Search Results

Search found 15172 results on 607 pages for 'array intersect'.

Page 448/607 | < Previous Page | 444 445 446 447 448 449 450 451 452 453 454 455  | Next Page >

  • Completion block not being called. How to check validity?

    - by HCHogan
    I have this method which takes a block, but that block isn't always called. See the method: - (void)updateWithCompletion:(void (^)(void))completion { [MYObject myMethodWithCompletion:^(NSArray *array, NSError *error) { if (error) { NSLog(@"%s, ERROR not nil", __FUNCTION__); completion(); return; } NSLog(@"%s, calling completion %d", __FUNCTION__, &completion); completion(); NSLog(@"%s, finished completion", __FUNCTION__); }]; } I have some more NSLogs inside completion. Sometimes this program counter just blows right past the call to completion() in the code above. I don't see why this would be as the calling code always passes a literal block of code as input. If you're curious of the output of the line containing the addressof operator, it's always something different, but never 0 or nil. What would cause completion not to be executed?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How do I get a full Magento session in an external script? (Specifically, Catalog Rules)

    - by Laizer
    I'm running an external script that loads up a Magento session. Within that script, I'm loading products and grabbing a bunch of properties. The one issue is that getFinalPrice() does not apply the catalog rules that apply to the product. I'm doing everything I know to set the session, even a bunch of stuff that I think is superfluous. Nothing seems to get these rules applied. Here's a test script: require_once "app/Mage.php"; umask(0); $app = Mage::app("default"); $app->getTranslator()->init('frontend'); //Probably not needed Mage::getSingleton('core/session', array('name'=>'frontend')); $session = Mage::getSingleton("customer/session"); $session->start(); //Probably not needed $session->loginById(122); $product = Mage::getModel('catalog/product')->load(1429); echo $product->getFinalPrice(); Any insight is appreciated.

    Read the article

  • Replacing backslash with another symbol in PHP

    - by Skyfe
    Hi there, Been struggling with replacing a backslash by another symbol such as '.-.' just to indicate the position of backslashes as I could not send a string such as 'C\xampp\etc.' through url as GET variable so I thought I'd first replace the backslashes in that string by another symbol, then send through url, and then replace them back to backslashes in the PHP file that handles it. Though would there be a better way to send such strings through url? Because when I try a script such as: $tmp_name = preg_replace("\", ".-.", $_FILES['uploadfile']['tmp_name']); It turns out into a php error as \ is also used as delimiter.. Could anyone help me out on this? Thanks in advanced! Btw, if I'd be able to send a full array through url, this whole problem would be solved, but I don't think it's possible?

    Read the article

  • Building resultset using collection object

    - by Bhaskara Krishna Mohan Potam
    Hi, I had an issue in building the resultset using java. Here it goes... I am storing a collection object which is organized as row wise taken from a resultset object and putting the collection object(which is stored as vector/array list) in cache and trying to retrieve the same collection object. Here i need to build back the resultset again using the collection object. Now my doubt is building the resultset in this way possible or not? Please let me know asap. Thanks in advance, Bhaskar

    Read the article

  • Multiple key/value pairs in HTTP POST where key is the same name

    - by randombits
    I'm working on an API that accepts data from remote clients, some of which where the key in an HTTP POST almost functions as an array. In english what this means is say I have a resource on my server called "class". A class in this sense, is the type a student sits in and a teacher educates in. When the user submits an HTTP POST to create a new class for their application, a lot of the key value pairs look like: student_name: Bob Smith student_name: Jane Smith student_name: Chris Smith What's the best way to handle this on both the client side (let's say the client is cURL or ActiveResource, whatever..) and what's a decent way of handling this on the server-side if my server is a Ruby on Rails app? Need a way to allow for multiple keys with the same name and without any namespace clashing or loss of data.

