Search Results

Search found 15172 results on 607 pages for 'array intersect'.

Page 453/607 | < Previous Page | 449 450 451 452 453 454 455 456 457 458 459 460  | Next Page >

  • What risks are there in using extracted PHP superglobals?

    - by Zephiro
    Hola usando estas funciones, que riesgo corro en tener problemas de seguridad, es necesesario usar extract() o hay alguna manera mejor de convertir las variables superglobales (array) en trozos de variables. Good, there is some risk in using the function extract in the superglobal variables as $_POS and $_GET, I work of the following way. There is risk of SQL INJECTION or there is an alternative to extract if ( get_magic_quotes_gpc() ) { $_GET = stripslashes( $_GET ); $_POST =stripslashes( $_POST ); } function vars_globals($value = '') { if (is_array ( $value )) $r = &$value; else parse_str ( $value, $r ); return $r; } $r = vars_globals( $_GET ); extract($r, EXTR_SKIP);

    Read the article

  • OOP function and if statement

    - by Luke
    Not sure if I can ask two questions? If i run the following function in my database class function generateUserArray() { $u = array(); $result = $this->selectAllUsers(); while( $row=mysql_fetch_assoc($result)) { $u[] = $row['username']; } return $u; } Would i call it like this? $u[] = $datebase->generateUserArray(); My second question, will this work: else if($database->addLeagueInformation($subname, $subformat, $subgame, $subseason, $subwindow, $subadmin, $subchampion, $subtype) && $databases->addLeagueTable($name) && $_SESSION['players'] == $subplayers && $comp_name = "$format_$game_$name_$season" && $_SESSION['comp_name'] = $comp_name) Thankyou

    Read the article

  • Regular expression for parsing CSV in PHP

    - by Discodancer
    I already managed to split the CSV file using this regex: "/,(?=(?:[^\"]\"[^\"]\")(?![^\"]\"))/" But I ended up with an array of strings that contain the opening and ending double quotes. Now I need a regex that would strip those strings of the delimiter double quotes. As far as I know the CSV format can encapsulate strings in double quotes, and all the double quotes that are already a part of the string are doubled. For example: My "other" cat becomes "My ""other"" cat" What I basically need is a regex that will replace all sequences of N doublequotes with a sequence of (N/2 - rounded down) double quotes. Or is there a better way ? Thanks in advance.

    Read the article

  • How to handle subclasses in JasperReports?

    - by gotch4
    I've two classes (A and B) that extend a base class BASE. I need to make a report that takes an array of such classes and the prints the fields of A or B. I tought of using conditional expressions, then casting to one or another (depending on a field value). But I can't cast, because I don't know how to refere to the current bean. To do this I am using a JRBeanCollectionDataSource filled with a List<BASE>. How do I cast every bean to A or B in a report (or subreport)? I tried: ((A)this) but it says basically that this contains the report instance, not the current bean and gives error.

    Read the article

  • Zend Navigation add extra id

    - by lander
    I made a menu with zend_navigation, using an ini file. That work well. If I look at the code, i see that zend has added a class, to the ul element. With a name that i use in my ini file. But now I want to add also a id to the ul element. How can I do this? protected function _initNavigation() { $this->bootstrap('layout'); $layout = $this->getResource('layout'); $view = $layout->getView(); $iniOptions = array('allowModifications' => true); $config = new Zend_Config_Ini(APPLICATION_PATH . '/configs/navigation.ini', 'nav', $iniOptions); $config->id = 1; $navigation = new Zend_Navigation($config->navigation); $view->navigation($navigation); }

    Read the article

  • GetProperties() to return all properties for an interface inheritance hierarchy

    - by sduplooy
    Assuming the following hypothetical inheritance hierarchy: public interface IA { int ID { get; set; } } public interface IB : IA { string Name { get; set; } } Using reflection and making the following call: typeof(IB).GetProperties(BindingFlags.Public | BindingFlags.Instance) will only yield the properties of interface IB, which is "Name". If we were to do a similar test on the following code, public abstract class A { public int ID { get; set; } } public class B : A { public string Name { get; set; } } the call typeof(B).GetProperties(BindingFlags.Public | BindingFlags.Instance) will return an array of PropertyInfo objects for "ID" and "Name". Is there an easy way to find all the properties in the inheritance hierarchy for interfaces as in the first example?

