Search Results

Search found 11509 results on 461 pages for 'description logic'.

Page 451/461 | < Previous Page | 447 448 449 450 451 452 453 454 455 456 457 458  | Next Page >

  • parentNode.parentNode.rowindex to delete a row in a dynamic table

    - by billy85
    I am creating my rows dynamically when the user clicks on "Ajouter". <?xml version="1.0" encoding="UTF-8"?> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html> <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <script> function getXhr(){ var xhr = null; if(window.XMLHttpRequest) // Firefox and others xhr = new XMLHttpRequest(); else if(window.ActiveXObject){ // Internet Explorer try { xhr = new ActiveXObject("Msxml2.XMLHTTP"); } catch (e) { xhr = new ActiveXObject("Microsoft.XMLHTTP"); } } else { // XMLHttpRequest not supported by your browser alert("Votre navigateur ne supporte pas les objets XMLHTTPRequest..."); xhr = false; } return xhr } /** * method called when the user clicks on the button */ function go(){ var xhr = getXhr() // We defined what we gonna do with the response xhr.onreadystatechange = function(){ // We do somthing once the server's response is OK if(xhr.readyState == 4 && xhr.status == 200){ //alert(xhr.responseText); var body = document.getElementsByTagName("body")[0]; // Retrieve <table> ID and create a <tbody> element var tbl = document.getElementById("table"); var tblBody = document.createElement("tbody"); var row = document.createElement("tr"); // Create <td> elements and a text node, make the text // node the contents of the <td>, and put the <td> at // the end of the table row var cell_1 = document.createElement("td"); var cell_2 = document.createElement("td"); var cell_3 = document.createElement("td"); var cell_4 = document.createElement("td"); // Create the first cell which is a text zone var cell1=document.createElement("input"); cell1.type="text"; cell1.name="fname"; cell1.size="20"; cell1.maxlength="50"; cell_1.appendChild(cell1); // Create the second cell which is a text area var cell2=document.createElement("textarea"); cell2.name="fdescription"; cell2.rows="2"; cell2.cols="30"; cell_2.appendChild(cell2); var cell3 = document.createElement("div"); cell3.innerHTML=xhr.responseText; cell_3.appendChild(cell3); // Create the fourth cell which is a href var cell4 = document.createElement("a"); cell4.appendChild(document.createTextNode("[Delete]")); cell4.setAttribute("href","javascrit:deleteRow();"); cell_4.appendChild(cell4); // add cells to the row row.appendChild(cell_1); row.appendChild(cell_2); row.appendChild(cell_3); row.appendChild(cell_4); // add the row to the end of the table body tblBody.appendChild(row); // put the <tbody> in the <table> tbl.appendChild(tblBody); // appends <table> into <body> body.appendChild(tbl); // sets the border attribute of tbl to 2; tbl.setAttribute("border", "1"); } } xhr.open("GET","fstatus.php",true); xhr.send(null); } </head> <body > <h1> Create an Item </h1> <form method="post"> <table align="center" border = "2" cellspacing ="0" cellpadding="3" id="table"> <tr><td><b>Functionality Name:</b></td> <td><b>Description:</b></td> <td><b>Status:</b></td> <td><input type="button" Name= "Ajouter" Value="Ajouter" onclick="go()"></td></tr> </table> </form> </body> </html> Now, I would like to use the href [Delete] to delete one particular row. I wrote this: <script type="text/javascript"> function deleteRow(r){ var i=r.parentNode.parentNode.rowIndex; document.getElementById('table').deleteRow(i); } </script> When I change the first code like this: cell4.setAttribute("href","javascrit:deleteRow(this);"); I got an error: The page cannot be displayed. I am redirected to a new pagewhich can not be displayed. How could I delete my row by using the function deleteRow(r)? table is the id of my table Thanks. Billy85

    Read the article

  • problem processing xml in flex3

    - by john
    Hi All, First time here asking a question and still learning on how to format things better... so sorry about the format as it does not look too well. I have started learning flex and picked up a book and tried to follow the examples in it. However, I got stuck with a problem. I have a jsp page which returns xml which basically have a list of products. I am trying to parse this xml, in other words go through products, and create Objects for each product node and store them in an ArrayCollection. The problem I believe I am having is I am not using the right way of navigating through xml. The xml that is being returned from the server looks like this: <?xml version="1.0" encoding="ISO-8859-1"?><result type="success"> <products> <product> <id>6</id> <cat>electronics</cat> <name>Plasma Television</name> <desc>65 inch screen with 1080p</desc> <price>$3000.0</price> </product> <product> <id>7</id> <cat>electronics</cat> <name>Surround Sound Stereo</name> <desc>7.1 surround sound receiver with wireless speakers</desc> <price>$1000.0</price> </product> <product> <id>8</id> <cat>appliances</cat> <name>Refrigerator</name> <desc>Bottom drawer freezer with water and ice on the door</desc> <price>$1200.0</price> </product> <product> <id>9</id> <cat>appliances</cat> <name>Dishwasher</name> <desc>Large capacity with water saver setting</desc> <price>$500.0</price> </product> <product> <id>10</id> <cat>furniture</cat> <name>Leather Sectional</name> <desc>Plush leather with room for 6 people</desc> <price>$1500.0</price> </product> </products></result> And I have flex code that tries to iterate over products like following: private function productListHandler(e:JavaFlexStoreEvent):void { productData = new ArrayCollection(); trace(JavaServiceHandler(e.currentTarget).response); for each (var item:XML in JavaServiceHandler(e.currentTarget).response..product ) { productData.addItem( { id:item.id, item:item.name, price:item.price, description:item.desc }); } } with trace, I can see the xml being returned from the server. However, I cannot get inside the loop as if the xml was empty. In other words, JavaServiceHandler(e.currentTarget).response..product must be returning nothing. Can someone please help/point out what I could be doing wrong. My JavaServiceHandler class looks like this: package com.wiley.jfib.store.data { import com.wiley.jfib.store.events.JavaFlexStoreEvent; import flash.events.Event; import flash.events.EventDispatcher; import flash.net.URLLoader; import flash.net.URLRequest; public class JavaServiceHandler extends EventDispatcher { public var serviceURL:String = ""; public var response:XML; public function JavaServiceHandler() { } public function callServer():void { if(serviceURL == "") { throw new Error("serviceURL is a required parameter"); return; } var loader:URLLoader = new URLLoader(); loader.addEventListener(Event.COMPLETE, handleResponse); loader.load(new URLRequest(serviceURL)); // var httpService:HTTPService = new HTTPService(); // httpService.url = serviceURL; // httpService.resultFormat = "e4x"; // httpService.addEventListener(Event.COMPLETE, handleResponse); // httpService.send(); } private function handleResponse(e:Event):void { var loader:URLLoader = URLLoader(e.currentTarget); response = XML(loader.data); dispatchEvent(new JavaFlexStoreEvent(JavaFlexStoreEvent.DATA_LOADED) ); // var httpService:HTTPService = HTTPService(e.currentTarget); // response = httpService.lastResult.product; // dispatchEvent(new JavaFlexStoreEvent(JavaFlexStoreEvent.DATA_LOADED) ); } } } Even though I refer to this as mine and it is not in reality. This is from a Flex book as a code sample which does not work, go figure. Any help is appreciated. Thanks john