    Read the article

  • Where are my $_FILES? Ajax Uploading

    - by Richard Testani
    I've built a form to upload images, and processed with Prototype/PHP. $('image_upload').observe('submit', function() { var params = $H(); params.set('name', $('image_title').value); params.set('from', $('from_who').value); params.set('upload_file', $('upload_file').value); new Ajax.Request('/files/upload_process.php', { method:'post', parameters: params, onSuccess: function(r) { $('uploadbox').update('<img src="/images/interface/thankyou.png" />'); } }) }); The form itself sends the data to the server, but when I try to output print_r($_FILES['upload_file']); nothing appears, not even an empty array. If I output print_r($_POST), the parameters are sent properly, but only the file name of the image. So it seems the files themselves are not being sent along. How do I handle this? Thanks Rich

    Read the article

  • Rendering a variable with erb.

    - by TZer0
    I've got the following problem: I have rhtml (html minced together with ruby inside <% % and <%= % tags) stored in a database which I want to render. The information is acquired through a query. I need to be able to evaluate the information I get from the database as though as it was normal content inside the .erb-file. What I currently have: <% @mymods.each do |mod| %> <%= render_text(mod["html"])%> <% end %> Where mod["html"] is the variable containing the rhtml-code and @mymods an array of objects from the query. I have currently no idea what function I should use (render_text does, of course, not work). Help is greatly appreciated. /TZer0

    Read the article

  • Best way to parse command line arguments in C#

    - by Paul Stovell
    When building console applications that take parameters, you can use the arguments passed to Main(string[] args). In the past I've simply indexed/looped that array and done a few regular expressions to extract the values. However, when the commands get more complicated, the parsing can get pretty ugly. More recently, I built the world's simplest Backus-Naur Form parser in C# to parse the arguments. It does the job, but it also feels like overkill. So I'm interested in: Libraries that you use Patterns that you use Assume the commands always adhere to common standards such as answered here.

    Read the article

  • Routing configuration in cakephp

    - by ShiVik
    Hello all I am trying to implement routing in cakephp. I want the urls to mapped like this... www.example.com/nodes/main - www.example.com/main www.example.com/nodes/about - www.example.com/about So for this I wrote in my config/routes.php file.. Router::connect('/:action', array('controller' => 'nodes')); Now, I got the thing going but when I click on the links, the url in browser appears like www.example.com/nodes/main www.example.com/nodes/about Is there some way where I can get the urls to appear the way they are routed? Setting in .htaccess or httpd.conf would be easy - but I don't have access to that. Regards Vikram

    Read the article

  • CommunicationException in WCF

    - by user343159
    Hi I have a problem with a WCF Service I've just created. This was working yesterday but for some reason it's just stopped working. One of my WCF methods returns an array of an Entity Framework entity, like this: public BranchContactDetail[] GetClosestBranches(string postcode, int howManyBranches) { GeoLocation geoLocation = GetLocationFromPostcode(postcode); Location location = new Location(geoLocation.Latitude, geoLocation.Longitude); using (BranchDirectoryEntities entities = new BranchDirectoryEntities()) { var branchesInOrder = entities.BranchContactDetails .Where(b => b.latitude.HasValue && b.longitude.HasValue ) .OrderBy(b => location.DistanceFrom(b.latitude, b.longitude)) .Take(howManyBranches) .ToArray(); return branchesInOrder; } } ...and, as I say, this was working fine yesterday. Now I'm getting a "The underlying connection was closed: The connection was closed unexpectedly." I've hunted all over the web but no-one seems to know the answer. Anyone shed any light on this issue? Regards, Mark

    Read the article

  • Compatibility issues with <a> and calling a function(); across different web browsers

