Search Results

Search found 37765 results on 1511 pages for 'null reference exception'.

Page 447/1511 | < Previous Page | 443 444 445 446 447 448 449 450 451 452 453 454  | Next Page >

  • Help creating custom iPhone Classes

    - by seanny94
    This should be a simple question, but I just can't seem to figure it out. I'm trying to create my own class which will provide a simpler way of playing short sounds using the AudioToolbox framework as provided by Apple. When I import these files into my project and attempt to utilize them, they just don't seem to work. I was hoping someone would shed some light on what I may be doing wrong here. simplesound.h #import <Foundation/Foundation.h> @interface simplesound : NSObject { IBOutlet UILabel *statusLabel; } @property(nonatomic, retain) UILabel *statusLabel; - (void)playSimple:(NSString *)url; @end simplesound.m #import "simplesound.h" @implementation simplesound @synthesize statusLabel; - (void)playSimple:(NSString *)url { if (url = @"vibrate") { AudioServicesPlaySystemSound(kSystemSoundID_Vibrate); statusLabel.text = @"VIBRATED!"; } else { NSString *paths = [[NSBundle mainBundle] resourcePath]; NSString *audioF1ile = [paths stringByAppendingPathComponent:url]; NSURL *audioURL = [NSURL fileURLWithPath:audioFile isDirectory:NO]; SystemSoundID mySSID; OSStatus error = AudioServicesCreateSystemSoundID ((CFURLRef)audioURL,&mySSID); AudioServicesAddSystemSoundCompletion(mySSID,NULL,NULL,simpleSoundDone,NULL); if (error) { statusLabel.text = [NSString stringWithFormat:@"Error: %d",error]; } else { AudioServicesPlaySystemSound(mySSID); } } static void simpleSoundDone (SystemSoundID mySSID, void *args) { AudioServicesDisposeSystemSoundID (mySSID); } } - (void)dealloc { [url release]; } @end Does anyone see what I'm trying to accomplish here? Does anyone know how to remedy this code that is supposedly wrong?

    Read the article

  • Opening a Silverlight project causes APPCRASH is Visual Studio 2008

    - by Ed Woodcock
    Hi guys I've got to add a Silverlight project to a solution for a deployment procedure (it's a pre-build dependency for the main project). I've installed Silverlight tools v3, silverlight itself and the silverlight sdk 3, and am using Visual Studio 2008 with ReSharper and the DevArt oracle database tools. Every time I go to open the relevant silverlight .csproj file VS crashes with the following error message: Problem Event Name: APPCRASH Application Name: devenv.exe Application Version: 9.0.30729.1 Application Timestamp: 488f2b50 Fault Module Name: StackHash_20af Fault Module Version: 6.0.6001.18000 Fault Module Timestamp: 4791a7a6 Exception Code: c0000374 Exception Offset: 000b015d This also happens if I try to create a new silverlight project from scratch. Does anyone have any suggestions?

    Read the article

  • help me "dry" out this .net XML serialization code

    - by Sarah Vessels
    I have a base collection class and a child collection class, each of which are serializable. In a test, I discovered that simply having the child class's ReadXml method call base.ReadXml resulted in an InvalidCastException later on. First, here's the class structure: Base Class // Collection of Row objects [Serializable] [XmlRoot("Rows")] public class Rows : IList<Row>, ICollection<Row>, IEnumerable<Row>, IEquatable<Rows>, IXmlSerializable { public Collection<Row> Collection { get; protected set; } public void ReadXml(XmlReader reader) { reader.ReadToFollowing(XmlNodeName); do { using (XmlReader rowReader = reader.ReadSubtree()) { var row = new Row(); row.ReadXml(rowReader); Collection.Add(row); } } while (reader.ReadToNextSibling(XmlNodeName)); } } Derived Class // Acts as a collection of SpecificRow objects, which inherit from Row. Uses the same // Collection<Row> that Rows defines which is fine since SpecificRow : Row. [Serializable] [XmlRoot("MySpecificRowList")] public class SpecificRows : Rows, IXmlSerializable { public new void ReadXml(XmlReader reader) { // Trying to just do base.ReadXml(reader) causes a cast exception later reader.ReadToFollowing(XmlNodeName); do { using (XmlReader rowReader = reader.ReadSubtree()) { var row = new SpecificRow(); row.ReadXml(rowReader); Collection.Add(row); } } while (reader.ReadToNextSibling(XmlNodeName)); } public new Row this[int index] { // The cast in this getter is what causes InvalidCastException if I try // to call base.ReadXml from this class's ReadXml get { return (Row)Collection[index]; } set { Collection[index] = value; } } } And here's the code that causes a runtime InvalidCastException if I do not use the version of ReadXml shown in SpecificRows above (i.e., I get the exception if I just call base.ReadXml from within SpecificRows.ReadXml): TextReader reader = new StringReader(serializedResultStr); SpecificRows deserializedResults = (SpecificRows)xs.Deserialize(reader); SpecificRow = deserializedResults[0]; // this throws InvalidCastException So, the code above all compiles and runs exception-free, but it bugs me that Rows.ReadXml and SpecificRows.ReadXml are essentially the same code. The value of XmlNodeName and the new Row()/new SpecificRow() are the differences. How would you suggest I extract out all the common functionality of both versions of ReadXml? Would it be silly to create some generic class just for one method? Sorry for the lengthy code samples, I just wanted to provide the reason I can't simply call base.ReadXml from within SpecificRows.