    Read the article

  • Choosing a scripting language for game and implementing it

    - by Radius
    Hello, I am currently developing a 3D Action/RPG game in C++, and I would like some advice in choosing a scripting language to program the AI of the game. My team comes from a modding background, and in fact we are still finishing work on a mod of the game Gothic. In that game (which we also got our inspiration from) the language DAEDALUS (created by Piranha Bytes, the makers of the game) is used. Here is a full description of said language. The main thing to notice about this is that it uses instances moreso than classes. The game engine is closed, and so one can only guess about the internal implementation of this language, but the main thing I am looking for in a scripting language (which ideally would be quite similar but preferably also more powerful than DAEDALUS) is the fact that there are de facto 3 'separations' of classes - ie classes, instances and (instances of instances?). I think it will be easier to understand what I want if I provide an example. Take a regular NPC. First of all you have a class defined which (I understand) mirrors the (class or structure) inside the engine: CLASS C_NPC { VAR INT id ; // absolute ID des NPCs VAR STRING name [5] ; // Namen des NPC VAR STRING slot ; VAR INT npcType ; VAR INT flags ; VAR INT attribute [ATR_INDEX_MAX] ; VAR INT protection [PROT_INDEX_MAX]; VAR INT damage [DAM_INDEX_MAX] ; VAR INT damagetype ; VAR INT guild,level ; VAR FUNC mission [MAX_MISSIONS] ; var INT fight_tactic ; VAR INT weapon ; VAR INT voice ; VAR INT voicePitch ; VAR INT bodymass ; VAR FUNC daily_routine ; // Tagesablauf VAR FUNC start_aistate ; // Zustandsgesteuert // ********************** // Spawn // ********************** VAR STRING spawnPoint ; // Beim Tod, wo respawnen ? VAR INT spawnDelay ; // Mit Delay in (Echtzeit)-Sekunden // ********************** // SENSES // ********************** VAR INT senses ; // Sinne VAR INT senses_range ; // Reichweite der Sinne in cm // ********************** // Feel free to use // ********************** VAR INT aivar [50] ; VAR STRING wp ; // ********************** // Experience dependant // ********************** VAR INT exp ; // EXerience Points VAR INT exp_next ; // EXerience Points needed to advance to next level VAR INT lp ; // Learn Points }; Then, you can also define prototypes (which set some default values). But how you actually define an NPC is like this: instance BAU_900_Ricelord (Npc_Default) //Inherit from prototype Npc_Default { //-------- primary data -------- name = "Ryzowy Ksiaze"; npctype = NPCTYPE_GUARD; guild = GIL_BAU; level = 10; voice = 12; id = 900; //-------- abilities -------- attribute[ATR_STRENGTH] = 50; attribute[ATR_DEXTERITY] = 10; attribute[ATR_MANA_MAX] = 0; attribute[ATR_MANA] = 0; attribute[ATR_HITPOINTS_MAX]= 170; attribute[ATR_HITPOINTS] = 170; //-------- visuals -------- // animations Mdl_SetVisual (self,"HUMANS.MDS"); Mdl_ApplyOverlayMds (self,"Humans_Arrogance.mds"); Mdl_ApplyOverlayMds (self,"HUMANS_DZIDA.MDS"); // body mesh ,bdytex,skin,head mesh ,headtex,teethtex,ruestung Mdl_SetVisualBody (self,"Hum_Body_CookSmith",1,1,"Hum_Head_FatBald",91 , 0,-1); B_Scale (self); Mdl_SetModelFatness(self,2); fight_tactic = FAI_HUMAN_STRONG; //-------- Talente -------- Npc_SetTalentSkill (self,NPC_TALENT_1H,1); //-------- inventory -------- CreateInvItems (self, ItFoRice,10); CreateInvItem (self, ItFoWine); CreateInvItems(self, ItMiNugget,40); EquipItem (self, Heerscherstab); EquipItem (self, MOD_AMULETTDESREISLORDS); CreateInvItem (self, ItMi_Alchemy_Moleratlubric_01); //CreateInvItem (self,ItKey_RB_01); EquipItem (self, Ring_des_Lebens); //-------------Daily Routine------------- daily_routine = Rtn_start_900; }; FUNC VOID Rtn_start_900 () { TA_Boss (07,00,20,00,"NC_RICELORD"); TA_SitAround (20,00,24,00,"NC_RICELORD_SIT"); TA_Sleep (24,00,07,00,"NC_RICEBUNKER_10"); }; As you can see, the instance declaration is more like a constructor function, setting values and calling functions from within. This still wouldn't pose THAT much of a problem, if not for one more thing: multiple copies of this instance. For example, you can spawn multiple BAU_900_Ricelord's, and each of them keeps track of its own AI state, hitpoints etc. Now I think the instances are represented as ints (maybe even as the id of the NPC) inside the engine, as whenever (inside the script) you use the expression BAU_900_Ricelord it can be only assigned to an int variable, and most functions that operate on NPCs take that int value. However to directly modify its hitpoints etc you have to do something like var C_NPC npc = GetNPC(Bau_900_Ricelord); npc.attribute[ATR_HITPOINTS] = 10; ie get the actual C_NPC object that represents it. To finally recap - is it possible to get this kind of behaviour in any scripting languages you know of, or am I stuck with having to make my own? Or maybe there is an even better way of representing NPC's and their behaviours that way. The IDEAL language for scripting for me would be C#, as I simply adore that language, but somehow I doubt it is possible or indeed feasible to try and implement a similar kind of behaviour in C#. Many thanks

    Read the article

  • Finding the heaviest length-constrained path in a weighted Binary Tree

    - by Hristo
    UPDATE I worked out an algorithm that I think runs in O(n*k) running time. Below is the pseudo-code: routine heaviestKPath( T, k ) // create 2D matrix with n rows and k columns with each element = -8 // we make it size k+1 because the 0th column must be all 0s for a later // function to work properly and simplicity in our algorithm matrix = new array[ T.getVertexCount() ][ k + 1 ] (-8); // set all elements in the first column of this matrix = 0 matrix[ n ][ 0 ] = 0; // fill our matrix by traversing the tree traverseToFillMatrix( T.root, k ); // consider a path that would arc over a node globalMaxWeight = -8; findArcs( T.root, k ); return globalMaxWeight end routine // node = the current node; k = the path length; node.lc = node’s left child; // node.rc = node’s right child; node.idx = node’s index (row) in the matrix; // node.lc.wt/node.rc.wt = weight of the edge to left/right child; routine traverseToFillMatrix( node, k ) if (node == null) return; traverseToFillMatrix(node.lc, k ); // recurse left traverseToFillMatrix(node.rc, k ); // recurse right // in the case that a left/right child doesn’t exist, or both, // let’s assume the code is smart enough to handle these cases matrix[ node.idx ][ 1 ] = max( node.lc.wt, node.rc.wt ); for i = 2 to k { // max returns the heavier of the 2 paths matrix[node.idx][i] = max( matrix[node.lc.idx][i-1] + node.lc.wt, matrix[node.rc.idx][i-1] + node.rc.wt); } end routine // node = the current node, k = the path length routine findArcs( node, k ) if (node == null) return; nodeMax = matrix[node.idx][k]; longPath = path[node.idx][k]; i = 1; j = k-1; while ( i+j == k AND i < k ) { left = node.lc.wt + matrix[node.lc.idx][i-1]; right = node.rc.wt + matrix[node.rc.idx][j-1]; if ( left + right > nodeMax ) { nodeMax = left + right; } i++; j--; } // if this node’s max weight is larger than the global max weight, update if ( globalMaxWeight < nodeMax ) { globalMaxWeight = nodeMax; } findArcs( node.lc, k ); // recurse left findArcs( node.rc, k ); // recurse right end routine Let me know what you think. Feedback is welcome. I think have come up with two naive algorithms that find the heaviest length-constrained path in a weighted Binary Tree. Firstly, the description of the algorithm is as follows: given an n-vertex Binary Tree with weighted edges and some value k, find the heaviest path of length k. For both algorithms, I'll need a reference to all vertices so I'll just do a simple traversal of the Tree to have a reference to all vertices, with each vertex having a reference to its left, right, and parent nodes in the tree. Algorithm 1 For this algorithm, I'm basically planning on running DFS from each node in the Tree, with consideration to the fixed path length. In addition, since the path I'm looking for has the potential of going from left subtree to root to right subtree, I will have to consider 3 choices at each node. But this will result in a O(n*3^k) algorithm and I don't like that. Algorithm 2 I'm essentially thinking about using a modified version of Dijkstra's Algorithm in order to consider a fixed path length. Since I'm looking for heaviest and Dijkstra's Algorithm finds the lightest, I'm planning on negating all edge weights before starting the traversal. Actually... this doesn't make sense since I'd have to run Dijkstra's on each node and that doesn't seem very efficient much better than the above algorithm. So I guess my main questions are several. Firstly, do the algorithms I've described above solve the problem at hand? I'm not totally certain the Dijkstra's version will work as Dijkstra's is meant for positive edge values. Now, I am sure there exist more clever/efficient algorithms for this... what is a better algorithm? I've read about "Using spine decompositions to efficiently solve the length-constrained heaviest path problem for trees" but that is really complicated and I don't understand it at all. Are there other algorithms that tackle this problem, maybe not as efficiently as spine decomposition but easier to understand? Thanks.