    - by Matthew
    Hi, I am new to javascript. I wrote the following function rollDice() to produce 5 random numbers and display them. I use an anchor with click event to call the function. Problem is, in Chrome it won't display, works fine in IE, in firefox the 5 values display and then the original page w/anchor appears! I am suspicious that my script tag is too general but I am really lost. Also if there is a display function that doesn't clear the screen first that would be great. diceArray = new Array(5) function rollDice() { var i; for(i=0; i<5; i++) { diceArray[i]=Math.round(Math.random() * 6) % 6 + 1; document.write(diceArray[i]); } } when I click should display 5 rand variables

    Read the article

  • F#: Define an abstract class that inherits an infterface, but does not implement it

    - by akaphenom
    I owuld like to define an abstract class that inerhits from UserControl and my own Interface IUriProvider, but doesn't implement it. The goal is to be able to define pages (for silverlight) that implement UserControl but also provide their own Uri's (and then stick them in a list / array and deal with them as a set: type IUriProvider = interface abstract member uriString: String ; abstract member Uri : unit -> System.Uri ; end type UriUserControl() as this = inherit IUriProvider with abstract member uriString: String ; inherit UserControl() Also the Uri in the definition - I would like to implement as a property getter - and am having issues with that as well. this does not compile type IUriProvider = interface abstract member uriString: String with get; end Thank you...

    Read the article

  • rails update whole index of a model with one click

    - by mattherick
    hello! i have a store model, this will handle my leaflet and my shoppingcart for my shop. now i d´like to show all items added from an user to his leaflet in the index of store. in the store an user can change the quantity of the choosen items. and now i want to save that the changes of the different quantities in the database with one click on a button "update store". so how could i implement an update over the whole index with one click? i´d like to do this with ajax and most dynamically. somebody has an idea? i render all items into a form so far, but now i have the problem, when i submit this form only the last quantity and item id are included in the params. further i pushed every quantity into an array and i want to submit this also as a param. but i could not. please give me some tips, will be very fine :) mattherick

    Read the article

  • A controller problem using a base CRUD model

    - by rkj
    In CodeIgniter I'm using a base CRUD My_model, but I have this small problem in my browse-controller.. My $data['posts'] gets all posts from the table called "posts". Though the author in that table is just a user_id, which is why I need to use my "getusername" function (gets the username from a ID - the ID) to grab the username from the users table. Though I don't know how to proceed from here, since it is not just one post. Therefore I need the username to either be a part of the $data['posts'] array or some other smart solution. Anyone who can help me out? function index() { $this->load->model('browse_model'); $data['posts'] = $this->browse_model->get_all(); $data['user'] = $this->browse_model->getusername(XX); $this->load->view('header'); $this->load->view('browse/index', $data); $this->load->view('footer'); }

    Read the article

  • Make object available within php functions without passing them or making them global

    - by Matt
    Hey all, This requirement is just for simplicity for developers and beautiful code. I'm building a template system and I really would just like an object variable to simply be there in all functions. Here's some code: Librarian.php: $class = "slideshow"; $function = "basic"; $args = array(...); $librarian = $this; // I WOULD LIKE THIS TO BE PRESENT IN CALLED FUNCTION ... return call_user_func($class.'::'.$function, $args); ... Slideshow.php: public static function basic($args) { echo $librarian; // "Librarian Object" } Thanks! Matt Mueller

    Read the article

  • XSLT: How to escape square brackets in Urls

    - by ilariac
    I have a set of records from Solr where field[@name='url'] can have the following format: http://url/blabla/blabla.aspx?sv=[keyword%20keyword,%201] My understanding is that the square brackets denote an array syntax and I would like to use XSLT to remove the square brackets from all Urls. The reason for this is that I am using an Open URL resolver, which does not currently handle well those characters. The best option would be to strip the square brackets from all URLs before such resources are mediated by the Open URL resolver. There are cases where I have multiple occurrences of square brackets per Url. Can you please help me with this? Thanks for your help, I.

