Search Results

Search found 37765 results on 1511 pages for 'null reference exception'.

Page 443/1511 | < Previous Page | 439 440 441 442 443 444 445 446 447 448 449 450  | Next Page >

• Updating MS Access Database from Datagridview

  - by Peter Roche

  I am trying to update an ms access database from a datagridview. The datagridview is populated on a button click and the database is updated when any cell is modified. The code example I have been using populates on form load and uses the cellendedit event. private OleDbConnection connection = null; private OleDbDataAdapter dataadapter = null; private DataSet ds = null; private void Form2_Load(object sender, EventArgs e) { string connetionString = "Provider=Microsoft.ACE.OLEDB.12.0;Data Source='C:\\Users\\Peter\\Documents\\Visual Studio 2010\\Projects\\StockIT\\StockIT\\bin\\Debug\\StockManagement.accdb';Persist Security Info=True;Jet OLEDB:Database Password="; string sql = "SELECT * FROM StockCount"; connection = new OleDbConnection(connetionString); dataadapter = new OleDbDataAdapter(sql, connection); ds = new DataSet(); connection.Open(); dataadapter.Fill(ds, "Stock"); connection.Close(); dataGridView1.DataSource = ds; dataGridView1.DataMember = "Stock"; } private void addUpadateButton_Click(object sender, EventArgs e) { } private void dataGridView1_CellEndEdit(object sender, DataGridViewCellEventArgs e) { try { dataadapter.Update(ds,"Stock"); } catch (Exception exceptionObj) { MessageBox.Show(exceptionObj.Message.ToString()); } } The error I receive is Update requires a valid UpdateCommand when passed DataRow collection with modified rows. I'm not sure where this command needs to go and how to reference the cell to update the value in the database.

  Read the article

• How to use third party themes in swing application?

  - by swift

  I want to use some third party themes (like synthetica http://www.javasoft.de/synthetica/themes/) in my swing appliaction. i am using eclipse ide, got the jar file of theme and did the following modification(according to the readme file from the theme) in my code try { UIManager.setLookAndFeel(new SyntheticaBlackMoonLookAndFeel()); } catch (Exception e) { e.printStackTrace(); } but after this modification its showing the following error The type de.javasoft.plaf.synthetica.SyntheticaLookAndFeel cannot be resolved. It is indirectly referenced from required .class files what does this mean? i tried searching on net but cant really find any useful answers Contents of Readme file: System Requirements =================== Java SE 5 (JRE 1.5.0) or above Synthetica V2.2.0 or above Integration =========== 1. Ensure that your classpath contains all Synthetica libraries (including Synthetica's core library 'synthetica.jar'). 2. Enable the Synthetica Look and Feel at startup time in your application: import de.javasoft.plaf.synthetica.SyntheticaBlackMoonLookAndFeel; try { UIManager.setLookAndFeel(new SyntheticaBlackMoonLookAndFeel()); } catch (Exception e) { e.printStackTrace(); }

  Read the article

• Qt/C++, Problems with large QImage

  - by David Günzel

  I'm pretty new to C++/Qt and I'm trying to create an application with Visual Studio C++ and Qt (4.8.3). The application displays images using a QGraphicsView, I need to change the images at pixel level. The basic code is (simplified): QImage* img = new QImage(img_width,img_height,QImage::Format_RGB32); while(do_some_stuff) { img->setPixel(x,y,color); } QGraphicsPixmapItem* pm = new QGraphicsPixmapItem(QPixmap::fromImage(*img)); QGraphicsScene* sc = new QGraphicsScene; sc->setSceneRect(0,0,img->width(),img->height()); sc->addItem(pm); ui.graphicsView->setScene(sc); This works well for images up to around 12000x6000 pixel. The weird thing happens beyond this size. When I set img_width=16000 and img_height=8000, for example, the line img = new QImage(...) returns a null image. The image data should be around 512,000,000 bytes, so it shouldn't be too large, even on a 32 bit system. Also, my machine (Win 7 64bit, 8 GB RAM) should be capable of holding the data. I've also tried this version: uchar* imgbuf = (uchar*) malloc(img_width*img_height*4); QImage* img = new QImage(imgbuf,img_width,img_height,QImage::Format_RGB32); At first, this works. The img pointer is valid and calling img-width() for example returns the correct image width (instead of 0, in case the image pointer is null). But as soon as I call img-setPixel(), the pointer becomes null and img-width() returns 0. So what am I doing wrong? Or is there a better way of modifying large images on pixel level? Regards, David