    Read the article

  • Authoritative sources about Database vs. Flatfile decision

    - by FastAl
    <tldr>looking for a reference to a book or other undeniably authoritative source that gives reasons when you should choose a database vs. when you should choose other storage methods. I have provided an un-authoritative list of reasons about 2/3 of the way down this post.</tldr> I have a situation at my company where a database is being used where it would be better to use another solution (in this case, an auto-generated piece of source code that contains a static lookup table, searched by binary sort). Normally, a database would be an OK solution even though the problem does not require a database, e.g, none of the elements of ACID are needed, as it is read-only data, updated about every 3-5 years (also requiring other sourcecode changes), and fits in memory, and can be keyed into via binary search (a tad faster than db, but speed is not an issue). The problem is that this code runs on our enterprise server, but is shared with several PC platforms (some disconnected, some use a central DB, etc.), and parts of it are managed by multiple programming units, parts by the DBAs, parts even by mathematicians in another department, etc. These hit their own platform’s version of their databases (containing their own copy of the static data). What happens is that every implementation, every little change, something different goes wrong. There are many other issues as well. I can’t even use a flatfile, because one mode of running on our enterprise server does not have permission to read files (only databases, and of course, its own literal storage, e.g., in-source table). Of course, other parts of the system use databases in proper, less obscure manners; there is no problem with those parts. So why don’t we just change it? I don’t have administrative ability to force a change. But I’m affected because sometimes I have to help fix the problems, but mostly because it causes outages and tons of extra IT time by other programmers and d*mmit that makes me mad! The reason neither management, nor the designers of the system, can see the problem is that they propose a solution that won’t work: increase communication; implement more safeguards and standards; etc. But every time, in a different part of the already-pared-down but still multi-step processes, a few different diligent, hard-working, top performing IT personnel make a unique subtle error that causes it to fail, sometimes after the last round of testing! And in general these are not single-person failures, but understandable miscommunications. And communication at our company is actually better than most. People just don't think that's the case because they haven't dug into the matter. However, I have it on very good word from somebody with extensive formal study of sociology and psychology that the relatively small amount of less-than-proper database usage in this gigantic cross-platform multi-source, multi-language project is bureaucratically un-maintainable. Impossible. No chance. At least with Human Beings in the loop, and it can’t be automated. In addition, the management and developers who could change this, though intelligent and capable, don’t understand the rigidity of this ‘how humans are’ issue, and are not convincible on the matter. The reason putting the static data in sourcecode will solve the problem is, although the solution is less sexy than a database, it would function with no technical drawbacks; and since the sharing of sourcecode already works very well, you basically erase any database-related effort from this section of the project, along with all the drawbacks of it that are causing problems. OK, that’s the background, for the curious. I won’t be able to convince management that this is an unfixable sociological problem, and that the real solution is coding around these limits of human nature, just as you would code around a bug in a 3rd party component that you can’t change. So what I have to do is exploit the unsuitableness of the database solution, and not do it using logic, but rather authority. I am aware of many reasons, and posts on this site giving reasons for one over the other; I’m not looking for lists of reasons like these (although you can add a comment if I've miss a doozy): WHY USE A DATABASE? instead of flatfile/other DB vs. file: if you need... Random Read / Transparent search optimization Advanced / varied / customizable Searching and sorting capabilities Transaction/rollback Locks, semaphores Concurrency control / Shared users Security 1-many/m-m is easier Easy modification Scalability Load Balancing Random updates / inserts / deletes Advanced query Administrative control of design, etc. SQL / learning curve Debugging / Logging Centralized / Live Backup capabilities Cached queries / dvlp & cache execution plans Interleaved update/read Referential integrity, avoid redundant/missing/corrupt/out-of-sync data Reporting (from on olap or oltp db) / turnkey generation tools [Disadvantages:] Important to get right the first time - professional design - but only b/c it's meant to last s/w & h/w cost Usu. over a network, speed issue (best vs. best design vs. local=even then a separate process req's marshalling/netwk layers/inter-p comm) indicies and query processing can stand in the way of simple processing (vs. flatfile) WHY USE FLATFILE: If you only need... Sequential Row processing only Limited usage append only (no reading, no master key/update) Only Update the record you're reading (fixed length recs only) Too big to fit into memory If Local disk / read-ahead network connection Portability / small system Email / cut & Paste / store as document by novice - simple format Low design learning curve but high cost later WHY USE IN-MEMORY/TABLE (tables, arrays, etc.): if you need... Processing a single db/ff record that was imported Known size of data Static data if hardcoding the table Narrow, unchanging use (e.g., one program or proc) -includes a class that will be shared, but encapsulates its data manipulation Extreme speed needed / high transaction frequency Random access - but search is dependent on implementation Following are some other posts about the topic: http://stackoverflow.com/questions/1499239/database-vs-flat-text-file-what-are-some-technical-reasons-for-choosing-one-over http://stackoverflow.com/questions/332825/are-flat-file-databases-any-good http://stackoverflow.com/questions/2356851/database-vs-flat-files http://stackoverflow.com/questions/514455/databases-vs-plain-text/514530 What I’d like to know is if anybody could recommend a hard, authoritative source containing these reasons. I’m looking for a paper book I can buy, or a reputable website with whitepapers about the issue (e.g., Microsoft, IBM), not counting the user-generated content on those sites. This will have a greater change to elicit a change that I’m looking for: less wasted programmer time, and more reliable programs. Thanks very much for your help. You win a prize for reading such a large post!

    Read the article

  • How should I model the database for this problem? And which ORM can handle it?

    - by Kristof Claes
    I need to build some sort of a custom CMS for a client of ours. These are some of the functional requirements: Must be able to manage the list of Pages in the site Each Page can contain a number of ColumnGroups A ColumnGroup is nothing more than a list of Columns in a certain ColumnGroupLayout. For example: "one column taking up the entire width of the page", "two columns each taking up half of the width", ... Each Column can contain a number ContentBlocks Examples of a ContentBlock are: TextBlock, NewsBlock, PictureBlock, ... ContentBlocks can be given a certain sorting within a Column A ContentBlock can be put in different Columns so that content can be reused without having to be duplicated. My first quick draft of how this could look like in C# code (we're using ASP.NET 4.0 to develop the CMS) can be found at the bottom of my question. One of the technical requirements is that it must be as easy as possible to add new types of ContentBlocks to the CMS. So I would like model everything as flexible as possible. Unfortunately, I'm already stuck at trying to figure out how the database should look like. One of the problems I'm having has to do with sorting different types of ContentBlocks in a Column. I guess each type of ContentBlock (like TextBlock, NewsBlock, PictureBlock, ...) should have it's own table in the database because each has it's own different fields. A TextBlock might only have a field called Text whereas a NewsBlock might have fields for the Text, the Summary, the PublicationDate, ... Since one Column can have ContentBlocks located in different tables, I guess I'll have to create a many-to-many association for each type of ContentBlock. For example: ColumnTextBlocks, ColumnNewsBlocks and ColumnPictureBlocks. The problem I have with this setup is the sorting of the different ContentBlocks in a column. This could be something like this: TextBlock NewsBlock TextBlock TextBlock PictureBlock Where do I store the sorting number? If I store them in the associaton tables, I'll have to update a lot of tables when changing the sorting order of ContentBlocks in a Column. Is this a good approach to the problem? Basically, my question is: What is the best way to model this keeping in mind that it should be easy to add new types of ContentBlocks? My next question is: What ORM can deal with that kind of modeling? To be honest, we are ORM-virgins at work. I have been reading a bit about Linq-to-SQL and NHibernate, but we have no experience with them. Because of the IList in the Column class (see code below) I think we can rule out Linq-to-SQL, right? Can NHibernate handle the mapping of data from many different tables to one IList? Also keep in mind that this is just a very small portion of the domain. Other parts are Users belonging to a certain UserGroup having certain Permissions on Pages, ColumnGroups, Columns and ContentBlocks. The code (just a quick first draft): public class Page { public int PageID { get; set; } public string Title { get; set; } public string Description { get; set; } public string Keywords { get; set; } public IList<ColumnGroup> ColumnGroups { get; set; } } public class ColumnGroup { public enum ColumnGroupLayout { OneColumn, HalfHalf, NarrowWide, WideNarrow } public int ColumnGroupID { get; set; } public ColumnGroupLayout Layout { get; set; } public IList<Column> Columns { get; set; } } public class Column { public int ColumnID { get; set; } public IList<IContentBlock> ContentBlocks { get; set; } } public interface IContentBlock { string GetSummary(); } public class TextBlock : IContentBlock { public string GetSummary() { return "I am a piece of text."; } } public class NewsBlock : IContentBlock { public string GetSummary() { return "I am a news item."; } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How do I prove I should put a table of values in source code instead of a database table?