    Read the article

  • Memory leak with preg_replace

    - by Silvio Donnini
    I'm using the preg_replace function to replace accents in a string, I'm working with UTF-8. I have incurred in what seems to be a memory leak, but I can't isolate the root cause, my code is rather simple: preg_replace( array_keys($aToNoAccents), array_values($aToNoAccents), $sText ); where $aToNoAccents is an associative array with entries like '~[A]~u' => 'A', '~[C]~u' => 'C',. My script prints this error for the above line: Fatal error: Allowed memory size of 1073741824 bytes exhausted (tried to allocate 3039 bytes) Obviously it's not a matter of increasing the allowed memory for PHP, (a 1Gb footprint is way off the scale of my application). Also, that line is executed thousands of times without problems but, just for some cases which are difficult to reproduce, it yields the error. Is anyone aware of memory problems with preg_replace and UTF-8 strings? Am I to use special care in passing actual parameters to such function? I'm using PHP 5.2.6-3 with Suhosin-Patch thanks Silvio

    Read the article

  • Memory in Eclipse

    - by user247866
    I'm getting the java.lang.OutOfMemoryError exception in Eclipse. I know that Eclipse by default uses heap size of 256M. I'm trying to increase it but nothing happens. For example: eclipse -vmargs -Xmx16g -XX:PermSize=2g -XX:MaxPermSize=2g I also tried different settings, using only the -Xmx option, using different cases of g, G, m, M, different memory sizes, but nothing helps. Does not matter which params I specify, the heap exception is thrown at the same time, so I assume there's something I'm doing wrong that Eclipse ignores the -Xmx parameter. I'm using a 32GB RAM machine and trying to execute something very simple such as: double[][] a = new double[15000][15000]; It only works when I reduce the array size to something around 10000 on 10000. I'm working on Linux and using the top command I can see how much memory the Java process is consuming; it's less than 2%. Thanks!

    Read the article

  • Sending POST variables through a PHP proxy for AJAX?

    - by b. e. hollenbeck
    I've decided that using a PHP proxy for AJAX calls for a project is the best way to go - but I have a question regarding passing POST data through the proxy. As in - how to do it. Should I need to create a single variable in the javascript using alternate characters, then have the PHP proxy parse and modify the variable to reassemble a valid HTTP request? Or is there some means of passing along the $_POST array in new request to the external server by pulling the data out of the headers and re-sending it?