  Read the article

• VBA Excel To SqlServer

  - by adrianm

  What is the best way to write VBA code to connect to SQL Server 2005 from Excel? The users of the excel file might run XP, Vista, Win7 and I want to prevent driver installation as much as possible. My understanding is that XP uses MDAC while Vista/Win7 uses DAC. Does that mean that a reference to MDAC 2.8 will not work on a Vista machine and the other way around? Will my VBA code work on both if I don't add a reference and use late binding, e.g. CreateObject("ADODB.Connection")?

  Read the article

• A SelfHosted WCF Service over Basic HTTP Binding doesn't support more than 1000 concurrent requests

  - by Krishnan

  I have self hosted a WCF Service over BasicHttpBinding consumed by an ASMX Client. I'm simulating a concurrent user load of 1200 users. The service method takes a string parameter and returns a string. The data exchanged is less than 10KB. The processing time for a request is fixed at 2 seconds by having a Thread.Sleep(2000) statement. Nothing additional. I have removed all the DB Hits / business logic. The same piece of code runs fine for 1000 concurrent users. I get the following error when I bump up the number to 1200 users. System.Net.WebException: The underlying connection was closed: An unexpected error occurred on a receive. ---> System.IO.IOException: Unable to read data from the transport connection: An existing connection was forcibly closed by the remote host. ---> System.Net.Sockets.SocketException: An existing connection was forcibly closed by the remote host at System.Net.Sockets.Socket.Receive(Byte[] buffer, Int32 offset, Int32 size, SocketFlags socketFlags) at System.Net.Sockets.NetworkStream.Read(Byte[] buffer, Int32 offset, Int32 size) --- End of inner exception stack trace --- at System.Net.Sockets.NetworkStream.Read(Byte[] buffer, Int32 offset, Int32 size) at System.Net.PooledStream.Read(Byte[] buffer, Int32 offset, Int32 size) at System.Net.Connection.SyncRead(HttpWebRequest request, Boolean userRetrievedStream, Boolean probeRead) --- End of inner exception stack trace --- at System.Web.Services.Protocols.WebClientProtocol.GetWebResponse(WebRequest request) at System.Web.Services.Protocols.HttpWebClientProtocol.GetWebResponse(WebRequest request) at System.Web.Services.Protocols.SoapHttpClientProtocol.Invoke(String methodName, Object[] parameters) at WCF.Throttling.Client.Service.Function2(String param) This exception is often reported on DataContract mismatch and large data exchange. But never when doing a load test. I have browsed enough and have tried most of the options which include, Enabled Trace & Message log on server side. But no errors logged. To overcome Port Exhaustion MaxUserPort is set to 65535, and TcpTimedWaitDelay 30 secs. MaxConcurrent Calls is set to 600, and MaxConcurrentInstances is set to 1200. The Open, Close, Send and Receive Timeouts are set to 10 Minutes. The HTTPWebRequest KeepAlive set to false. I have not been able to nail down the issue for the past two days. Any help would be appreciated. Thank you.

  Read the article

• Java InputReader. Detect if file being read is binary?