    - by FastAl
    <tldr>looking for a reference to a book or other undeniably authoritative source that gives reasons when you should choose a database vs. when you should choose other storage methods. I have provided an un-authoritative list of reasons about 2/3 of the way down this post.</tldr> I have a situation at my company where a database is being used where it would be better to use another solution (in this case, an auto-generated piece of source code that contains a static lookup table, searched by binary sort). Normally, a database would be an OK solution even though the problem does not require a database, e.g, none of the elements of ACID are needed, as it is read-only data, updated about every 3-5 years (also requiring other sourcecode changes), and fits in memory, and can be keyed into via binary search (a tad faster than db, but speed is not an issue). The problem is that this code runs on our enterprise server, but is shared with several PC platforms (some disconnected, some use a central DB, etc.), and parts of it are managed by multiple programming units, parts by the DBAs, parts even by mathematicians in another department, etc. These hit their own platform’s version of their databases (containing their own copy of the static data). What happens is that every implementation, every little change, something different goes wrong. There are many other issues as well. I can’t even use a flatfile, because one mode of running on our enterprise server does not have permission to read files (only databases, and of course, its own literal storage, e.g., in-source table). Of course, other parts of the system use databases in proper, less obscure manners; there is no problem with those parts. So why don’t we just change it? I don’t have administrative ability to force a change. But I’m affected because sometimes I have to help fix the problems, but mostly because it causes outages and tons of extra IT time by other programmers and d*mmit that makes me mad! The reason neither management, nor the designers of the system, can see the problem is that they propose a solution that won’t work: increase communication; implement more safeguards and standards; etc. But every time, in a different part of the already-pared-down but still multi-step processes, a few different diligent, hard-working, top performing IT personnel make a unique subtle error that causes it to fail, sometimes after the last round of testing! And in general these are not single-person failures, but understandable miscommunications. And communication at our company is actually better than most. People just don't think that's the case because they haven't dug into the matter. However, I have it on very good word from somebody with extensive formal study of sociology and psychology that the relatively small amount of less-than-proper database usage in this gigantic cross-platform multi-source, multi-language project is bureaucratically un-maintainable. Impossible. No chance. At least with Human Beings in the loop, and it can’t be automated. In addition, the management and developers who could change this, though intelligent and capable, don’t understand the rigidity of this ‘how humans are’ issue, and are not convincible on the matter. The reason putting the static data in sourcecode will solve the problem is, although the solution is less sexy than a database, it would function with no technical drawbacks; and since the sharing of sourcecode already works very well, you basically erase any database-related effort from this section of the project, along with all the drawbacks of it that are causing problems. OK, that’s the background, for the curious. I won’t be able to convince management that this is an unfixable sociological problem, and that the real solution is coding around these limits of human nature, just as you would code around a bug in a 3rd party component that you can’t change. So what I have to do is exploit the unsuitableness of the database solution, and not do it using logic, but rather authority. I am aware of many reasons, and posts on this site giving reasons for one over the other; I’m not looking for lists of reasons like these (although you can add a comment if I've miss a doozy): WHY USE A DATABASE? instead of flatfile/other DB vs. file: if you need... Random Read / Transparent search optimization Advanced / varied / customizable Searching and sorting capabilities Transaction/rollback Locks, semaphores Concurrency control / Shared users Security 1-many/m-m is easier Easy modification Scalability Load Balancing Random updates / inserts / deletes Advanced query Administrative control of design, etc. SQL / learning curve Debugging / Logging Centralized / Live Backup capabilities Cached queries / dvlp & cache execution plans Interleaved update/read Referential integrity, avoid redundant/missing/corrupt/out-of-sync data Reporting (from on olap or oltp db) / turnkey generation tools [Disadvantages:] Important to get right the first time - professional design - but only b/c it's meant to last s/w & h/w cost Usu. over a network, speed issue (best vs. best design vs. local=even then a separate process req's marshalling/netwk layers/inter-p comm) indicies and query processing can stand in the way of simple processing (vs. flatfile) WHY USE FLATFILE: If you only need... Sequential Row processing only Limited usage append only (no reading, no master key/update) Only Update the record you're reading (fixed length recs only) Too big to fit into memory If Local disk / read-ahead network connection Portability / small system Email / cut & Paste / store as document by novice - simple format Low design learning curve but high cost later WHY USE IN-MEMORY/TABLE (tables, arrays, etc.): if you need... Processing a single db/ff record that was imported Known size of data Static data if hardcoding the table Narrow, unchanging use (e.g., one program or proc) -includes a class that will be shared, but encapsulates its data manipulation Extreme speed needed / high transaction frequency Random access - but search is dependent on implementation Following are some other posts about the topic: http://stackoverflow.com/questions/1499239/database-vs-flat-text-file-what-are-some-technical-reasons-for-choosing-one-over http://stackoverflow.com/questions/332825/are-flat-file-databases-any-good http://stackoverflow.com/questions/2356851/database-vs-flat-files http://stackoverflow.com/questions/514455/databases-vs-plain-text/514530 What I’d like to know is if anybody could recommend a hard, authoritative source containing these reasons. I’m looking for a paper book I can buy, or a reputable website with whitepapers about the issue (e.g., Microsoft, IBM), not counting the user-generated content on those sites. This will have a greater change to elicit a change that I’m looking for: less wasted programmer time, and more reliable programs. Thanks very much for your help. You win a prize for reading such a large post!

    Read the article

  • i have made a from and want to connect it to a oracle 10g data base using php.can you please assume

    - by nachiket-panse
    http://www.freecsstemplates.org Released for free under a Creative Commons Attribution 2.5 License -- Sitename.com by Free Css Templates MANAGEMEINT INFORMATION SYSTEM   <p class="style2">&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;REGISTRY ENTRY FORM </p> <form id="form2" method="post" action=""> <p align="center">&nbsp;</p> <p align="center"><span class="style3">JOB DESCRIPTION :</span>&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp; &nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp; <textarea name="textarea"></textarea> </p> <p align="center"><span class="style3">QUANTITY :</span>&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp; <input type="text" name="textfield5" /> </p> <p align="center">&nbsp;<span class="style3">CONTACT PERSON </span>&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp; <input type="text" name="textfield3" /> </p> <p align="center">&nbsp;</p> <p align="center"><span class="style3">DIVISION CODE: <textarea name="textarea3"></textarea> </span></p> <p align="center"><span class="style3">ACCEPTANCE DATE </span>: <input type="text" name="textfield4" /> </p> <p align="center"><span class="style3">REFERENCE NUMBER :</span> <input type="text" name="textfield2" /> </p> <p align="center"><span class="style3">CLASSIFICATION :</span>&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp; <input type="text" name="textfield" /></p> <p align="center">&nbsp;</p> <p align="center"><span class="style3">CUMULATIVE COST: </span> <select name="select"> </select> </p> <p align="center"><span class="style3">PLANNING ENGR: </span> <textarea name="textarea2"></textarea> </p> <p align="center"><span class="style3">PLANNING: </span> <input type="text" name="textfield6" /> </p> <p align="center"> <span class="style3">FILL THE COMPLETION DATE: </span> <input type="text" name="textfield7" /> </p> <p align="center"><span class="style3">REMARKS: </span> <input type="text" name="textfield8" /> </p> <p align="center">&nbsp;</p> <p align="center"> <input type="submit" name="SAVE" value="SAVE" /> <input type="submit" name="Submit2" value="LIST" /> <input type="submit" name="Submit" value="ADD" /> <input type="submit" name="Submit3" value="CANCEL" /> <input type="submit" name="BACK" value="BACK" /></p> <p align="center">&nbsp;</p> <p align="center">&nbsp;</p> <p align="center">&nbsp;</p> <p align="center">&nbsp;</p> <p align="center">&nbsp;</p> </form> <p align="center" class="style2">&nbsp;</p>