    Read the article

  • CodePlex Daily Summary for Sunday, January 30, 2011

    CodePlex Daily Summary for Sunday, January 30, 2011Popular ReleasesWPF Application Framework (WAF): WPF Application Framework (WAF) 2.0.0.3: Version: 2.0.0.3 (Milestone 3): This release contains the source code of the WPF Application Framework (WAF) and the sample applications. Requirements .NET Framework 4.0 (The package contains a solution file for Visual Studio 2010) The unit test projects require Visual Studio 2010 Professional Remark The sample applications are using Microsoft’s IoC container MEF. However, the WPF Application Framework (WAF) doesn’t force you to use the same IoC container in your application. You can use ...Rawr: Rawr 4.0.17 Beta: Rawr is now web-based. The link to use Rawr4 is: http://elitistjerks.com/rawr.phpThis is the Cataclysm Beta Release. More details can be found at the following link http://rawr.codeplex.com/Thread/View.aspx?ThreadId=237262 and on the Version Notes page: http://rawr.codeplex.com/wikipage?title=VersionNotes As of the 4.0.16 release, you can now also begin using the new Downloadable WPF version of Rawr!This is a pre-alpha release of the WPF version, there are likely to be a lot of issues. If you...VivoSocial: VivoSocial 7.4.2: Version 7.4.2 of VivoSocial has been released. If you experienced any issues with the previous version, please update your modules to the 7.4.2 release and see if they persist. If you have any questions about this release, please post them in our Support forums. If you are experiencing a bug or would like to request a new feature, please submit it to our issue tracker. Web Controls * Updated Business Objects and added a new SQL Data Provider File. Groups * Fixed a security issue whe...PHP Manager for IIS: PHP Manager 1.1.1 for IIS 7: This is a minor release of PHP Manager for IIS 7. It contains all the functionality available in 56962 plus several bug fixes (see change list for more details). Also, this release includes Russian language support. SHA1 codes for the downloads are: PHPManagerForIIS-1.1.0-x86.msi - 6570B4A8AC8B5B776171C2BA0572C190F0900DE2 PHPManagerForIIS-1.1.0-x64.msi - 12EDE004EFEE57282EF11A8BAD1DC1ADFD66A654VFPX: VFP2C32 2.0.0.8 Release Candidate: This release includes several bugfixes, new functions and finally a CHM help file for the complete library.EnhSim: EnhSim 2.3.3 ALPHA: 2.3.3 ALPHAThis release supports WoW patch 4.06 at level 85 To use this release, you must have the Microsoft Visual C++ 2010 Redistributable Package installed. This can be downloaded from http://www.microsoft.com/downloads/en/details.aspx?FamilyID=A7B7A05E-6DE6-4D3A-A423-37BF0912DB84 To use the GUI you must have the .NET 4.0 Framework installed. This can be downloaded from http://www.microsoft.com/downloads/en/details.aspx?FamilyID=9cfb2d51-5ff4-4491-b0e5-b386f32c0992 - Added back in a p...DB>doc for Microsoft SQL Server: 1.0.0.0: Initial release Supported output HTML WikiPlex markup Raw XML Supported objects Tables Primary Keys Foreign Keys ViewsmojoPortal: 2.3.6.1: see release notes on mojoportal.com http://www.mojoportal.com/mojoportal-2361-released.aspx Note that we have separate deployment packages for .NET 3.5 and .NET 4.0 The deployment package downloads on this page are pre-compiled and ready for production deployment, they contain no C# source code. To download the source code see the Source Code Tab I recommend getting the latest source code using TortoiseHG, you can get the source code corresponding to this release here.Office Web.UI: Alpha preview: This is the first alpha release. Very exciting moment... This download is just the demo application : "Contoso backoffice Web App". No source included for the moment, just the app, for testing purposes and for feedbacks !! This package includes a set of official MS Office icons (143 png 16x16 and 132 png 32x32) to really make a great app ! Please rate and give feedback ThanksParallel Programming with Microsoft Visual C++: Drop 6 - Chapters 4 and 5: This is Drop 6. It includes: Drafts of the Preface, Introduction, Chapters 2-7, Appendix B & C and the glossary Sample code for chapters 2-7 and Appendix A & B. The new material we'd like feedback on is: Chapter 4 - Parallel Aggregation Chapter 5 - Futures The source code requires Visual Studio 2010 in order to run. There is a known bug in the A-Dash sample when the user attempts to cancel a parallel calculation. We are working to fix this.Catel - WPF and Silverlight MVVM library: 1.1: (+) Styles can now be changed dynamically, see Examples application for a how-to (+) ViewModelBase class now have a constructor that allows services injection (+) ViewModelBase services can now be configured by IoC (via Microsoft.Unity) (+) All ViewModelBase services now have a unit test implementation (+) Added IProcessService to run processes from a viewmodel with directly using the process class (which makes it easier to unit test view models) (*) If the HasErrors property of DataObjec...NodeXL: Network Overview, Discovery and Exploration for Excel: NodeXL Excel Template, version 1.0.1.160: The NodeXL Excel template displays a network graph using edge and vertex lists stored in an Excel 2007 or Excel 2010 workbook. What's NewThis release improves NodeXL's Twitter and Pajek features. See the Complete NodeXL