  - by Trizicus

  I had posted a question in regards to this code. I found that JTextArea does not support the binary type data that is loaded. So my new question is how can I go about detecting the 'bad' file and canceling the file I/O and telling the user that they need to select a new file? class Open extends SwingWorker<Void, String> { File file; JTextArea jta; Open(File file, JTextArea jta) { this.file = file; this.jta = jta; } @Override protected Void doInBackground() throws Exception { BufferedReader br = null; try { br = new BufferedReader(new FileReader(file)); String line = br.readLine(); while(line != null) { publish(line); line = br.readLine(); } } finally { try { br.close(); } catch (IOException e) { } } return null; } @Override protected void process(List<String> chunks) { for(String s : chunks) jta.append(s + "\n"); } }

  Read the article

• jQuery: Use of undefined constant data assumed 'data'

  - by morpheous

  I am trying to use jQuery to make a synchronous AJAX post to a server, and get a JSON response back. I want to set a javascript variable msg upon successful return This is what my code looks like: $(document).ready(function(){ $('#test').click(function(){ alert('called!'); jQuery.ajax({ async: false, type: 'POST', url: 'http://www.example.com', data: 'id1=1&id2=2,&id3=3', dataType: 'json', success: function(data){ msg = data.msg; }, error: function(xrq, status, et){alert('foobar\'d!');} }); }); [Edit] I was accidentally mixing PHP and Javascript in my previous xode (now corrected). However, I now get this even more cryptic error message: uncaught exception: [Exception... "Component returned failure code: 0x80070057 (NS_ERROR_ILLEGAL_VALUE) [nsIXMLHttpRequest.open]" nsresult: "0x80070057 (NS_ERROR_ILLEGAL_VALUE)" location: "JS frame :: http://ajax.googleapis.com/ajax/libs/jquery/1.3.2/jquery.min.js :: anonymous :: line 19" data: no] What the ... ?

  Read the article

• wcf generated classes and validation application block attributes

  - by Shaboboo

  Hi, I'm new to the validation application block and trying to use it with wcf... I have a wcf service that has data objects with validation rules defined with attributes, using the validation application block . On my client side (WPF), I have a service reference. When I update the service reference the generated classes do not have the validation rules attributes in them. How can I get the rules from the service? Am I missing some step, or is it not possible?

  Read the article

• Raising C# events with an extension method - is it bad?

  - by Kyralessa

  We're all familiar with the horror that is C# event declaration. To ensure thread-safety, the standard is to write something like this: public event EventHandler SomethingHappened; protected virtual void OnSomethingHappened(EventArgs e) { var handler = SomethingHappened; if (handler != null) handler(this, e); } Recently in some other question on this board (which I can't find now), someone pointed out that extension methods could be used nicely in this scenario. Here's one way to do it: static public class EventExtensions { static public void RaiseEvent(this EventHandler @event, object sender, EventArgs e) { var handler = @event; if (handler != null) handler(sender, e); } static public void RaiseEvent<T>(this EventHandler<T> @event, object sender, T e) where T : EventArgs { var handler = @event; if (handler != null) handler(sender, e); } } With these extension methods in place, all you need to declare and raise an event is something like this: public event EventHandler SomethingHappened; void SomeMethod() { this.SomethingHappened.RaiseEvent(this, EventArgs.Empty); } My question: Is this a good idea? Are we missing anything by not having the standard On method? (One thing I notice is that it doesn't work with events that have explicit add/remove code.)

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Using resource values as layout attributes (config.xml)

  - by synic

  Looking in the android sdk folders, I've found a file called values/config.xml. This seems to be somewhere that you can define values for later use in layouts and animations. Given the config.xml: <resources> <string name="config_somePadding">50dip</string> </resources> How would I reference this to use as the layout_height in a layout xml file? @string/config_somePadding is actually the only one I've found that doesn't throw an error in Eclipse (even though there isn't a config_somePadding in values/strings.xml), but it appears to just put an empty string. In the sdk, they use an integer for animation duration. They reference it like this: android:duration="@android:integer/config_longAnimTime". Is there a way to use values that aren't integers in the layout_height attribute?