    Read the article

  • Twitter Bootstrap Collapsible Navbar Duplicating

    - by sixeightzero
    I am working on a project using Twitter Bootstrap. One thing that I noticed is that my pages have duplicate navbars when they are defined as collapsible and the page is resized smaller. Here is the duplicate NavBar: Here is the normal width NavBar: Code: <!DOCTYPE html> <html lang="en"> <!--[if lt IE 7]> <html class="no-js lt-ie9 lt-ie8 lt-ie7"> <![endif]--> <!--[if IE 7]> <html class="no-js lt-ie9 lt-ie8"> <![endif]--> <!--[if IE 8]> <html class="no-js lt-ie9"> <![endif]--> <!--[if gt IE 8]><!--> <html class="no-js"> <!--<![endif]--> <head> <meta charset="utf-8"> <meta http-equiv="X-UA-Compatible" content="IE=edge,chrome=1"> <title></title> <meta name="description" content=""> <meta name="viewport" content="width=device-width"> <link rel="stylesheet" href="/assets/css/bootstrap.css"> <style> body { padding-top: 60px; } </style> <link rel="stylesheet" href="/assets/css/bootstrap-responsive.min.css"> <link rel="stylesheet" href="/assets/css/main.css"> <script>window.jQuery || document.write('<script src="/assets/js/vendor/jquery-1.8.1.min.js"><\/script>')</script> <script src="/assets/js/vendor/modernizr-2.6.1-respond-1.1.0.min.js"></script> </head> <body class="dark"> <!--[if lt IE 9]> <p class="chromeframe">You are using an outdated browser. <a href="http://browsehappy.com/">Upgrade your browser today</a> or <a href="http://www.google.com/chromeframe/?redirect=true">install Google Chrome Frame</a> to better experience this site.</p> <![endif]--> <div class="navbar navbar-inverse navbar-fixed-top"> <div class="navbar-inner"> <div class="container"> <a class="btn btn-navbar" data-toggle="collapse" data-target=".nav-collapse"> <span class="icon-bar"></span> <span class="icon-bar"></span> <span class="icon-bar"></span> </a> <a class="brand" href="#">Project name</a> <div class="nav-collapse collapse"> <ul class="nav"> <li class="active"><a href="#">Home</a></li> <li><a href="#about">About</a></li> <li><a href="#contact">Contact</a></li> <li class="dropdown"> <a href="#" class="dropdown-toggle" data-toggle="dropdown">Dropdown <b class="caret"></b></a> <ul class="dropdown-menu"> <li><a href="#">Action</a></li> <li><a href="#">Another action</a></li> <li><a href="#">Something else here</a></li> <li class="divider"></li> <li class="nav-header">Nav header</li> <li><a href="#">Separated link</a></li> <li><a href="#">One more separated link</a></li> </ul> </li> </ul> </div><!--/.nav-collapse --> </div> </div> </div> Has anyone else run into this and have some pointers?

    Read the article

  • How to use iterator in nested arraylist

    - by Muhammad Abrar
    I am trying to build an NFA with a special purpose of searching, which is totally different from regex. The State has following format class State implements List{ //GLOBAL DATA static int depth; //STATE VALUES String stateName; ArrayList<String> label = new ArrayList<>(); //Label for states //LINKS TO OTHER STATES boolean finalState; ArrayList<State> nextState ; // Link with multiple next states State preState; // previous state public State() { stateName = ""; finalState = true; nextState = new ArrayList<>(); } public void addlabel(String lbl) { if(!this.label.contains(lbl)) this.label.add(lbl); } public State(String state, String lbl) { this.stateName = state; if(!this.label.contains(lbl)) this.label.add(lbl); depth++; } public State(String state, String lbl, boolean fstate) { this.stateName = state; this.label.add(lbl); this.finalState = fstate; this.nextState = new ArrayList<>(); } void displayState() { System.out.print(this.stateName+" --> "); for(Iterator<String> it = label.iterator(); it.hasNext();) { System.out.print(it.next()+" , "); } System.out.println("\nNo of States : "+State.depth); } Next, the NFA class is public class NFA { static final String[] STATES= {"A","B","C","D","E","F","G","H","I","J","K","L","M" ,"N","O","P","Q","R","S","T","U","V","W","X","Y","Z"}; State startState; State currentState; static int level; public NFA() { startState = new State(); startState = null; currentState = new State(); currentState = null; startState = currentState; } /** * * @param st */ NFA(State startstate) { startState = new State(); startState = startstate; currentState = new State(); currentState = null; currentState = startState ; // To show that their is only one element in NFA } boolean insertState(State newState) { newState.nextState = new ArrayList<>(); if(currentState == null && startState == null ) //if empty NFA { newState.preState = null; startState = newState; currentState = newState; State.depth = 0; return true; } else { if(!Exist(newState.stateName))//Exist is used to check for duplicates { newState.preState = currentState ; currentState.nextState.add(newState); currentState = newState; State.depth++; return true; } } return false; } boolean insertState(State newState, String label) { newState.label.add(label); newState.nextState = null; newState.preState = null; if(currentState == null && startState == null) { startState = newState; currentState = newState; State.depth = 0; return true; } else { if(!Exist(newState.stateName)) { newState.preState = currentState; currentState.nextState.add(newState); currentState = newState; State.depth++; return true; } else { ///code goes here } } return false; } void markFinal(State s) { s.finalState = true; } void unmarkFinal(State s) { s.finalState = false; } boolean Exist(String s) { State temp = startState; if(startState.stateName.equals(s)) return true; Iterator<State> it = temp.nextState.iterator(); while(it.hasNext()) { Iterator<State> i = it ;//startState.nextState.iterator(); { while(i.hasNext()) { if(i.next().stateName.equals(s)) return true; } } //else // return false; } return false; } void displayNfa() { State st = startState; if(startState == null && currentState == null) { System.out.println("The NFA is empty"); } else { while(st != null) { if(!st.nextState.isEmpty()) { Iterator<State> it = st.nextState.iterator(); do { st.displayState(); st = it.next(); }while(it.hasNext()); } else { st = null; } } } System.out.println(); } /** * @param args the command line arguments */ /** * * @param args the command line arguments */ public static void main(String[] args) { // TODO code application logic here NFA l = new NFA(); State s = new State("A11", "a",false); NFA ll = new NFA(s); s = new State("A111", "a",false); ll.insertState(s); ll.insertState(new State("A1","0")); ll.insertState(new State("A1111","0")); ll.displayNfa(); int j = 1; for(int i = 0 ; i < 2 ; i++) { int rand = (int) (Math.random()* 10); State st = new State(STATES[rand],String.valueOf(i), false); if(l.insertState(st)) { System.out.println(j+" : " + STATES[rand]+" and "+String.valueOf(i)+ " inserted"); j++; } } l.displayNfa(); System.out.println("No of states inserted : "+ j--); } I want to do the following This program always skip to display the last state i.e. if there are 10 states inserted, it will display only 9. In exist() method , i used two iterator but i do not know why it is working I have no idea how to perform searching for the existing class name, when dealing with iterators. How should i keep track of current State, properly iterate through the nextState List, Label List in a depth first order. How to insert unique States i.e. if State "A" is inserted once, it should not insert it again (The exist method is not working) Best Regards

    Read the article

  • how to pass an id number string to this class

    - by Phil
    I'm very much a vb person, but have had to use this id number class in c#. I got it from http://www.codingsanity.com/idnumber.htm : using System; using System.Text.RegularExpressions; namespace Utilities.SouthAfrica { /// <summary> /// Represents a South African Identity Number. /// valid number = 7707215230080 /// invalid test number = 1234567891234 /// /// </summary> [Serializable()] public class IdentityNumber { #region Enumerations /// <summary> /// Indicates a gender. /// </summary> public enum PersonGender { Female = 0, Male = 5 } public enum PersonCitizenship { SouthAfrican = 0, Foreign = 1 } #endregion #region Declarations static Regex _expression; Match _match; const string _IDExpression = @"(?<Year>[0-9][0-9])(?<Month>([0][1-9])|([1][0-2]))(?<Day>([0-2][0-9])|([3][0-1]))(?<Gender>[0-9])(?<Series>[0-9]{3})(?<Citizenship>[0-9])(?<Uniform>[0-9])(?<Control>[0-9])"; #endregion #region Constuctors /// <summary> /// Sets up the shared objects for ID validation. /// </summary> static IdentityNumber() { _expression = new Regex(_IDExpression, RegexOptions.Compiled | RegexOptions.Singleline); } /// <summary> /// Creates the ID number from a string. /// </summary> /// <param name="IDNumber">The string ID number.</param> public IdentityNumber(string IDNumber) { _match = _expression.Match(IDNumber.Trim()); } #endregion #region Properties /// <summary> /// Indicates the date of birth encoded in the ID Number. /// </summary> /// <exception cref="System.ArgumentException">Thrown if the ID Number is not usable.</exception> public DateTime DateOfBirth { get { if(IsUsable == false) { throw new ArgumentException("ID Number is unusable!", "IDNumber"); } int year = int.Parse(_match.Groups["Year"].Value); // NOTE: Do not optimize by moving these to static, otherwise the calculation may be incorrect // over year changes, especially century changes. int currentCentury = int.Parse(DateTime.Now.Year.ToString().Substring(0, 2) + "00"); int lastCentury = currentCentury - 100; int currentYear = int.Parse(DateTime.Now.Year.ToString().Substring(2, 2)); // If the year is after or at the current YY, then add last century to it, otherwise add // this century. // TODO: YY -> YYYY logic needs thinking about if(year > currentYear) { year += lastCentury; } else { year += currentCentury; } return new DateTime(year, int.Parse(_match.Groups["Month"].Value), int.Parse(_match.Groups["Day"].Value)); } } /// <summary> /// Indicates the gender for the ID number. /// </summary> /// <exception cref="System.ArgumentException">Thrown if the ID Number is not usable.</exception> public PersonGender Gender { get { if(IsUsable == false) { throw new ArgumentException("ID Number is unusable!", "IDNumber"); } int gender = int.Parse(_match.Groups["Gender"].Value); if(gender < (int) PersonGender.Male) { return PersonGender.Female; } else { return PersonGender.Male; } } } /// <summary> /// Indicates the citizenship for the ID number. /// </summary> /// <exception cref="System.ArgumentException">Thrown if the ID Number is not usable.</exception> public PersonCitizenship Citizenship { get { if(IsUsable == false) { throw new ArgumentException("ID Number is unusable!", "IDNumber"); } return (PersonCitizenship) Enum.Parse(typeof(PersonCitizenship), _match.Groups["Citizenship"].Value); } } /// <summary> /// Indicates if the IDNumber is usable or not. /// </summary> public bool IsUsable { get { return _match.Success; } } /// <summary> /// Indicates if the IDNumber is valid or not. /// </summary> public bool IsValid { get { if(IsUsable == true) { // Calculate total A by adding the figures in the odd positions i.e. the first, third, fifth, // seventh, ninth and eleventh digits. int a = int.Parse(_match.Value.Substring(0, 1)) + int.Parse(_match.Value.Substring(2, 1)) + int.Parse(_match.Value.Substring(4, 1)) + int.Parse(_match.Value.Substring(6, 1)) + int.Parse(_match.Value.Substring(8, 1)) + int.Parse(_match.Value.Substring(10, 1)); // Calculate total B by taking the even figures of the number as a whole number, and then // multiplying that number by 2, and then add the individual figures together. int b = int.Parse(_match.Value.Substring(1, 1) + _match.Value.Substring(3, 1) + _match.Value.Substring(5, 1) + _match.Value.Substring(7, 1) + _match.Value.Substring(9, 1) + _match.Value.Substring(11, 1)); b *= 2; string bString = b.ToString(); b = 0; for(int index = 0; index < bString.Length; index++) { b += int.Parse(bString.Substring(index, 1)); } // Calculate total C by adding total A to total B. int c = a + b; // The control-figure can now be determined by subtracting the ones in figure C from 10. string cString = c.ToString() ; cString = cString.Substring(cString.Length - 1, 1) ; int control = 0; // Where the total C is a multiple of 10, the control figure will be 0. if(cString != "0") { control = 10 - int.Parse(cString.Substring(cString.Length - 1, 1)); } if(_match.Groups["Control"].Value == control.ToString()) { return true; } } return false; } } #endregion } } Here is the code from my default.aspx.cs page: using System; using System.Collections.Generic; using System.Linq; using System.Web; using System.Web.UI; using System.Web.UI.WebControls; using Utilities.Southafrica; <- this is the one i added to public partial class _Default : System.Web.UI.Page { protected void Page_Load(object sender, EventArgs e) { var someNumber = new IdentityNumber("123456"); <- gives error } } Can someone please tell the syntax for how I pass an id number to the class? Thanks