    Read the article

  • Synchronizing Access to a member of the ASP.NET session

    - by Sam
    I'm building a Javascript application and eash user has an individual UserSession. The application makes a bunch of Ajax calls. Each Ajax call needs access to a single UserSession object for the user. Each Ajax call needs a UserSession object. Data in the UserSession object is unique to each user. Originally, during each Ajax call I would create a new UserSession object and it's data members were stored in the ASP.NET Session. However, I found that the UserSession object was being instantiated a lot. To minimize the construction of the UserSession object, I wrapped it in a Singleton pattern and sychronized access to it. I believe that the synchronization is happening application wide, however I only need it to happen per user. I saw a post here that says the ASP.NET cache is synchronized, however the time between creating the object and inserting it into the cache another Thread could start construction it's another object and insert it into the cache. Here is the way I'm currently synchronizing access to the object. Is there a better way than using "lock"... should be be locking on the HttpContext.Session object? private static object SessionLock = new object(); public static WebSession GetSession { get { lock (SessionLock) { try { var context = HttpContext.Current; WebSession result = null; if (context.Session["MySession"] == null) { result = new WebSession(context); context.Session["MySession"] = result; } else { result = (WebSession)context.Session["MySession"]; } return result; } catch (Exception ex) { ex.Handle(); return null; } } } }

    Read the article

  • Trying to convert existing production database table columns from enum to VARCHAR (Rails)

    - by dchua
    Hi everyone, I have a problem that needs me to convert my existing live production (I've duplicated the schema on my local development box, don't worry :)) table column types from enums to a string. Background: Basically, a previous developer left my codebase in absolute shit, migration versions are extremely out of date, and apparently he never used it after a certain point of time in development and now that I'm tasked with migrating a rails 1.2.6 app to 2.3.5, I can't get the tests to run properly on 2.3.5 because my table columns have ENUM column types and they convert to :string, :limit = 0 on my schema.rb which creates the problem of an invalid default value when doing a rake db:test:prepare, like in the case of: Mysql::Error: Invalid default value for 'own_vehicle': CREATE TABLE `lifestyles` (`id` int(11) DEFAULT NULL auto_increment PRIMARY KEY, `member_id` int(11) DEFAULT 0 NOT NULL, `own_vehicle` varchar(0) DEFAULT 'Y' NOT NULL, `hobbies` text, `sports` text, `AStar_activities` text, `how_know_IRC` varchar(100), `IRC_referral` varchar(200), `IRC_others` varchar(100), `IRC_rdrive` varchar(30)) ENGINE=InnoDB I'm thinking of writing a migration task that looks through all the database tables for columns with enum and replace it with VARCHAR and I'm wondering if this is the right way to approach this problem. I'm also not very sure how to write it such that it would loop through my database tables and replace all ENUM colum_types with a VARCHAR. References [1] https://rails.lighthouseapp.com/projects/8994/tickets/997-dbschemadump-saves-enum-columns-as-varchar0-on-mysql [2] http://dev.rubyonrails.org/ticket/2832

    Read the article

  • Mysql: ROLLBACK for multiple queries

    - by Raj
    Hi I have more than three MySql queiries in a PHP script triggered by scheduled task. If a query catch an error, script throw an exception and rollback that Mysql query. It works fine. However if first query works fine, but not 2nd query, throw an exception, it rollback 2nd one but not 1st query. I am using begin_trans(), commit and rollback() for individual queries because Sometimes i need to rollback one query, sometimes all queries. Is there any way to rollback one query or all queries? Thanks in advance UPDATE: I got it working, there was no problem with in begin_trans(), commit and rollback(), the database connection config was different for one query from other queries, crazy code without any comments!!!