  Read the article

• Problem with building with csc task in Ant

  - by Wing C. Chen

  I have an ant build target using csc: <target name="compile"> <echo>Starting compiling ServiceLauncher</echo> <csc optimize="true" debug="true" warnLevel="1" unsafe="false" targetType="exe" failonerror="true" incremental="false" mainClass = "ServiceLauncher.Launcher" srcdir="ServiceLauncher/Launcher/" outputfile="ServiceLauncher.exe" > <reference file="libs/log4net.dll"/> <define name="RELEASE"/> </csc> </target> When I run it, the following exception comes up: csc failed: java.io.IOException: Cannot run program "csc": CreateProcess error=2, The system cannot find the file specified However, it runs without the exception but never correctly builds the .exe file, when I manually add in an empty ServiceLauncher.exe. How can I correctly build this .Net project "ServiceLauncher"?

  Read the article

• Is there a tool that can refactor this C code correctly?

  - by Alex

  Lets say I have the following code (the array* function are what we use for resizable arrays and they operate on pointers-to-arrays that are null initialized): typedef struct MyStruct { int i; } MyStruct; MyStruct* GetNewMyStruct(int i) { MyStruct* s = malloc(sizeof(MyStruct)); s->i = i; return s; } int SomeFunction(int number, MyStruct *elem) { MyStruct **structs = NULL; int i; for (i = 0; i < number; i++) arrayPush(&structs, GetNewMyStruct(i)); arrayPush(&structs, elem); return arraySize(&structs); } I decide that SomeFunction is too large and I want refactor it. Currently where I work we use VisualAssist X, which has some refactoring capabilities, but when I use it on this it does not work correctly. If I attempt to use it to refactor out the loop, this is what I get: void MyMethod( int number, MyStruct ** structs ) { int i; for (i = 0; i < number; i++) arrayPush(&structs, GetNewMyStruct(i)); } int SomeFunction(int number, MyStruct *elem) { MyStruct **structs = NULL; MyMethod(number, structs); arrrayPush(&structs, elem); return arraySize(&structs); } This is not correct. MyMethod should take a MyStruct ***, not a MyStruct **. This is because the code I'm refactoring takes the address of structs. The result is that the refactored version will always return 1 (since only one object has been pushed into my array) rather than number+1. Are there other tools out there that do this type of refactoring correctly?

  Read the article

• Test if single linked list is circular by traversing it only once

  - by user1589754

  I am a fresher and I was asked this question in a recent interview I gave. The question was --- By traversing each element of linked list just once find if the single linked list is circular at any point. To this I answered that we will store reference of each node while traversing the list in another linked list and for every node in the list being tested we will find if the reference exists in the list I am storing the references. The interviewer said that he needs a more optimized way to solve this problem. Can anyone please tell me what would be a more optimized method to solve this problem.

  Read the article

• sorting names in a linked list

  - by sil3nt

  Hi there, I'm trying to sort names into alphabetical order inside a linked list but am getting a run time error. what have I done wrong here? #include <iostream> #include <string> using namespace std; struct node{ string name; node *next; }; node *A; void addnode(node *&listpointer,string newname){ node *temp; temp = new node; if (listpointer == NULL){ temp->name = newname; temp->next = listpointer; listpointer = temp; }else{ node *add; add = new node; while (true){ if(listpointer->name > newname){ add->name = newname; add->next = listpointer->next; break; } listpointer = listpointer->next; } } } int main(){ A = NULL; string name1 = "bob"; string name2 = "tod"; string name3 = "thomas"; string name4 = "kate"; string name5 = "alex"; string name6 = "jimmy"; addnode(A,name1); addnode(A,name2); addnode(A,name3); addnode(A,name4); addnode(A,name5); addnode(A,name6); while(true){ if(A == NULL){break;} cout<< "name is: " << A->name << endl; A = A->next; } return 0; }