    Read the article

  • Help needed on an SQL configuration problem.

    - by user321048
    I have been banging my head with this one more the two weeks, and still don't know what the problem is ( I can't narrow it down). The problem is the following. I have a solution with 3 project in it all written in c# and I with LINQ. One project is the main web site, the other is the data layer (communication with the database) and the third one is a custom little CMS. The problem is the following: On a hosting provider when I publish the site it all works perfectly, but this site was needed to be hosted on the client server so I needed to do that. But the problem is that I also needed to configure the client server, because they don't have an Administrator employed (I know, I know ;) ). For the first time I some how managed, to set it up but a problem appear. My main web site is working just as it suppose to be - it reads (communicates with) the database, but My CMS is not. It shows the first log in page, but after that when I try to log in it throws the following error: A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: TCP Provider, error: 0 - A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond.) Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.Data.SqlClient.SqlException: A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: TCP Provider, error: 0 - A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond.) Source Error: An unhandled exception was generated during the execution of the current web request. Information regarding the origin and location of the exception can be identified using the exception stack trace below. Stack Trace: [SqlException (0x80131904): A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: TCP Provider, error: 0 - A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond.)] System.Data.SqlClient.SqlInternalConnection.OnError(SqlException exception, Boolean breakConnection) +4846887 System.Data.SqlClient.TdsParser.ThrowExceptionAndWarning(TdsParserStateObject stateObj) +194 System.Data.SqlClient.TdsParser.Connect(ServerInfo serverInfo, SqlInternalConnectionTds connHandler, Boolean ignoreSniOpenTimeout, Int64 timerExpire, Boolean encrypt, Boolean trustServerCert, Boolean integratedSecurity, SqlConnection owningObject) +4860189 System.Data.SqlClient.SqlInternalConnectionTds.AttemptOneLogin(ServerInfo serverInfo, String newPassword, Boolean ignoreSniOpenTimeout, Int64 timerExpire, SqlConnection owningObject) +90 System.Data.SqlClient.SqlInternalConnectionTds.LoginNoFailover(String host, String newPassword, Boolean redirectedUserInstance, SqlConnection owningObject, SqlConnectionString connectionOptions, Int64 timerStart) +342 System.Data.SqlClient.SqlInternalConnectionTds.OpenLoginEnlist(SqlConnection owningObject, SqlConnectionString connectionOptions, String newPassword, Boolean redirectedUserInstance) +221 System.Data.SqlClient.SqlInternalConnectionTds..ctor(DbConnectionPoolIdentity identity, SqlConnectionString connectionOptions, Object providerInfo, String newPassword, SqlConnection owningObject, Boolean redirectedUserInstance) +189 System.Data.SqlClient.SqlConnectionFactory.CreateConnection(DbConnectionOptions options, Object poolGroupProviderInfo, DbConnectionPool pool, DbConnection owningConnection) +185 System.Data.ProviderBase.DbConnectionFactory.CreatePooledConnection(DbConnection owningConnection, DbConnectionPool pool, DbConnectionOptions options) +31 System.Data.ProviderBase.DbConnectionPool.CreateObject(DbConnection owningObject) +433 System.Data.ProviderBase.DbConnectionPool.UserCreateRequest(DbConnection owningObject) +66 System.Data.ProviderBase.DbConnectionPool.GetConnection(DbConnection owningObject) +499 System.Data.ProviderBase.DbConnectionFactory.GetConnection(DbConnection owningConnection) +65 System.Data.ProviderBase.DbConnectionClosed.OpenConnection(DbConnection outerConnection, DbConnectionFactory connectionFactory) +117 System.Data.SqlClient.SqlConnection.Open() +122 System.Data.Linq.SqlClient.SqlConnectionManager.UseConnection(IConnectionUser user) +44 System.Data.Linq.SqlClient.SqlProvider.get_IsSqlCe() +45 System.Data.Linq.SqlClient.SqlProvider.InitializeProviderMode() +20 System.Data.Linq.SqlClient.SqlProvider.System.Data.Linq.Provider.IProvider.Execute(Expression query) +57 System.Data.Linq.DataQuery`1.System.Linq.IQueryProvider.Execute(Expression expression) +23 System.Linq.Queryable.Count(IQueryable`1 source) +240 CMS.Security.UserProfile.LoginUser() in C:\Documents and Settings\Dimitar\Desktop\New Mepso Final 08_04\CMS\Classes\UserProfile.cs:132 CMS.Default.Login1_Authenticate(Object sender, AuthenticateEventArgs e) in C:\Documents and Settings\Dimitar\Desktop\New Mepso Final 08_04\CMS\Default.aspx.cs:37 System.Web.UI.WebControls.Login.OnAuthenticate(AuthenticateEventArgs e) +108 System.Web.UI.WebControls.Login.AttemptLogin() +115 System.Web.UI.WebControls.Login.OnBubbleEvent(Object source, EventArgs e) +101 System.Web.UI.Control.RaiseBubbleEvent(Object source, EventArgs args) +37 System.Web.UI.WebControls.Button.OnCommand(CommandEventArgs e) +118 System.Web.UI.WebControls.Button.RaisePostBackEvent(String eventArgument) +166 System.Web.UI.WebControls.Button.System.Web.UI.IPostBackEventHandler.RaisePostBackEvent(String eventArgument) +10 System.Web.UI.Page.RaisePostBackEvent(IPostBackEventHandler sourceControl, String eventArgument) +13 System.Web.UI.Page.RaisePostBackEvent(NameValueCollection postData) +36 System.Web.UI.Page.ProcessRequestMain(Boolean includeStagesBeforeAsyncPoint, Boolean includeStagesAfterAsyncPoint) +1565 Maybe this is a dumb question, but I cannot find the root of the problem, let alone the solution. So far I have tried the following: -setting time out on connection string to a higher value -configuration and after that turning off server firewall -checking the connection string over and over again (they are the same for all three projects and are saved in web.config) Important notes: I have tried executing the project from VS2008 with a connection string to the same database and the results are the same. That's why I think the problem is the SQL Server 2005 and not the IIS7. Any bit of information is more then welcomed.