    Read the article

  • How to move a symlink to the trash?

    - by neoneye
    I don't see any options for the FSPathMoveObjectToTrashSync() function for not following links. Here is what I have tried Create a link and a file [ 21:32:41 /tmp ] $ touch my_file [ 21:32:45 /tmp ] $ ln -s my_file my_link [ 21:32:52 /tmp ] $ la total 8 drwxrwxrwt 12 root wheel 408 17 Maj 21:32 . drwxr-xr-x@ 6 root wheel 204 9 Sep 2009 .. -rw-r--r-- 1 neoneye wheel 0 17 Maj 21:32 my_file lrwxr-xr-x 1 neoneye wheel 7 17 Maj 21:32 my_link -> my_file Move the link to the trash OSStatus status = FSPathMoveObjectToTrashSync( "/tmp/my_link", NULL, kFSFileOperationDefaultOptions ); NSLog(@"status: %i", (int)status); Output is status: 0 However the file got removed and not the link [ 21:32:55 /tmp ] $ la total 8 drwxrwxrwt 11 root wheel 374 17 Maj 21:33 . drwxr-xr-x@ 6 root wheel 204 9 Sep 2009 .. lrwxr-xr-x 1 neoneye wheel 7 17 Maj 21:32 my_link -> my_file [ 21:33:05 /tmp ] $ How can I move move symlinks to the trash? The Solution.. thanks to Rob Napier NSString* path = @"/tmp/my_link"; OSStatus status = 0; FSRef ref; status = FSPathMakeRefWithOptions( (const UInt8 *)[path fileSystemRepresentation], kFSPathMakeRefDoNotFollowLeafSymlink, &ref, NULL ); NSAssert((status == 0), @"failed to make FSRef"); status = FSMoveObjectToTrashSync( &ref, NULL, kFSFileOperationDefaultOptions ); NSLog(@"status: %i", (int)status);

    Read the article

  • Can anybody help me out with this error.?

    - by kumar
    Error during serialization or deserialization using the JSON JavaScriptSerializer. The length of the string exceeds the value set on the maxJsonLength property. Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.InvalidOperationException: Error during serialization or deserialization using the JSON JavaScriptSerializer. The length of the string exceeds the value set on the maxJsonLength property. in jquery gird on button click i am displaying something like 28000 rows? I know some of them are sujjested to define the JsonmaxLength in web config file.. but its not working for me? can anybody tell me about this? thanks

    Read the article

  • ASP.NET AJAX or jQuery (UpdatePanel/ScriptManager or UFrame/jQuery.ajax)

    - by Mark Redman
    Hi, We use the asp.net UpdatePanel and the ScriptManager/ScriptManagerProxy for ajax related functionality; reducing full page refreshes and calling WCF Services respectively. we also use jQuery and plugins for some parts of the UI. We have had some issues with javascript library related conflicts, but have come across some posts indicating that there is a lot more overhead using the UpdatePanel. I have found some limited reference to UFrame: http://www.codeproject.com/KB/aspnet/uframe.aspx www.codeplex.com/uframe Is this a commercially viable replacement for the asp.net UpdatePanel? We use a ScriptManagerProxy to reference WCF services and easily create and use a proxy to call the various WCF service methods. Would using jQuery ajax be a more efficient solution here? We have got this working well on various browsers but now seem to be getting some security related issues (as seen in FF Firebug: Access to restricted URI denied" code: "1012) which seem to have started since using jQuery a lot more. Is it possible/viable to not use ASP.NET Ajax at all?