  Read the article

• jQuery error when aborting an ajax call only in Internet Explorer

  - by Rob Crowell

  When mousing over an image in a jcarousel, my site displays a popup whose contents are loaded via ajax. I'm doing what I thought was fairly straightforward; keeping a handle to the xhrRequest object, and aborting the existing one before making a new request. It works great in all browsers except IE, where I receive an error "Object doesn't support this property or method" Here's the code that is triggering it: function showPopup { // ... code snipped ... // cancel the existing xhr request if (showPopup.xhrRequest != null) { showPopup.xhrRequest.abort(); showPopup.xhrRequest = null; } showPopup.xhrRequest = $.ajax({url: url, type: "GET", success:function(data) { $("#popup-content").html(data); } }); // ... code snipped ... } showPopup.xhrRequest = null; Works great in Firefox and Chrome. I traced the error down to this bit of code in jquery.js inside the ajax function (line 5233 in my copy of jQuery): // Override the abort handler, if we can (IE doesn't allow it, but that's OK) // Opera doesn't fire onreadystatechange at all on abort try { var oldAbort = xhr.abort; xhr.abort = function() { if (xhr ) { oldAbort.call( xhr ); } onreadystatechange( "abort" ); } catch(e) { } The specific error occurs on the oldAbort.call( xhr ) line. Any ideas?

  Read the article

• jQuery/Ajax/javascript in FireFox Error when using $.post/$.get

  - by IsenGrim

  uncaught exception: [Exception... "Component returned failure code: 0x80004005 (NS_ERROR_FAILURE)" nsresult: "0x80004005 (NS_ERROR_FAILURE)" location: "JS frame :: http://localhost/scripts/jQuery.js :: anonymous :: line 808" data: no] Line 0 is the error i get when i bring up firebug. This only happens in firefox (and maybe other browsers) but the code works fine in IE8. I have codes like this in jquery: $("#Logout").live("click", function (e) { e.preventDefault(e); $.post("/logout.php", {}, function () { //--a bunch of animations--// window.location = "/login.php"; } }); I have no idea whats wrong as even the error message is not helpful at all.. inside logout.php: <?php session_start(); session_destroy(); ?> Also dont work if I used GET or inserted phantom data. Or is there a more elegant way to do this?

  Read the article

• Updating to Spring 2.5.5 causes a javax.servlet.UnavailableException: org.springframework.web.struts

  - by Averroes

  I have been told to update some application from Spring 2.0.8 to Spring 2.5.5. This application is using Struts 1.2.7. Once I change the Spring.jar I get the following exception while loading in JBoss 4.0.5: 10:14:57,579 ERROR [[/PortalRRHH]] Servlet /PortalRRHH threw load() exception javax.servlet.UnavailableException: org.springframework.web.struts.DelegatingTilesRequestProcessor This is defined in the struts-config.xml this way: <controller locale="true"> <set-property property="processorClass" value="org.springframework.web.struts.DelegatingTilesRequestProcessor"/> </controller> I have no clue of what is happening since it works with the old version of Spring and the DelegatingTilesRequestProcessor is still available in Spring 2.5.5. I have no previous experience with Struts so if you need anything else to figure what the problem is please ask and I will update the question. Thanks.

  Read the article

• How to copy an array of char pointers with a larger list of char pointers?

  - by Casey Link

  My function is being passed a struct containing, among other things, a NULL terminated array of pointers to words making up a command with arguments. I'm performing a glob match on the list of arguments, to expand them into a full list of files, then I want to replace the passed argument array with the new expanded one. The globbing is working fine, that is, g.gl_pathv is populated with the list of expected files. However, I am having trouble copying this array into the struct I was given. #include <glob.h> struct command { char **argv; // other fields... } void myFunction( struct command * cmd ) { char **p = cmd->argv; char* program = *p++; // save the program name (e.g 'ls', and increment to the first argument glob_t g; memset(&g, 0, sizeof(g)); int res = glob(*p, 0, NULL, &g); *p++ // increment while (*p) { glob(*p++, GLOB_APPEND, NULL, &g); // append the matches } // here i want to replace cmd->argv with the expanded g.gl_pathv memcpy(cmd->argv, g.gl_pathv, g.gl_pathc ); // this doesn't work globfree(&g); }

  Read the article

• What are the hibernate annotations used to persist a value typed Map with an enumerated type as a ke