    Read the article

  • Overwriting arguments object for a Javascript function

    - by Ian Storm Taylor
    If I have the following: // Clean input. $.each(arguments, function(index, value) { arguments[index] = value.replace(/[\W\s]+/g, '').toLowerCase(); }); Would that be a bad thing to do? I have no further use for the uncleaned arguments in the function, and it would be nice not to create a useless copy of arguments just to use them, but are there any negative effects to doing this? Ideally I would have done this, but I'm guessing this runs into problems since arguments isn't really an Array: arguments = $.map(arguments, function(value) { return value.replace(/[\W\s]+/g, '').toLowerCase(); }); Thanks for any input. EDIT: I've just realized that both of these are now inside their own functions, so the arguments object has changed. Any way to do this without creating an unnecessary variable?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Setting Mnemonics and Hot Keys for a JOptionPane Dialog

    - by Daniel Bingham
    Is it possible to assign hotkeys and mnemonics to the buttons in a JOptionPane Dialog? I'd like to be able, in a JOptionPane generated message dialog with the options Yes, No and Cancel, press Y to hit the Yes button, N to hit the No button and escape to activate the escape button. Similarly in a dialog with Okay and Cancel buttons I'd like to be able to activate them with enter and escape. I've attempted passing JButtons into the JOptionPane's button Object array with the Mnemonics set already. The mnemonics work and the buttons show up correctly in the dialogs, however, they do not act properly when they are activated. Most noticeably they do not dispose of the dialog. What is the correct way to add hotkeys and Mnemonics to a JOptionPane Dialog's buttons? As always, my apologies ahead of time if this is a duplicate - I searched both Google and Stackoverflow and found nothing.

    Read the article

  • Routing zend request through a default controller when controller not found.

    - by Brett Pontarelli
    Below is a function defined in my Bootstrap class. I must be missing something fundamental in the way Zend does routing and dispatching. What I am trying to accomplish is simple: For any request /foo/bar/* that is not dispatchable for any reason try /index/foo/bar/. The problem I'm having is when the FooController exists I get Action "foo" does not exist. Basically, the isDispatchable is always false. public function run() { $front = Zend_Controller_Front::getInstance(); $request = $front->getRequest(); $dispatcher = $front->getDispatcher(); //$controller = $dispatcher->getControllerClass($request); if (!$dispatcher->isDispatchable($request)) { $route = new Zend_Controller_Router_Route( ':action/*', array('controller' => 'index') ); $router = $front->getRouter(); $router->addRoute('FallBack', $route); } $front->dispatch(); }

    Read the article

  • Pear MDB2 class and raiserror exceptions in SQL Server

    - by drholzmichl
    Hi, in SQL Server it's possible to raise an error with raiserror(). I want to use a severity, which doesn't interrupt the connection. This error is raised in a stored procedure. In SQL Management Studio all is fine and I get my error code when executing this SP. But when trying to execute this SP via MDB2 in PHP5 this doesn't work. All I get is an empty array. MDB2 object is created via (including needed options): $db =& MDB2::connect($dsn); $db->setFetchMode(MDB2_FETCHMODE_ASSOC); $db->setOption('portability',MDB2_PORTABILITY_ALL ^ MDB2_PORTABILITY_EMPTY_TO_NULL); The following works (I get a PEAR error): $db->query("RAISERROR('test',11,0);"); But when calling a stored procedure which raises this error via $db->query("EXEC sp_raise_error"); there is not output. What's wrong?

    Read the article

  • In Drupal, how to change the values passed to Pathauto?

    - by Vinicius Pinto
    I have Pathauto configured to generate an alias based on the title of a node, for a specific content type. The problem is that I want to make small changes in this title before Pathauto uses it to generate the alias. The first comment in this post suggests the use of hook_token_values, but I couldn't really understand how to use it, even after reading the docs. In my tests, when I implement this hook, the alias generated is always "array", which means I'm missing something. Any help? Thanks.

    Read the article

  • TypeError: 'NoneType' object does not support item assignment

    - by R S John
    I am trying to do some mathematical calculation according to the values at particular index of a NumPy array with the following code X = np.arange(9).reshape(3,3) temp = X.copy().fill(5.446361E-01) ind = np.where(X < 4.0) temp[ind] = 0.5*X[ind]**2 - 1.0 ind = np.where(X >= 4.0 and X < 9.0) temp[ind] = (5.699327E-1*(X[ind]-1)**4)/(X[ind]**4) print temp But I am getting the following error Traceback (most recent call last): File "test.py", line 7, in <module> temp[ind] = 0.5*X[ind]**2 - 1.0 TypeError: 'NoneType' object does not support item assignment Would you please help me in solving this? Thanks