    Read the article

  • show definition (browse) in *.pdb of *.dll file

    - by ala
    I have built a Library project (DLL) in .NET. And sometimes I use the DLL along with its PDB file as a reference in some other projects. Now in the new project, I cant browse through the code of the DLL to debug. I can only see the definitions of class/methods/variables. That's by using "show definition" by browsing through the "class view" However, only in case of an exception I the contents of the DLL opens and I could see the entire code of the DLL from the new project. How could I see the contents (code) of the DLL before an exception occur?

    Read the article

  • Draw a position from a 2d Array on respected canvas location

    - by Anon
    Background: I have two 2d arrays. Each index within each 2d array represents a tile which is drawn on a square canvas suitable for 8 x 8 tiles. The first 2d array represents the ground tiles and is looped and drawn on the canvas using the following code: //Draw the map from the land 2d array map = new Canvas(mainFrame, 20, 260, 281, 281); for(int i=0; i < world.length; i++){ for(int j=0; j < world[i].length; j++){ for(int x=0; x < 280; x=x+35){ for(int y=0; y < 280; y=y+35){ Point p = new Point(x,y); map.add(new RectangleObject(p,35,35,Colour.green)); } } } } This creates a grid of green tiles 8 x 8 across as intended. The second 2d array represents the position on the ground. This 2d array has everyone of its indexes as null apart from one which is comprised of a Person class. Problem I am unsure of how I can draw the position on the grid. I was thinking of a similar loop, so it draws over the previous 2d array another set of 64 tiles. Only this time they are all transparent but the one tile which isn't null. In other words, the tile where Person is located. I wanted to use a search throughout the loop using a comparative if statement along the lines of if(!(world[] == null)){ map.add(new RectangleObject(p,35,35,Colour.red));} However my knowledge is limited and I am confused on how to implement it.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • implement button click in html

    - by vbNewbie
    I have been trying to execute a button event in html page that displays additional content on the web page. I am getting a null reference error when using the getelementbyid and not sure how to change this. Here is the html reference I need to engage: <div class="button" style="float:none;width:180px;margin:20px auto 30px;"><a href="#" id="more" style="width:178px">Show more ?</a></div> </div> and here is my code: Dim wb As New WebBrowser wb.Navigate(fromUrl) While wb.ReadyState <> WebBrowserReadyState.Complete Application.DoEvents() End While Debug.Write(wb.DocumentText) Dim htmlElements As HtmlElementCollection = wb.Document.GetElementsByTagName("<a") If Not wb.Document Is Nothing Then Try If wb.DocumentText.Contains("more") Then If wb.Document.GetElementById("more").GetAttribute("href") Then wb.Document.GetElementById("more").InvokeMember("#") End If End If Catch ex As Exception MessageBox.Show(ex.Message.ToString) End Try End If I appreciate any ideas.

    Read the article

  • Issues with LINQ (to Entity) [adding records]

    - by Mario
    I am using LINQ to Entity in a project, where I pull a bunch of data (from the database) and organize it into a bunch of objects and save those to the database. I have not had problems writing to the db before using LINQ to Entity, but I have run into a snag with this particular one. Here's the error I get (this is the "InnerException", the exception itself is useless!): New transaction is not allowed because there are other threads running in the session. I have seen that before, when I was trying to save my changes inside a loop. In this case, the loop finishes, and it tries to make that call, only to give me the exception. Here's the current code: try { //finalResult is a list of the keys to match on for the records being pulled foreach (int i in finalResult) { var queryEff = (from eff in dbMRI.MemberEligibility where eff.Member_Key == i && eff.EffDate >= DateTime.Now select eff.EffDate).Min(); if (queryEff != null) { //Add a record to the Process table Process prRecord = new Process(); prRecord.GroupData = qa; prRecord.Member_Key = i; prRecord.ProcessDate = DateTime.Now; prRecord.RecordType = "F"; prRecord.UsernameMarkedBy = "Autocard"; prRecord.GroupsId = qa.GroupsID; prRecord.Quantity = 2; prRecord.EffectiveDate = queryEff; dbMRI.AddObject("Process", prRecord); } } dbMRI.SaveChanges(); //<-- Crashes here foreach (int i in finalResult) { var queryProc = from pro in dbMRI.Process where pro.Member_Key == i && pro.UsernameMarkedBy == "Autocard" select pro; foreach (var qp in queryProc) { Audit aud = new Audit(); aud.Member_Key = i; aud.ProcessId = qp.ProcessId; aud.MarkDate = DateTime.Now; aud.MarkedByUsername = "Autocard"; aud.GroupData = qa; dbMRI.AddObject("Audit", aud); } } dbMRI.SaveChanges(); //<-- AND here (if the first one is commented out) } catch (Exception e) { //Do Something here } Basically, I need it to insert a record, get the identity for that inserted record and insert a record into another table with the identity from the first record. Given some other constraints, it is not possible to create a FK relationship between the two (I've tried, but some other parts of the app won't allow it, AND my DBA team for whatever reason hates FK's, but that's for a different topic :)) Any ideas what might be causing this? Thank!