  - by Jason Novak

  I am having trouble getting the right hibernate annotations to use on a value typed Map with an enumerated class as a key. Here is a simplified (and extremely contrived) example. public class Thing { public String id; public Letter startLetter; public Map<Letter,Double> letterCounts = new HashMap<Letter, Double>(); } public enum Letter { A, B, C, D } Here are my current annotations on Thing @Entity public class Thing { @Id public String id; @Enumerated(EnumType.STRING) public Letter startLetter; @CollectionOfElements @JoinTable(name = "Thing_letterFrequencies", joinColumns = @JoinColumn(name = "thingId")) @MapKey(columns = @Column(name = "letter", nullable = false)) @Column(name = "count") public Map<Letter,Double> letterCounts = new HashMap<Letter, Double>(); } Hibernate generates the following DDL to create the tables for my MySql database create table Thing (id varchar(255) not null, startLetter varchar(255), primary key (id)) type=InnoDB; create table Thing_letterFrequencies (thingId varchar(255) not null, count double precision, letter tinyblob not null, primary key (thingId, letter)) type=InnoDB; Notice that hibernate tries to define letter (my map key) as a tinyblob, however it defines startLetter as a varchar(255) even though both are of the enumerated type Letter. When I try to create the tables I see the following error BLOB/TEXT column 'letter' used in key specification without a key length I googled this error and it appears that MySql has issues when you try to make a tinyblob column part of a primary key, which is what hibernate needs to do with the Thing_letterFrequencies table. So I would rather have letter mapped to a varchar(255) the way startLetter is. Unfortunately, I've been fussing with the MapKey annotation for a while now and haven't been able to make this work. I've also tried @MapKeyManyToMany(targetEntity=Product.class) without success. Can anyone tell me what are the correct annotations for my letterCounts map so that hibernate will treat the letterCounts map key the same way it does startLetter?

  Read the article

• Uploading XML with NSInputStream Iphone....

  - by Aks

  Hi, I have to upload XML string to server & the Web service expect it in body stream part of the http request. So i am allocating the NSInputstream instance with xml data & then setting it the part of the http string but it uploading the stream body NULL & in my code if check the Stream status, it gives error & size null, Could you let me know how to get it done , also pasting the code. Code: NSInputStream* stream = [[[NSInputStream alloc]initWithData:streamData]retain]; request=[NSMutableURLRequest requestWithURL:[NSURL URLWithString:nss_url]]; NSString *msgLength = [NSString stringWithFormat:@"%d", [message length]]; [request addValue: @"text/xml; charset=utf-8" forHTTPHeaderField:@"Content-Type"]; [request addValue: @"http://www.XYZ.COM/ACL" forHTTPHeaderField:@"SOAPAction"]; [request addValue: msgLength forHTTPHeaderField:@"Content-Length"]; [request setHTTPBodyStream:[NSInputStream inputStreamWithData:streamData]]; [request setHTTPMethod:@"POST"]; NSLog(@"The input stream is %@ & error is %@",[stream streamStatus],[stream streamError]); Its gives: The input stream is (null) & error is Error Domain=NSUnknownErrorDomain Code=0 "Operation could not be completed. (NSUnknownErrorDomain error 0.)" Any inputs what I am missing ..........

  Read the article

• Django - I got TemplateSyntaxError when I try open the admin page. (http://DOMAIN_NAME/admin)