    Read the article

  • CodeIgniter's Scaffolding not working

    - by 01010011
    Hi, I keep getting a 404 Page Not Found whenever I try to access CodeIgniter's Scaffolding page in my browser, like so: localhost/codeignitor/index.php/blog/scaffolding/mysecretword I can access localhost/codeignitor/index.php/blog just fine. I followed CodeIgnitor's instructions in their "Create a blog in 20 minutes" by storing my database settings in the database.php file; and automatically connecting to the database by inserting "database" in the core array of the autoload.php; and I've added both parent::Controller(); and $this-load-scaffolding('myTableName') to blog's constructor. It still gives me this 404. Any suggestions?

    Read the article

  • SQL Server 2005 Fail: Return Dates As Strings

    - by Abs
    Hello all, I am using the SQL Server PHP Driver, I think this question can be answered without knowing what this is. I have come across this many times, what does it mean by NAMES? Column names?: SET NAMES utf8 Is there a query similar to the above that will get my dates to be returned as a string? For some reason on my SQL Sever 2008 on Vista, this works: $connectionInfo = array('Database' => $dbname, 'ReturnDatesAsStrings' => true) But the above 'ReturnDatesAsStrings' does not work on my SQL Server 2005 on a windows server machine? I can't execute any queries after setting the above! Does SQL Server 2005 support ReturnDatesAsStrings? Is there some other parameter I can pass to do the same? Thanks all for any help EDIT I should of mentioned this but if there is a solution I am hoping for one that is in the form of a setting that can be set before any queries can be executed as I do not have control on what queries will be executed.

    Read the article

  • Calling UITableViews delegate methods directly.

    - by RickiG
    Hi I was looking for a way to call the edit method directly. - (void)tableView:(UITableView *)theTableView commitEditingStyle:(UITableViewCellEditingStyle)editingStyle forRowAtIndexPath:(NSIndexPath *)indexPath I have all my logic for animating manipulated cells, removing from my model array etc. in this method. It is getting called when a user swipes, adds or rearranges, but I would like to call it manually/directly as a background thread changes my model. I have constructed an NSIndexPath like so: NSIndexPath *path = [NSIndexPath indexPathForRow:i inSection:1]; I just can't figure out how to call something like: [self.tableview commitEditingStyle:UITableViewCellEditingStyleDelete forRowAtIndexPath:path]; Do I need to gain access to the methods of this plain style UITableView in another way? Thanks:)

    Read the article

  • google search engine api not produce exact live search

    - by Bharanikumar
    Hi , The google search engine api not render the first result , Example, function google_search_api($args, $referer = 'http://localhost/test/', $endpoint = 'web'){ $url = "http://ajax.googleapis.com/ajax/services/search/".$endpoint; if ( !array_key_exists('v', $args) ) $args['v'] = '1.0'; $url .= '?'.http_build_query($args, '', '&'); $ch = curl_init(); curl_setopt($ch, CURLOPT_URL, $url); curl_setopt($ch, CURLOPT_RETURNTRANSFER, 1); // note that the referer must be set curl_setopt($ch, CURLOPT_REFERER, $referer); $body = curl_exec($ch); curl_close($ch); //decode and return the response return json_decode($body); } $rez = google_search_api(array( 'q' = 'dl03', )); print_r($rez); the result for the above snippet little differ compare to live google search, the above snippet not render first result , that is in google live search first result not displaying the above snippet , AMy i know, what should i have to do now, Regards

    Read the article

  • Fibonacci sequence subroutine returning one digit too high...PERL

    - by beProactive
    #!/usr/bin/perl -w use strict; sub fib { my($num) = @_; #give $num to input array return(1) if ($num<=1); #termination condition return($num = &fib($num-1) + &fib($num-2)); #should return sum of first "n" terms in the fibonacci sequence } print &fib(7)."\n"; #should output 20 This subroutine should be outputting a summation of the first "x" amount of terms, as specified by the argument to the sub. However, it's one too high. Does this have something to do with the recursion? Thanks.

    Read the article

  • Is NSDictionary key order guaranteed the same as initialized if it never changes?

    - by Thaurin
    I've run into the same problem as found in this question. However, I have a follow-up question. I seem to be in the same situation as the original asker: I have a plist with a hierarchy of dictionaries that define a configuration screen. These are not mutable and will stay the same throughout the application. Since the original discussion seems to focus on problems arising from mutating the dictionary, I must ask for comfirmation: is the order of a dictionary guaranteed the same as they are in the plist, i.e. as it is read (with initWithContentsOfFile)? Can I use allKeys on it in this case to get a correct-order array of keys if the dictionary never changes?