    Read the article

  • Accessing running task scheduled with java.util.Timer

    - by jbatista
    I'm working on a Java project where I have created a class that looks like this (abridged version): public class Daemon { private static Timer[] timerarray=null; private static Daemon instance=null; protected Daemon() { ArrayList<Timer> timers = new ArrayList<Timer>(); Timer t = new Timer("My application"); t.schedule(new Worker(), 10000,30000); timers.add(t); //... timerarray = timers.toArray(new Timer[]{}); } public static Daemon getInstance() { if(instance==null) instance=new Daemon(); return instance; } public SomeClass getSomeValueFromWorker() { return theValue; } ///////////////////////////////////////////// private class Worker extends TimerTask { public Worker() {} public void run() { // do some work } public SomeReturnClass someMethod(SomeType someParameter) { // return something; } } ///////////////////////////////////////////// } I start this class, e.g. by invoking daemon.getInstance();. However, I'd like to have some way to access the running task objects' methods (for example, for monitoring the objects' state). The Java class java.util.Timer does not seem to provide the means to access the running object, it just schedules the object instance extending TimerTask. Are there ways to access the "running" object instanciated within a Timer? Do I have to subclass the Timer class with the appropriate methods to somehow access the instance (this "feels" strange, somehow)? I suppose someone might have done this before ... where can I find examples of this "procedure"? Thank you in advance for your feedback.

    Read the article

  • CouchDB Map/Reduce raises execption in reduce function?

    - by fuzzy lollipop
    my view generates keys in this format ["job_id:1234567890", 1271430291000] where the first key element is a unique key and the second is a timestamp in milliseconds. I run my view with this elapsed_time?startkey=["123"]&endkey=["123",{}]&group=true&group_level=1 and here is my reduce function, the intention is to reduce the output to get the earliest and latest timestamps and return the difference between them and now function(keys,values,rereduce) { var now = new Date().valueOf(); var first = Number.MIN_VALUE; var last = Number.MAX_VALUE; if (rereduce) { first = Math.max(first,values[0].first); last = Math.min(last,values[0].last); } else { first = keys[0][0][1]; last = keys[keys.length-1][0][1]; } return {first:now - first, last:now - last}; } and when processing a query it constantly raises the following execption: function raised exception (new TypeError("keys has no properties", "", 1)) I am making sure not to reference keys inside my rereduce block. Why does this function constantly raise this exception?

    Read the article

  • show() progressdialog in asynctask inside fragment

    - by just_user
    I'm trying to display a progressDialog while getting an image from a url to a imageview. When trying to show the progressDialog the parent activity has leaked window... Strange thing is that I have two fragments in the this activity, in the first fragment this exact same way of calling the progressdialog works but when the fragment is replaced and i try to make it again it crashes. This is the asynctask I'm using inside the second fragment with the crash: class SkinPreviewImage extends AsyncTask<Void, Void, Void> { private ProgressDialog progressDialog; @Override protected void onPreExecute() { progressDialog = new ProgressDialog(getActivity()); progressDialog.setMessage("Loading preview..."); if(progressDialog != null) progressDialog.show(); progressDialog.setOnCancelListener(new OnCancelListener() { public void onCancel(DialogInterface arg0) { SkinPreviewImage.this.cancel(true); } }); } @Override protected Void doInBackground(Void... params) { try { URL newurl = new URL(url); Bitmap mIcon_val = BitmapFactory.decodeStream(newurl.openConnection().getInputStream()); skinPreview.setImageBitmap(mIcon_val); } catch (IOException e) { Log.e("SkinStoreDetail", e.getMessage()); } return null; } @Override protected void onPostExecute(Void v) { if(progressDialog != null) progressDialog.dismiss(); } } I've seen a few similar questions but the one closest to solve my problem used a groupactivity for the parent which I'm not using. Any suggestions?