  - by user140827

  I use grappelly plugin. When I try open the admin page (/admin) I got TemplateSyntaxError. It says 'get_generic_relation_list' is invalid block tag. TemplateSyntaxError at /admin/ Invalid block tag: 'get_generic_relation_list', expected 'endblock' Request Method: GET Request URL: http://DOMAIN_NAME/admin/ Django Version: 1.4 Exception Type: TemplateSyntaxError Exception Value: Invalid block tag: 'get_generic_relation_list', expected 'endblock' Exception Location: /opt/python27/django/1.4/lib/python2.7/site-packages/django/template/base.py in invalid_block_tag, line 320 Python Executable: /opt/python27/django/1.4/bin/python Python Version: 2.7.0 Python Path: ['/home/vhosts/DOMAIN_NAME/httpdocs/media', '/home/vhosts/DOMAIN_NAME/private/new_malinnikov/lib', '/home/vhosts/DOMAIN_NAME/httpdocs/', '/home/vhosts/DOMAIN_NAME/private/new_malinnikov', '/home/vhosts/DOMAIN_NAME/private/new_malinnikov', '/home/vhosts/DOMAIN_NAME/private', '/opt/python27/django/1.4', '/home/vhosts/DOMAIN_NAME/httpdocs', '/opt/python27/django/1.4/lib/python2.7/site-packages/setuptools-0.6c12dev_r88846-py2.7.egg', '/opt/python27/django/1.4/lib/python2.7/site-packages/pip-0.8.1-py2.7.egg', '/opt/python27/django/1.4/lib/python27.zip', '/opt/python27/django/1.4/lib/python2.7', '/opt/python27/django/1.4/lib/python2.7/plat-linux2', '/opt/python27/django/1.4/lib/python2.7/lib-tk', '/opt/python27/django/1.4/lib/python2.7/lib-old', '/opt/python27/django/1.4/lib/python2.7/lib-dynload', '/opt/python27/lib/python2.7', '/opt/python27/lib/python2.7/plat-linux2', '/opt/python27/lib/python2.7/lib-tk', '/opt/python27/django/1.4/lib/python2.7/site-packages', '/opt/python27/lib/python2.7/site-packages/setuptools-0.6c11-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/flup-1.0.3.dev_20100525-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/virtualenv-1.5.1-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/SQLAlchemy-0.6.4-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/SQLObject-0.14.1-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/FormEncode-1.2.3dev-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/MySQL_python-1.2.3-py2.7-linux-x86_64.egg', '/opt/python27/lib/python2.7/site-packages/psycopg2-2.2.2-py2.7-linux-x86_64.egg', '/opt/python27/lib/python2.7/site-packages/pysqlite-2.6.0-py2.7-linux-x86_64.egg', '/opt/python27/lib/python2.7/site-packages', '/opt/python27/lib/python2.7/site-packages/PIL'] Server time: ???, 7 ??? 2012 04:19:42 +0700 Error during template rendering In template /home/vhosts/DOMAIN_NAME/httpdocs/templates/grappelli/admin/base.html, error at line 28 Invalid block tag: 'get_generic_relation_list', expected 'endblock' 18 <!--[if lt IE 8]> 19 <script src="http://ie7-js.googlecode.com/svn/version/2.0(beta3)/IE8.js" type="text/javascript"></script> 20 <![endif]--> 21 {% block javascripts %} 22 <script type="text/javascript" src="{% admin_media_prefix %}jquery/jquery-1.3.2.min.js"></script> 23 <script type="text/javascript" src="{% admin_media_prefix %}js/admin/Bookmarks.js"></script> 24 <script type="text/javascript"> 25 // Admin URL 26 var ADMIN_URL = "{% get_admin_url %}"; 27 // Generic Relations 28 {% get_generic_relation_list %} 29 // Get Bookmarks 30 $(document).ready(function(){ 31 $.ajax({ 32 type: "GET", 33 url: '{% url grp_bookmark_get %}', 34 data: "path=" + escape(window.location.pathname + window.location.search), 35 dataType: "html", 36 success: function(data){ 37 $('ul#bookmarks').replaceWith(data); 38 }

  Read the article

• is it possible to display video information from an rtsp stream in an android app UI