Release History for details. Installation StepsFollow these steps to install and use the template: Download the Zip file. Unzip it into any folder. Use WinZip or a similar program, or just right-click the Zip file in Windows Explorer and select "Extract All." Close Ex...Kooboo CMS: Kooboo CMS 3.0 CTP: Files in this downloadkooboo_CMS.zip: The kooboo application files Content_DBProvider.zip: Additional content database implementation of MSSQL, RavenDB and SQLCE. Default is XML based database. To use them, copy the related dlls into web root bin folder and remove old content provider dlls. Content provider has the name like "Kooboo.CMS.Content.Persistence.SQLServer.dll" View_Engines.zip: Supports of Razor, webform and NVelocity view engine. Copy the dlls into web root bin folder to enable...UOB & ME: UOB ME 2.6: UOB ME 2.6????: ???? V1.0: ???? V1.0 ??Password Generator: 2.2: Parallel password generation Password strength calculation ( Same method used by Microsoft here : https://www.microsoft.com/protect/fraud/passwords/checker.aspx ) Minor code refactoringVisual Studio 2010 Architecture Tooling Guidance: Spanish - Architecture Guidance: Francisco Fagas http://geeks.ms/blogs/ffagas, Microsoft Most Valuable Professional (MVP), localized the Visual Studio 2010 Quick Reference Guidance for the Spanish communities, based on http://vsarchitectureguide.codeplex.com/releases/view/47828. Release Notes The guidance is available in a xps-only (default) or complete package. The complete package contains the files in xps, pdf and Office 2007 formats. 2011-01-24 Publish version 1.0 of the Spanish localized bits.ASP.NET MVC Project Awesome, jQuery Ajax helpers (controls): 1.6.2: A rich set of helpers (controls) that you can use to build highly responsive and interactive Ajax-enabled Web applications. These helpers include Autocomplete, AjaxDropdown, Lookup, Confirm Dialog, Popup Form, Popup and Pager the html generation has been optimized, the html page size is much smaller nowFacebook Graph Toolkit: Facebook Graph Toolkit 0.6: new Facebook Graph objects: Application, Page, Post, Comment Improved Intellisense documentation new Graph Api connections: albums, photos, posts, feed, home, friends JSON Toolkit upgraded to version 0.9 (beta release) with bug fixes and new features bug fixed: error when handling empty JSON arrays bug fixed: error when handling JSON array with square or large brackets in the message bug fixed: error when handling JSON obejcts with double quotation in the message bug fixed: erro...Microsoft All-In-One Code Framework: Visual Studio 2008 Code Samples 2011-01-23: Code samples for Visual Studio 2008New ProjectsAnaida - WebSocket Client/Adapter: Anaida is a WebSocket Client Library/Adapter. With 3 versions for Java, Silverlight and C#CutPasteAssign: Visual Studio extension to assist in the common refactoring of assigning parameters to local variables.Drori Photos: Photos of Drori the photographerD-Solution: App de D-SolutionEnigma Home Inventory: Most consumers do not have an itemized list of proof of ownership. Enigma Home Inventory may take the hassle out of arguing with the insurance companies. This project is aimed to be for a simple inventory program for end users who are not computer savvy.FastKnow: is a CMS & wikiFileSignatures: FileSignatures aims to create a class library that can identify the file format based on file contents. The project is written in C# 3.0, and can be used in .NET 3.5 and 4.0 projects.Genrsis: The aim of the Genrsis project is to be a suite of products that you can use to build things, starting with a workflow-based project management tool. Built in C#, it should be a one-stop place to get well-integrated products to get you up and running.MVC Demos: MVC 2 and MVC 3 examples with ajax and json.MVC Templates for DevExpress: Scaffolding templates for use in ASP.NET MVC 2 with DevExpress MVC Extensions for ASP.NET MVCPixel Replacer: The Pixel Replacer is a simple library for replacing pixel colors with a new color, by setting a filter rule.ReviewPal - The Code Review Companion for .Net.: ReviewPal, the Code Review Companion for .Net. This is an Add-In / Extension for Visual Studio 2008 & Visual Studio 2010. The aim of the Add-In / Extension is to do a source code review within the Visual Studio IDE where code makes more sense and most readable.SMVector3: Vector3 class implemented as float array or with SIMD instructions with the same interface so it is transparant whether you decide to use one version or another. You can also chance version during the life cycle of the projects.uRibbon - Office 2007 Ribbon control for VB.NET: Office 2007 ribbon control, with Orb and graphic transitions. After searching for many day looking for an Office 2007-like ribbon bar, I finally gave up and decided to write my own. It's in decent shape as-is. But anyone interested in helping me to continue the devlopment??vtcheck: This will read a target binary and check to see if it is detected by VirusTotal.Web Scheduled Task Framework: A simple set of classes intended to allow the standalone scheduling of tasks (arbitrary code to execute) on a .net website without requiring access to the operating system.WP7 codeproject app: A Windows Phone 7 app for browsing codeproject.com.zhongjh: ?????????,???????。???????????: ???????????