    Read the article

  • Why do I get a nullpointerexception at line ds.getPort in class L1?

    - by Fred
    import java.awt.; import java.awt.event.; import javax.swing.; import java.io.; import java.net.; import java.util.; public class Draw extends JFrame { /* * Socket stuff */ static String host; static int port; static int localport; DatagramSocket ds; Socket socket; Draw d; Paper p = new Paper(ds); public Draw(int localport, String host, int port) { d = this; this.localport = localport; this.host = host; this.port = port; try { ds = new DatagramSocket(localport); InetAddress ia = InetAddress.getByName(host); System.out.println("Attempting to connect DatagramSocket. Local port " + localport + " , foreign host " + host + ", foreign port " + port + "..."); ds.connect(ia, port); System.out.println("Success, ds.localport: " + ds.getLocalPort() + ", ds.port: " + ds.getPort() + ", address: " + ds.getInetAddress()); Reciever r = new Reciever(ds); r.start(); } catch (Exception e) { e.printStackTrace(); } setDefaultCloseOperation(EXIT_ON_CLOSE); getContentPane().add(p, BorderLayout.CENTER); setSize(640, 480); setVisible(true); } public static void main(String[] args) { int x = 0; for (String s : args){ if (x==0){ localport = Integer.parseInt(s); x++; } else if (x==1){ host = s; x++; } else if (x==2){ port = Integer.parseInt(s); } } Draw d = new Draw(localport, host, port); } } class Paper extends JPanel { DatagramSocket ds; private HashSet hs = new HashSet(); public Paper(DatagramSocket ds) { this.ds=ds; setBackground(Color.white); addMouseListener(new L1(ds)); addMouseMotionListener(new L2()); } public void paintComponent(Graphics g) { super.paintComponent(g); g.setColor(Color.black); Iterator i = hs.iterator(); while(i.hasNext()) { Point p = (Point)i.next(); g.fillOval(p.x, p.y, 2, 2); } } private void addPoint(Point p) { hs.add(p); repaint(); } class L1 extends MouseAdapter { DatagramSocket ds; public L1(DatagramSocket ds){ this.ds=ds; } public void mousePressed(MouseEvent me) { addPoint(me.getPoint()); Point p = me.getPoint(); String message = Integer.toString(p.x) + " " + Integer.toString(p.y); System.out.println(message); try{ byte[] data = message.getBytes("UTF-8"); //InetAddress ia = InetAddress.getByName(ds.host); String convertedMessage = new String(data, "UTF-8"); System.out.println("The converted string is " + convertedMessage); DatagramPacket dp = new DatagramPacket(data, data.length); System.out.println(ds.getPort()); //System.out.println(message); //System.out.println(ds.toString()); //ds.send(dp); /*System.out.println("2Sending a packet containing data: " +data +" to " + ia + ":" + d.port + "...");*/ } catch (Exception e){ e.printStackTrace(); } } } class L2 extends MouseMotionAdapter { public void mouseDragged(MouseEvent me) { addPoint(me.getPoint()); Point p = me.getPoint(); String message = Integer.toString(p.x) + " " + Integer.toString(p.y); //System.out.println(message); } } } class Reciever extends Thread{ DatagramSocket ds; byte[] buffer; Reciever(DatagramSocket ds){ this.ds = ds; buffer = new byte[65507]; } public void run(){ try { DatagramPacket packet = new DatagramPacket(buffer, buffer.length); while(true){ try { ds.receive(packet); String s = new String(packet.getData()); System.out.println(s); } catch (Exception e) { e.printStackTrace(); } } } catch (Exception e) { e.printStackTrace(); } } }

    Read the article

  • MongoDB RSS Feed Entries, Embed the Entries in the Feed Object?

    - by Patrick Klingemann
    I am saving a reference to an RSS Feed in MongoDB, each Feed has an ever growing list of Entries. As I'm designing my schema, I'm concerned about this statement from the MongoDB Schema Design - Embed vs. Reference Documentation: If the amount of data to embed is huge (many megabytes), you may read the limit on size of a single object. This will surely happen if I understand the statement correctly. So the question is, I am correct to assume that I should not embed the Feed Entries within a Feed because I'll eventually reach the limit on size of a single object?