  - by Joseph Cheung

  I have managed to get a working video player that can stream rtsp links, however im not sure how to display the videos current time position in the UI, i have used the getDuration and getCurrentPosition calls, stored this information in a string and tried to display it in the UI but it doesnt seem to work in main.xml: TextView android:id="@+id/player" android:layout_width="wrap_content" android:layout_height="wrap_content" android:layout_margin="1px" android:text="@string/cpos" / in strings.xml: string name="cpos""" /string in Player.java private void playVideo(String url) { try { media.setEnabled(false); if (player == null) { player = new MediaPlayer(); player.setScreenOnWhilePlaying(true); } else { player.stop(); player.reset(); } player.setDataSource(url); player.getCurrentPosition(); player.setDisplay(holder); player.setAudioStreamType(AudioManager.STREAM_MUSIC); player.setOnPreparedListener(this); player.prepareAsync(); player.setOnBufferingUpdateListener(this); player.setOnCompletionListener(this); } catch (Throwable t) { Log.e(TAG, "Exception in media prep", t); goBlooey(t); try { try { player.prepare(); } catch (IOException e) { // TODO Auto-generated catch block e.printStackTrace(); } Log.v(TAG, "Duration: === " + player.getDuration()); } catch (IllegalStateException e) { // TODO Auto-generated catch block e.printStackTrace(); } } } private Runnable onEverySecond = new Runnable() { public void run() { if (lastActionTime 0 && SystemClock.elapsedRealtime() - lastActionTime 3000) { clearPanels(false); } if (player != null) { timeline.setProgress(player.getCurrentPosition()); //stores getCurrentPosition as a string cpos = String.valueOf(player.getCurrentPosition()); System.out.print(cpos); } if (player != null) { timeline.setProgress(player.getDuration()); //stores getDuration as a string cdur = String.valueOf(player.getDuration()); System.out.print(cdur); } if (!isPaused) { surface.postDelayed(onEverySecond, 1000); } } };

  Read the article

• Turning a JSON list into a POJO

  - by Josh L

  I'm having trouble getting this bit of JSON into a POJO. I'm using Jackson configured like this: protected ThreadLocal<ObjectMapper> jparser = new ThreadLocal<ObjectMapper>(); public void receive(Object object) { try { if (object instanceof String && ((String)object).length() != 0) { ObjectDefinition t = null ; if (parserChoice==0) { if (jparser.get()==null) { jparser.set(new ObjectMapper()); } t = jparser.get().readValue((String)object, ObjectDefinition.class); } Object key = t.getKey(); if (key == null) return; transaction.put(key,t); } } catch (Exception e) { e.printStackTrace(); } } Here's the JSON that needs to be turned into a POJO: { "id":"exampleID1", "entities":{ "tags":[ { "text":"textexample1", "indices":[ 2, 14 ] }, { "text":"textexample2", "indices":[ 31, 36 ] }, { "text":"textexample3", "indices":[ 37, 43 ] } ] } And lastly, here's what I currently have for the java class: protected Entities entities; @JsonIgnoreProperties(ignoreUnknown = true) protected class Entities { public Entities() {} protected Tags tags; @JsonIgnoreProperties(ignoreUnknown = true) protected class Tags { public Tags() {} protected String text; public String getText() { return text; } public void setText(String text) { this.text = text; } }; public Tags getTags() { return tags; } public void setTags(Tags tags) { this.tags = tags; } }; //Getters & Setters ... I've been able to translate the more simple objects into a POJO, but the list has me stumped. Any help is appreciated. Thanks!

  Read the article

• How to wrtie a XML License Line(ended with a forward slash '/') in C#?

  - by Nano HE

  I want to write a XML file as below: <?xml version="1.0" encoding="UTF-8"?> <books xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"> <License licenseId="" licensePath="" /> Some piece of my code attached here // Create a new file in D:\\ and set the encoding to UTF-8 XmlTextWriter textWriter = new XmlTextWriter("D:\\books.xml", System.Text.Encoding.UTF8); // Format automatically textWriter.Formatting = Formatting.Indented; // Opens the document textWriter.WriteStartDocument(); // Write the namespace declaration. textWriter.WriteStartElement("books", null); // Write the genre attribute. textWriter.WriteAttributeString("xmlns", "xsd", null, "http://www.w3.org/2001/XMLSchema"); textWriter.WriteAttributeString("xmlns", "xsi", null, "http://www.w3.org/2001/XMLSchema-instance"); And now I need to write the License Line below in C# <License licenseId="" licensePath="" /> But I don't know how to move on for I found the Line ended with the forward slash / .Thank you.

  Read the article

< Previous Page | 439 440 441 442 443 444 445 446 447 448 449 450  | Next Page >