    Read the article

  • Curl automatically display the result?

    - by Emily
    I'm using php 5.3.2 and when i execute a curl it display the result directly without adding a print or echo function. Here is my code: <?php $pvars = array('query' => 'ice age', 'orderby' => 'popularity'); $timeout = 30; $myurl = "http://www.website.com"; $curl = curl_init(); curl_setopt($curl, CURLOPT_URL, $myurl); curl_setopt($curl, CURLOPT_TIMEOUT, $timeout); curl_setopt($curl, CURLOPT_POST, 1); curl_setopt($curl, CURLOPT_POSTFIELDS, $pvars); $xml = curl_exec($curl); curl_close ($curl); ?> What's wrong with my code and why it displays the result?

    Read the article

  • Statement hierarchy in programming languages

    - by sudo
    I quickly wrote an interpreter for some sort of experimental programing language i came up with, in PHP (yes, in PHP). The language itself doesn't have anything really special, I just wanted to give it a try. I got the basic things working (Hello World, input to output, string manipulation, arithmetics) but I'm getting stuck with the management of blocks and grouped statements. What I mean is: PHP and most other languages let you do this: ((2+2)*(8+2)+2), of course not only with mathematical computations. My program structure currently consists of a multidimensional array built like this: ID => Type (Identifier, String, Int, Newline, EOF, Comma, ...) Contents (If identifier, int or string) How could I allow statements to be executed in a defined order like in the PHP example above?

    Read the article

  • what is for....in statement in javascript

    - by dramasea
    anyone can explain how to use for...in statement in javascript. I had read the w3school article but i think it is not so clear.Below is the code, please explain this: <html> <body> <script type="text/javascript"> var x; var mycars = new Array(); mycars[10] = "Saab"; mycars[20] = "Volvo"; mycars[30] = "BMW"; for (x in mycars) { document.write(mycars[x] + "<br />"); } </script> </body> </html>

    Read the article

  • PHP pathinfo gets fooled by url in quert string. Any workaround?

    - by Majid
    I am working on a small function to take in a url and return a relative path based on where it resides itself. If the url contains a path in the query string, pathinfo returns incorrect results. This is demonstrated by the code below: $p = 'http://localhost/demos/image_editor/dir_adjuster.php?u=http://localhost/demos/some/dir/afile.txt'; $my_path_info = pathinfo($p); echo $p . '<br/><pre>'; print_r($my_path_info); echo '</pre>'; That code outputs: http://localhost/demos/image_editor/dir_adjuster.php?u=http://localhost/demos/some/dir/afile.txt Array ( [dirname] => http://localhost/demos/image_editor/dir_adjuster.php?u=http://localhost/demos/some/dir [basename] => afile.txt [extension] => txt [filename] => afile ) Which obviously is wrong. Any workaround?

    Read the article

  • Can an Excel VBA UDF called from the worksheet ever be passed an instance of any Excel VBA object mo

    - by jtolle
    I'm 99% sure that the answer is "no", but I'm wondering if someone who is 100% sure can say so. Consider a VBA UDF: Public Function f(x) End Function When you call this from the worksheet, 'x' will be a number, string, boolean, error, array, or object of type 'Range'. Can it ever be, say, an instance of 'Chart', 'ListObject', or any other Excel-VBA object model class? (The question arose from me moving to Excel 2007 and playing with Tables, and wondering if I could write UDFs that accept them as parameters instead of Ranges. The answer to that seems to be no, but then I realized I didn't know for sure in general.)

    Read the article

  • Codeigniter Form validation problem

    - by ben robinson
    Please please please can someone help me $this-load-library('form_validation'); $this-load-helper('cookie'); $data = array(); if($_POST) { // Set validation rules including additional validation for uniqueness $this-form_validation-set_rules('yourname', 'Your Name', 'trim|required'); $this-form_validation-set_rules('youremail', 'Your Email', 'trim|required|valid_email'); $this-form_validation-set_rules('friendname', 'Friends Name', 'trim|required'); $this-form_validation-set_rules('friendemail', 'Friends Email', 'trim|required|valid_email'); // Run the validation and take action if($this-form_validation-run()) { echo 'valid; } } else{ echo 'problem'; } Form validation is coming back with no errors can cany one see why?

    Read the article

< Previous Page | 449 450 451 452 453 454 455 456 457 458 459 460  | Next Page >