    Read the article

  • Resizing uploaded files in django using PIL

    - by Nikunj
    I am using PIL to resize an uploaded file using this method: def resize_uploaded_image(buf): imagefile = StringIO.StringIO(buf.read()) imageImage = Image.open(imagefile) (width, height) = imageImage.size (width, height) = scale_dimensions(width, height, longest_side=240) resizedImage = imageImage.resize((width, height)) return resizedImage I then use this method to get the resizedImage in my main view method: image = request.FILES['avatar'] resizedImage = resize_uploaded_image(image) content = django.core.files.File(resizedImage) acc = Account.objects.get(account=request.user) acc.avatar.save(image.name, content) However, this gives me the 'read' error. Trace: Exception Type: AttributeError at /myapp/editAvatar Exception Value: read Any idea how to fix this? I have been at it for hours! Thanks! Nikunj

    Read the article

  • Adding dynamic controls to Silverlight application after WCF Service Asynchronous Callback

    - by Birk
    I'm trying to add some dynamic controls to my Silverlight page after a WCF call. When I try to add a control to I get an error: Object reference not set to an instance of an object. Here is a simplified version of my code: using edm = SilverlightBusinessApplication.ServiceRefrence; public partial class ListWCF : Page { edm.ServiceClient EdmClient = new ServiceClient(); public ListWCF() { EdmClient.GetTestCompleted += EdmGetTestCompleted; EdmClient.GetTestAsync(); } private void EdmGetTestCompleted(object sender, edm.GetTestCompletedEventArgs e) { //This is where I want to add my controls Button b = new Button(); LayoutRoot.Children.Add(b); //Error: Object reference not set to an instance of an object } } Is it not possible to modify the page after it has been loaded? What am I missing? Thanks

    Read the article

  • Create class instance in assembly from string name

    - by Arcadian
    I'm not sure if this is possible, and I'm quite new to using assemblies in C#.NET. What I would like to do is to create an instance of a class when supplied the string name of that class. Something like this: using MyAssembly; namespace MyNameSpace { Class MyClass { int MyValue1; int MyValue2; public MyClass(string myTypeName) { foreach(Type type in MyAssembly) { if((string)type == myTypeName) { //create a new instance of the type } } AssignInitialValues(//the type created above) } //Here I use an abstract type which the type above inherits from private void AssignInitialValues(AbstractType myClass) { this.value1 = myClass.value1; this.value2 = myClass.value2; } } } Obviously you cannot compare strings to types but it illustrates what I'm trying to do: create a type from a supplied string. Any thoughts? EDIT: After attempting: var myObject = (AbstractType) Activator.CreateInstance(null, myTypeName); AssignInitialValues(myObject); I get a number of errors: Inconsistent accessibility: parameter type 'MyAssembly.AbstractType' is less accessible than method 'MyNameSpace.MyClass.AssignInitialValues(MyAssembly.AstractType)' 'MyAssembly.AstractType' is inaccessible due to it's protection level The type or namespace name 'MyAssembly' could not be found (are you missing a using directive or an assembly reference?) The type or namespace name 'AbstractType' could not be found (are you missing a using directive or an assembly reference?) Not exactly sure why it can't find the assembly; I've added a reference to the assembly and I use a Using Directive for the namespace in the assembly. As for the protection level, it's calling classes (or rather the constructors of classes) which can only be public. Any clues on where the problem is? UPDATE: After looking through several articles on SO I came across this: http://stackoverflow.com/a/1632609/360627 Making the AbstractTypeclass public solved the issue of inconsistent accessibility. The new compiler error is this: Cannot convert type 'System.Runtime.Remoting.ObjectHandle' to 'MyAssembly.AbstractType' The line it references is this one: var myObject = (AbstractType) Activator.CreateInstance(null, myTypeName); Using .Unwrap() get's me past this error and I think it's the right way to do it (uncertain). However, when running the program I then get a TypeLoadException when this code is called. TypeLoadException: Could not load type ‘AbstractType’ from assembly ‘MyNameSpace'... Right away I can spot that the type its looking for is correct but the assembly it's looking in is wrong. Looking up the Activator.CreateInstance(String, String) method revealed that the null as the first argument means that the method will look in the executing assembly. This is contrary to the required behavior as in the original post. I've tried using MyAssembly as the first argument but this produces the error: 'MyAssembly' is a 'namespace' but is used like a 'variable' Any thoughts on how to fix this?