    Read the article

  • $_GET loading content before head tag instead of in specified div.

    - by s32ialx
    NOT EDITING BELOW BUT THANKS TO SOME REALLY NICE PEOPLE I CAN'T POST AN IMAGE ANYMORE BECAUSE I HAD a 15 Rep but NOW ONLY A 5 becuase my question wasn't what they wanted help with they gave me a neg rep. The problem is that the content loads it displays UNDER the div i placed #CONTENT# inside so the styles are being ignored and it's posting #CONTENT# outside the divs at positions 0,0 any suggestions? Found out whats happening by using "View Source" seems that it's putting all of the #CONTENT#, content that's being loaded in front of the <head> tag. Like this <doctype...> <div class="home"> \ blah blah #CONTENT# bot being loaded in correct specified area </div> / <head> <script src=""></script> </head> <body> <div class="header"></div> <div class="contents"> #CONTENT# < where content SHOULD load </div> <div class="footer"></div> </body> so anyone got a fix? OK so a better description I'll add relevant screen-shots Whats happening is /* file.class.php */ <?php $file = new file(); class file{ var $path = "templates/clean"; var $ext = "tpl"; function loadfile($filename){ return file_get_contents($this->path . "/" . $filename . "." . $this->ext); } function setcontent($content,$newcontent,$vartoreplace='#CONTENT#'){ $val = str_replace($vartoreplace,$newcontent,$content); return $val; } function p($content) { $v = $content; $v = str_replace('#CONTENT#','',$v); print $v; } } if(!isset($_GET['page'])){ // if not, lets load our index page(you can change home.php to whatever you want: include("main.txt"); // else $_GET['page'] was set so lets do stuff: } else { // lets first check if the file exists: if(file_exists($_GET['page'].'.txt')){ // and lets include that then: include($_GET['page'].'.txt'); // sorry mate, could not find it: } else { echo 'Sorry, could not find <strong>' . $_GET['page'] .'.txt</strong>'; } } ?> is calling for a file_get_contents at the bottom which I use in /* index.php */ <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xml:lang="en" lang="en"> <?php include('classes/file.class.php'); // load the templates $header = $file->loadfile('header'); $body = $file->loadfile('body'); $footer = $file->loadfile('footer'); // fill body.tpl #CONTENT# slot with $content $body = $file->setcontent($body, $content); // cleanup and output the full page $file->p($header . $body . $footer); ?> and loads into /* body.tpl */ <div id="bodys"> <div id="bodt"></div> <div id="bodm"> <div id="contents"> #CONTENT# </div> </div> <div id="bodb"></div> </div> but the issue is as follows the $content loads properly img tags etc <h2> tags etc but CSS styling is TOTALY ignored for position width z-index etc. and as follows here's the screen-shot My Firefox Showing The Problem In Action REPOSTED DUE TO PEOPLE NOT HELPING AND JUST BEING ARROGANT AND GIVING NEGATIVE VOTES and not even saying a word. DO NOT COMMENT UNLESS YOU PLAN TO HELP god I'm a beginner and with you people giving me bad reviews this won't make me help you out when the chance comes.

    Read the article

  • (C++) Linking with namespaces causes duplicate symbol error

    - by user577072
    Hello. For the past few days, I have been trying to figure out how to link the files for a CLI gaming project I have been working on. There are two halves of the project, the Client and the Server code. The client needs two libraries I've made. The first is a general purpose game board. This is split between GameEngine.h and GameEngine.cpp. The header file looks something like this namespace gfdGaming { // struct sqr_size { // Index x; // Index y; // }; typedef struct { Index x, y; } sqr_size; const sqr_size sPos = {1, 1}; sqr_size sqr(Index x, Index y); sqr_size ePos; class board { // Prototypes / declarations for the class } } And the CPP file is just giving everything content #include "GameEngine.h" type gfdGaming::board::functions The client also has game-specific code (in this case, TicTacToe) split into declarations and definitions (TTT.h, Client.cpp). TTT.h is basically #include "GameEngine.h" #define TTTtar "localhost" #define TTTport 2886 using namespace gfdGaming; void* turnHandler(void*); namespace nsTicTacToe { GFDCON gfd; const char X = 'X'; const char O = 'O'; string MPhostname, mySID; board TTTboard; bool PlayerIsX = true, isMyTurn; char Player = X, Player2 = O; int recon(string* datHolder = NULL, bool force = false); void initMP(bool create = false, string hn = TTTtar); void init(); bool isTie(); int turnPlayer(Index loc, char lSym = Player); bool checkWin(char sym = Player); int mainloop(); int mainloopMP(); }; // NS I made the decision to put this in a namespace to group it instead of a class because there are some parts that would not work well in OOP, and it's much easier to implement later on. I have had trouble linking the client in the past, but this setup seems to work. My server is also split into two files, Server.h and Server.cpp. Server.h contains exactly: #include "../TicTacToe/TTT.h" // Server needs a full copy of TicTacToe code class TTTserv; struct TTTachievement_requirement { Index id; Index loc; bool inUse; }; struct TTTachievement_t { Index id; bool achieved; bool AND, inSameGame; bool inUse; bool (*lHandler)(TTTserv*); char mustBeSym; int mustBePlayer; string name, description; TTTachievement_requirement steps[safearray(8*8)]; }; class achievement_core_t : public GfdOogleTech { public: // May be shifted to private TTTachievement_t list[safearray(8*8)]; public: achievement_core_t(); int insert(string name, string d, bool samegame, bool lAnd, int lSteps[8*8], int mbP=0, char mbS=0); }; struct TTTplayer_t { Index id; bool inUse; string ip, sessionID; char sym; int desc; TTTachievement_t Ding[8*8]; }; struct TTTgame_t { TTTplayer_t Player[safearray(2)]; TTTplayer_t Spectator; achievement_core_t achievement_core; Index cTurn, players; port_t roomLoc; bool inGame, Xused, Oused, newEvent; }; class TTTserv : public gSserver { TTTgame_t Game; TTTplayer_t *cPlayer; port_t conPort; public: achievement_core_t *achiev; thread threads[8]; int parseit(string tDat, string tsIP); Index conCount; int parseit(string tDat, int tlUser, TTTplayer_t** retval); private: int parseProto(string dat, string sIP); int parseProto(string dat, int lUser); int cycleTurn(); void setup(port_t lPort = 0, bool complete = false); public: int newEvent; TTTserv(port_t tlPort = TTTport, bool tcomplete = true); TTTplayer_t* userDC(Index id, Index force = false); int sendToPlayers(string dat, bool asMSG = false); int mainLoop(volatile bool *play); }; // Other void* userHandler(void*); void* handleUser(void*); And in the CPP file I include Server.h and provide main() and the contents of all functions previously declared. Now to the problem at hand I am having issues when linking my server. More specifically, I get a duplicate symbol error for every variable in nsTicTacToe (and possibly in gfdGaming as well). Since I need the TicTacToe functions, I link Client.cpp ( without main() ) when building the server ld: duplicate symbol nsTicTacToe::PlayerIsX in Client.o and Server.o collect2: ld returned 1 exit status Command /Developer/usr/bin/g++-4.2 failed with exit code 1 It stops once a problem is encountered, but if PlayerIsX is removed / changed temporarily than another variable causes an error Essentially, I am looking for any advice on how to better organize my code to hopefully fix these errors. Disclaimers: -I apologize in advance if I provided too much or too little information, as it is my first time posting -I have tried using static and extern to fix these problems, but apparently those are not what I need Thank you to anyone who takes the time to read all of this and respond =)