    Read the article

  • [OpenGL] I'm having an issue to use GLshort for representing Vertex, and Normal.

    - by Xylopia
    As my project gets close to optimization stage, I notice that reducing Vertex Metadata could vastly improve the performance of 3D rendering. Eventually, I've dearly searched around and have found following advices from stackoverflow. Using GL_SHORT instead of GL_FLOAT in an OpenGL ES vertex array How do you represent a normal or texture coordinate using GLshorts? Advice on speeding up OpenGL ES 1.1 on the iPhone Simple experiments show that switching from "FLOAT" to "SHORT" for vertex and normal isn't tough, but what troubles me is when you're to scale back verticies to their original size (with glScalef), normals are multiplied by the reciprocal of the scale. Then how do you use "short" for both vertex and normal at the same time? I've been trying this and that for about a full day, but I could only go for "float vertex w/ byte normal" or "short vertex w/ float normal" so far. Your help would be truly appreciated.

    Read the article

  • Detecting a url using preg_match? without http:// in the string

    - by Stefan
    Hey there, I was wondering how I could check a string broken into an array against a preg_match to see if it started with www. I already have one that check for http://www. $stringToArray = explode(" ",$_POST['text']); foreach($stringToArray as $key=>$val){ $urlvalid = isValidURL($val); if($urlvalid){ $_SESSION["messages"][] = "NO URLS ALLOWED!"; header("Location: http://www.domain.com/post/id/".$_POST['postID']); exit(); } } Thanks! Stefan

    Read the article

  • How to draw/manage a hexagon grid?

    - by W.N.
    I've read this article: generating/creating hexagon grid in C . But look like both the author and answerer have already abandoned it. v(hexagonSide - hexagonWidth * hexagonWidth): What's hexagonSide and hexagonWidth? Isn't it will < 0 (so square root can't be calculated). And, can I put a hexagon into a rectangle? I need to create a grid like this: One more thing, how can I arrange my array to store data, as well as get which cells are next to one cell? I have never been taught about hexagon, so I know nothing about it, but I can easily learn new thing, so if you can explain or give me a clue, I may do it myself.

    Read the article

  • How do I include 2 tables in one LocalStorage item?

    - by Noor
    I've got a table that you can edit, and I've got a simple code saving that list when you're done with editing it. (the tables have the contenteditable on) The problem I've stumbled upon is that if I double click on enter, the table gets divided into two separate tables with the same ID. This causes the code I'm using to set the localStorage to only store one of the tables (I assume the first).. I've thought of different solutions and I wonder if someone could point out the pro's and con's (if the solutions even works that is). Make a loop that checks the page after tables and stores them into an array of localStorage-items.. I'd have to dynamically create a localStorage item for each table. Take the whole div that the tables are in, and store that in the localStorage, when a user revisits the page, the page checks after the items in storage and displays the whole divs. Any suggestions you have that can beat this :).. (but no cache, it has to be with the localStorage!) Thanks

    Read the article

< Previous Page | 444 445 446 447 448 449 450 451 452 453 454 455  | Next Page >