    Read the article

  • How to add ACTIVE DOMAIN user to Sharepoint group

    - by standley-nguyen
    Hi all. I got an exception when executing this snippet code SPSecurity.RunWithElevatedPrivileges(delegate() { using (SPSite site = new SPSite(siteUrl.Trim())) { using (SPWeb web = site.OpenWeb()) { try { web.AllowUnsafeUpdates = true; SPUser spUser = web.AllUsers[userName]; if (spUser != null) { SPGroup spGroup = web.Groups[groupName]; if (spGroup != null) spGroup.AddUser(spUser); } } catch (Exception ex) { this.TraceData(LogLevel.Error, "Error at function Named [AddUserToSPGroupWidget.AddUserToGroup] . With Error Message: " + ex.ToString()); } finally { web.AllowUnsafeUpdates = false; } } } }); PLease guide me. Thanks in advance.

    Read the article

  • How to make a request from an android app that can enter a Spring Security secured webservice method

    - by johnrock
    I have a Spring Security (form based authentication) web app running CXF JAX-RS webservices and I am trying to connect to this webservice from an Android app that can be authenticated on a per user basis. Currently, when I add an @Secured annotation to my webservice method all requests to this method are denied. I have tried to pass in credentials of a valid user/password (that currently exists in the Spring Security based web app and can log in to the web app successfully) from the android call but the request still fails to enter this method when the @Secured annotation is present. The SecurityContext parameter returns null when calling getUserPrincipal(). How can I make a request from an android app that can enter a Spring Security secured webservice method? Here is the code I am working with at the moment: Android call: httpclient.getCredentialsProvider().setCredentials( //new AuthScope("192.168.1.101", 80), new AuthScope(null, -1), new UsernamePasswordCredentials("joeuser", "mypassword")); String userAgent = "Android/" + getVersion(); HttpGet httpget = new HttpGet(MY_URI); httpget.setHeader("User-Agent", userAgent); httpget.setHeader("Content-Type", "application/xml"); HttpResponse response; try { response = httpclient.execute(httpget); HttpEntity entity = response.getEntity(); ... parse xml Webservice Method: @GET @Path("/payload") @Produces("application/XML") @Secured({"ROLE_USER","ROLE_ADMIN","ROLE_GUEST"}) public Response makePayload(@Context Request request, @Context SecurityContext securityContext){ Payload payload = new Payload(); payload.setUsersOnline(new Long(200)); if (payload == null) { return Response.noContent().build(); } else{ return Response.ok().entity(payload).build(); } }

    Read the article

  • Handling exceptions raised in observers

    - by sparky
    I have a Rails (2.3.5) application where there are many groups, and each Group has_many People. I have a Group edit form where users can create new people. When a new person is created, they are sent an email (the email address is user entered on the form). This is accomplished with an observer on the Person model. The problem comes when ActionMailer throws an exception - for example if the domain does not exist. Clearly that cannot be weeded out with a validation. There would seem to be 2 ways to deal with this: A begin...rescue...end block in the observer around the mailer. The problem with this is that the only way to pass any feedback to the user would be to set a global variable - as the observer is out of the MVC flow, I can't even set a flash[:error] there. A rescue_from in the Groups controller. This works fine, but has 2 problems. Firstly, there is no way to know which person threw the exception (all I can get is the 503 exception, no way to know which person caused the problem). This would be useful information to be able to pass back to the user - at the moment, there is no way for me to let them know which email address is the problem - at the moment, I just have to chuck the lot back at them, and issue an unhelpful message saying that one of them is not correct. Secondly (and to a certain extent this make the first point moot) it seems that it is necessary to call a render in the rescue_from, or it dies with a rather bizarre "can't convert Array into String" error from webbrick, with no stack trace & nothing in the log. Thus, I have to throw it back to the user when I come across the first error and have to stop processing the rest of the emails. Neither of the solutions are optimal. It would seem that the only way to get Rails to do what I want is option 1, and loathsome global variables. This would also rely on Rails being single threaded. Can anyone suggest a better solution to this problem?

    Read the article

< Previous Page | 443 444 445 446 447 448 449 450 451 452 453 454  | Next Page >