (1); } else{ cout << " System ran correctly " << endl; } out_stream3.open("PRICELIST.txt", ios::out); if(out_stream3.fail() ) { wrong++; cout << " the error occured here3, you have " << wrong++ << " errors" << endl; cout << "Error opening the file\n"; exit (1); } else{ cout << " System ran correctly " << endl; } in_stream4.open("display.txt", ios::in); if( in_stream4.fail() ) { wrong++; cout << " the error occured here4, you have " << wrong++ << " errors" << endl; cout << "Error opening the file\n"; exit (1); } else{ cout << " System ran correctly " << endl; } out_stream5.open("display.txt", ios::out); if( out_stream5.fail() ) { wrong++; cout << " the error occured here5, you have " << wrong++ << " errors" << endl; cout << "Error opening the file\n"; exit (1); } else{ cout << " System ran correctly " << endl; }

    Read the article

  • ASP.NET: Turning on errors

    - by JamesBrownIsDead
    This is what I see when I visit my web site. How do I instead get the Yellow Screen of Death so I know what the error is? I have GoDaddy shared hosting and I think the problem is that I don't have the correct MVC binaries in the /bin folder. My web.config shows this: <add assembly="System.Web.Mvc, Version=2.0.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"/> <add assembly="System.Web.Abstractions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"/> <add assembly="System.Web.Routing, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"/> But I'm not positive I copied the right .DLL files into /bin. I've got like 8 of each file--which version is which?!

    Read the article

  • BlackBerry - Exception with null message when sending sms using Connector

    - by vikram deshpande
    I used code given but I am getting "IOCancelledException" and "IOException". And IOCancelledException.getMessage() / IOException.getMessage() giving null string, it does not give error message. Please help me understaing reason. class SMSThread extends Thread { Thread myThread; MessageConnection msgConn; String message; String mobilenumber; public SMSThread(String textMsg, String mobileNumber) { message = textMsg; mobilenumber = mobileNumber; } public void run() { try { msgConn = (MessageConnection) Connector.open("sms://+" + mobilenumber); TextMessage text = (TextMessage) msgConn .newMessage(MessageConnection.TEXT_MESSAGE); text.setPayloadText(message); msgConn.send(text); msgConn.close(); } catch (IOCancelledException ioce) { System.out .println("IOCancelledException: " + ioce.getMessage()); } catch (IOException ioe) { System.out.println("IOException: " + ioe.getMessage()); } catch (Exception e) { System.out.println("Exception: " + e); } } }

    Read the article

  • Routing and Remote Access Service won't start after full disk

    - by NKCSS
    The HDD of the server was out of disk space, and after a reboot, RRAS won't start anymore on my 2008 R2 server. Error Details: Log Name: System Source: RemoteAccess Date: 2/5/2012 9:39:52 PM Event ID: 20153 Task Category: None Level: Error Keywords: Classic User: N/A Computer: Windows14111.<snip> Description: The currently configured accounting provider failed to load and initialize successfully. The connection was prevented because of a policy configured on your RAS/VPN server. Specifically, the authentication method used by the server to verify your username and password may not match the authentication method configured in your connection profile. Please contact the Administrator of the RAS server and notify them of this error. Event Xml: <Event xmlns="http://schemas.microsoft.com/win/2004/08/events/event"> <System> <Provider Name="RemoteAccess" /> <EventID Qualifiers="0">20153</EventID> <Level>2</Level> <Task>0</Task> <Keywords>0x80000000000000</Keywords> <TimeCreated SystemTime="2012-02-05T20:39:52.000Z" /> <EventRecordID>12148869</EventRecordID> <Channel>System</Channel> <Computer>Windows14111.<snip></Computer> <Security /> </System> <EventData> <Data>The connection was prevented because of a policy configured on your RAS/VPN server. Specifically, the authentication method used by the server to verify your username and password may not match the authentication method configured in your connection profile. Please contact the Administrator of the RAS server and notify them of this error.</Data> <Binary>2C030000</Binary> </EventData> </Event> I think it has something to do with a corrupt config file, but I am unsure of what to do. I Removed the RRAS role, rebooted, and re-added, but it keeps failing with the same error. Thanks in advance. [UPDATE] If i set the accounting provider from 'Windows' to '' the service starts but VPN won't work. Any ideas how this can be repaired?

    Read the article

  • WebConfigurationManager error after adding siteMap

    - by aron
    Hello I'm getting this error: Compiler Error Message: CS0118: 'Configuration' is a 'namespace' but is used like a 'type' Configuration myWebConfig = WebConfigurationManager.OpenWebConfiguration("~/"); This code has been in place for 5+ months without this issues, only today after adding this sitemap code do I have this issue. <siteMap defaultProvider="ExtendedSiteMapProvider" enabled="true"> <providers> <clear/> <add name="ExtendedSiteMapProvider" type="Configuration.ExtendedSiteMapProvider" siteMapFile="Web.sitemap" securityTrimmingEnabled="true"/> </providers> </siteMap> I tried adding "System.Web." before the "Configuration ", but that did not work either: System.Web.Configuration myWebConfig = WebConfigurationManager.OpenWebConfiguration("~/"); Error 1 'System.Web.Configuration' is a 'namespace' but is used like a 'type'

    Read the article

  • Trying to create text boxes dynammically and remove them

    - by fari
    I am using VB.NET vb 2008 . I am trying to create text boxes dynammically and remove them here is the code i have written so far Private Sub setTextBox() Dim num As Integer Dim pos As Integer num = Len(word) temp = String.Copy(word) Dim intcount As Integer remove() GuessBox.Visible = True letters.Visible = True pos = 0 'To create the dynamic text box and add the controls For intcount = 0 To num - 1 Txtdynamic = New TextBox Txtdynamic.Width = 20 Txtdynamic.Visible = True Txtdynamic.MaxLength = 1 Txtdynamic.Location = New Point(pos + 5, 0) pos = pos + 30 'set the font size Txtdynamic.Font = New System.Drawing.Font("Verdana", 8.25!, System.Drawing.FontStyle.Regular, System.Drawing.GraphicsUnit.Point, CType(0, Byte)) Txtdynamic.Name = "txtdynamic_" & intcount & "_mycntrl" Txtdynamic.Enabled = False Txtdynamic.Text = "" Panel1.Controls.Add(Txtdynamic) Next Panel1.Visible = True Controls.Add(Panel1) Controls.Add(GuessBox) Controls.Add(letters) letter = "" letters.Text = "" hang_lable.Text = "" tries = 0 End Sub`enter code here` Function remove() For Each ctrl In Panel1.Controls Panel1.Controls.Remove(ctrl) Next End Function I am able to create the textboxes but only a few of them are removed. by using For Each ctrl In Panel1.Controls it doesn't retrieve all the controls and some ae duplicated as well.

    Read the article

  • How to delete a file with a space at end of the name and hidden attributes?

    - by Dr. Zim
    We have a hidden file with a space at the end of the file name. Usually, I take ownership of the file, then use a command line rename with the 8.3 (dir/x) file name. However, rename doesn't acknowledge hidden or system files. Any ideas on how to remove it? The original creator cannot access the file. The system is a Windows 2003 server with NTFS and SMB file sharing (normal windows file sharing).

    Read the article

  • Bypassing "Found New Hardware Wizard" / Setting Windows to Install Drivers Automatically

    - by Synetech inc.
    Hi, My motherboard finally died after the better part of a decade, so I bought a used system. I put my old hard-drive and sound-card in the new system, and connected my old keyboard and mouse (the rest of the components—CPU, RAM, mobo, video card—are from the new system). I knew beforehand that it would be a challenge to get Windows to boot and install drivers for the new hardware (particularly since the foundational components are new), but I am completely unable to even attempt to get through the work of installing drivers for things like the video card because the keyboard and mouse won't work (they do work, in the BIOS screen, in DOS mode, in Windows 7, in XP's boot menu, etc., just not in Windows XP itself). Whenever I try to boot XP (in normal or safe mode), I get a bunch of balloons popping up for all the new hardware detected, and a New Hardware Found Wizard for Processor (obviously it has to install drivers for the lowest-level components on up). Unfortunately I cannot click Next since the keyboard and mouse won't work yet because the motherboard drivers (for the PS/2 or USB ports) are not yet installed. I even tried a serial mouse, but to no avail—again, it does work in DOS, 7, etc., but not XP because it doesn't have the serial port driver installed. I tried mounting the SOFTWARE and SYSTEM hives under Windows 7 in order to manually set the "unsigned drivers warning" to ignore (using both of the driver-signing policy settings that I found references to). That didn't work; I still get the wizard. They are not even fancy, proprietary, third-party, or unsigned drivers. They are drivers that come with Windows—as the drivers for CPU, RAM, IDE controller, etc. tend to be. And the keyboard and mouse drivers are the generic ones at that (but like I said, those are irrelevant since the drivers for the ports that they are connected to are not yet installed). Obviously at some point in time over the past several years, a setting got changed to make Windows always prompt me when it detects new hardware. (It was also configured to show the Shutdown Event Tracker on abnormal shutdowns, so I had to turn that off so that I could even see the desktop.) Oh, and I tried deleting all of the PNF files so that they get regenerated, but that too did not help. Does anyone know how I can reset Windows to at least try to automatically install drivers for new hardware before prompting me if it fails? Conversely, does anyone know how exactly one turns off automatic driver installation (and prompt with the wizard)? Thanks a lot.

    Read the article

  • Tomcat not showing Spring Context initialization errors when running from Eclipse WTP

    - by SourceRebels
    Hi all, Im working with Eclipse Galileo (WTP), Spring 2.5.6-SEC01 and Apache Tomcat 5.5.28. When I run my application from Eclipse, I'm able to see Tomcat standard output and error from the console view. When there is a Spring initialization error (ex: malformed spring XML) I'm not able to see the error message or the stacktrace at the Console view. Anyone found before a problem like this? how you solve it? Thanks in advance, I'm getting mad :-) Edited: I'm seeing all Tomcat startup messages and my System.out.println and System.err.println messages in Eclipse Console. I also try to pass this two system properties to my Tomcat Server: -Djava.util.logging.manager="org.apache.juli.ClassLoaderLogManager" -Djava.util.logging.config.file="C:\apache-tomcat-5.5.28\conf\logging.properties"

    Read the article

  • Can't Use Path in ASP MVC Action

    - by user1477388
    I am trying to use Path() but it has a blue line under it and says, "local variable (path) cannot be referred to until it is declared." How can I use Path()? Imports System.Globalization Imports System.IO Public Class MessageController Inherits System.Web.Mvc.Controller <EmployeeAuthorize()> <HttpPost()> Function SendReply(ByVal id As Integer, ByVal message As String, ByVal files As IEnumerable(Of HttpPostedFileBase)) As JsonResult ' upload files For Each i In files If (i.ContentLength > 0) Then Dim fileName = path.GetFileName(i.FileName) Dim path = path.Combine(Server.MapPath("~/App_Data/uploads"), fileName) i.SaveAs(path) End If Next End Function End Class

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 424 425 426 427 428 429 430 431 432 433 434 435  | Next Page >