    Read the article

  • WPF Some styles not applied on DataTemplate controls

    - by Martin
    Hi, I am trying to learn something about WPF and I am quite amazed by its flexibility. However, I have hit a problem with Styles and DataTemplates, which is little bit confusing. I have defined below test page to play around a bit with styles etc and found that the Styles defined in <Page.Resources> for Border and TextBlock are not applied in the DataTemplate, but Style for ProgressBar defined in exactly the same way is applied. Source code (I just use Kaxaml and XamlPadX to view the result) <Page xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml"> <Page.Resources> <Style TargetType="{x:Type Border}"> <Setter Property="Background" Value="SkyBlue"/> <Setter Property="BorderBrush" Value="Black"/> <Setter Property="BorderThickness" Value="2"/> <Setter Property="CornerRadius" Value="5"/> </Style> <Style TargetType="{x:Type TextBlock}"> <Setter Property="FontWeight" Value="Bold"/> </Style> <Style TargetType="{x:Type ProgressBar}"> <Setter Property="Height" Value="10"/> <Setter Property="Width" Value="100"/> <Setter Property="Foreground" Value="Red"/> </Style> <XmlDataProvider x:Key="TestData" XPath="/TestData"> <x:XData> <TestData xmlns=""> <TestElement> <Name>Item 1</Name> <Value>25</Value> </TestElement> <TestElement> <Name>Item 2</Name> <Value>50</Value> </TestElement> </TestData> </x:XData> </XmlDataProvider> <HierarchicalDataTemplate DataType="TestElement"> <Border Height="45" Width="120" Margin="5,5"> <StackPanel Orientation="Vertical" Margin="5,5" VerticalAlignment="Center" HorizontalAlignment="Center"> <TextBlock HorizontalAlignment="Center" Text="{Binding XPath=Name}"/> <ProgressBar Value="{Binding XPath=Value}"/> </StackPanel> </Border> </HierarchicalDataTemplate> </Page.Resources> <StackPanel Orientation="Horizontal" HorizontalAlignment="Center" VerticalAlignment="Center"> <StackPanel Orientation="Vertical" VerticalAlignment="Center"> <Border Height="45" Width="120" Margin="5,5"> <StackPanel Orientation="Vertical" VerticalAlignment="Center" HorizontalAlignment="Center"> <TextBlock HorizontalAlignment="Center" Text="Item 1"/> <ProgressBar Value="25"/> </StackPanel> </Border> <Border Height="45" Width="120" Margin="5,5"> <StackPanel Orientation="Vertical" VerticalAlignment="Center" HorizontalAlignment="Center"> <TextBlock HorizontalAlignment="Center" Text="Item 2"/> <ProgressBar Value="50"/> </StackPanel> </Border> </StackPanel> <ListBox Margin="10,10" Width="140" ItemsSource="{Binding Source={StaticResource TestData}, XPath=TestElement}"/> </StackPanel> </Page> I suspect it has something to do with default styles etc, but more puzzling is why some Styles are applied and some not. I cannot find an easy explanation for above anywhere and thus would like to ask if someone would be kind enough to explain this behaviour in lamens' terms with possible links to technical description, i.e. to MSDN or so. Thanks in advance for you support!

    Read the article

  • how to pass an id number string to this class (asp.net, c#)

    - by Phil
    I'm very much a vb person, but have had to use this id number class in c#. I got it from http://www.codingsanity.com/idnumber.htm : using System; using System.Text.RegularExpressions; namespace Utilities.SouthAfrica { /// <summary> /// Represents a South African Identity Number. /// valid number = 7707215230080 /// invalid test number = 1234567891234 /// /// </summary> [Serializable()] public class IdentityNumber { #region Enumerations /// <summary> /// Indicates a gender. /// </summary> public enum PersonGender { Female = 0, Male = 5 } public enum PersonCitizenship { SouthAfrican = 0, Foreign = 1 } #endregion #region Declarations static Regex _expression; Match _match; const string _IDExpression = @"(?<Year>[0-9][0-9])(?<Month>([0][1-9])|([1][0-2]))(?<Day>([0-2][0-9])|([3][0-1]))(?<Gender>[0-9])(?<Series>[0-9]{3})(?<Citizenship>[0-9])(?<Uniform>[0-9])(?<Control>[0-9])"; #endregion #region Constuctors /// <summary> /// Sets up the shared objects for ID validation. /// </summary> static IdentityNumber() { _expression = new Regex(_IDExpression, RegexOptions.Compiled | RegexOptions.Singleline); } /// <summary> /// Creates the ID number from a string. /// </summary> /// <param name="IDNumber">The string ID number.</param> public IdentityNumber(string IDNumber) { _match = _expression.Match(IDNumber.Trim()); } #endregion #region Properties /// <summary> /// Indicates the date of birth encoded in the ID Number. /// </summary> /// <exception cref="System.ArgumentException">Thrown if the ID Number is not usable.</exception> public DateTime DateOfBirth { get { if(IsUsable == false) { throw new ArgumentException("ID Number is unusable!", "IDNumber"); } int year = int.Parse(_match.Groups["Year"].Value); // NOTE: Do not optimize by moving these to static, otherwise the calculation may be incorrect // over year changes, especially century changes. int currentCentury = int.Parse(DateTime.Now.Year.ToString().Substring(0, 2) + "00"); int lastCentury = currentCentury - 100; int currentYear = int.Parse(DateTime.Now.Year.ToString().Substring(2, 2)); // If the year is after or at the current YY, then add last century to it, otherwise add // this century. // TODO: YY -> YYYY logic needs thinking about if(year > currentYear) { year += lastCentury; } else { year += currentCentury; } return new DateTime(year, int.Parse(_match.Groups["Month"].Value), int.Parse(_match.Groups["Day"].Value)); } } /// <summary> /// Indicates the gender for the ID number. /// </summary> /// <exception cref="System.ArgumentException">Thrown if the ID Number is not usable.</exception> public PersonGender Gender { get { if(IsUsable == false) { throw new ArgumentException("ID Number is unusable!", "IDNumber"); } int gender = int.Parse(_match.Groups["Gender"].Value); if(gender < (int) PersonGender.Male) { return PersonGender.Female; } else { return PersonGender.Male; } } } /// <summary> /// Indicates the citizenship for the ID number. /// </summary> /// <exception cref="System.ArgumentException">Thrown if the ID Number is not usable.</exception> public PersonCitizenship Citizenship { get { if(IsUsable == false) { throw new ArgumentException("ID Number is unusable!", "IDNumber"); } return (PersonCitizenship) Enum.Parse(typeof(PersonCitizenship), _match.Groups["Citizenship"].Value); } } /// <summary> /// Indicates if the IDNumber is usable or not. /// </summary> public bool IsUsable { get { return _match.Success; } } /// <summary> /// Indicates if the IDNumber is valid or not. /// </summary> public bool IsValid { get { if(IsUsable == true) { // Calculate total A by adding the figures in the odd positions i.e. the first, third, fifth, // seventh, ninth and eleventh digits. int a = int.Parse(_match.Value.Substring(0, 1)) + int.Parse(_match.Value.Substring(2, 1)) + int.Parse(_match.Value.Substring(4, 1)) + int.Parse(_match.Value.Substring(6, 1)) + int.Parse(_match.Value.Substring(8, 1)) + int.Parse(_match.Value.Substring(10, 1)); // Calculate total B by taking the even figures of the number as a whole number, and then // multiplying that number by 2, and then add the individual figures together. int b = int.Parse(_match.Value.Substring(1, 1) + _match.Value.Substring(3, 1) + _match.Value.Substring(5, 1) + _match.Value.Substring(7, 1) + _match.Value.Substring(9, 1) + _match.Value.Substring(11, 1)); b *= 2; string bString = b.ToString(); b = 0; for(int index = 0; index < bString.Length; index++) { b += int.Parse(bString.Substring(index, 1)); } // Calculate total C by adding total A to total B. int c = a + b; // The control-figure can now be determined by subtracting the ones in figure C from 10. string cString = c.ToString() ; cString = cString.Substring(cString.Length - 1, 1) ; int control = 0; // Where the total C is a multiple of 10, the control figure will be 0. if(cString != "0") { control = 10 - int.Parse(cString.Substring(cString.Length - 1, 1)); } if(_match.Groups["Control"].Value == control.ToString()) { return true; } } return false; } } #endregion } } Can someone please tell the syntax for how I pass an id number to the class? Thanks

    Read the article

  • On screen orientation loads again data with Async Task

    - by Zookey
    I make Android application with master/detail pattern. So I have ListActivity class which is FragmentActivity and ListFragment class which is Fragment It all works perfect, but when I change screen orientation it calls again AsyncTask and reload all data. Here is the code for ListActivity class where I handle all logic: @Override protected void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.activity_list); getActionBar().setDisplayHomeAsUpEnabled(true); getActionBar().setHomeButtonEnabled(true); getActionBar().setTitle("Dnevni horoskop"); if(findViewById(R.id.details_container) != null){ //Tablet mTwoPane = true; //Fragment stuff FragmentManager fm = getSupportFragmentManager(); FragmentTransaction ft = fm.beginTransaction(); DetailsFragment df = new DetailsFragment(); ft.add(R.id.details_container, df); ft.commit(); } pb = (ProgressBar) findViewById(R.id.pb_list); tvNoConnection = (TextView) findViewById(R.id.tv_no_internet); ivNoConnection = (ImageView) findViewById(R.id.iv_no_connection); list = (GridView) findViewById(R.id.gv_list); if(mTwoPane == true){ list.setNumColumns(1); //list.setPadding(16,16,16,16); } adapter = new CustomListAdapter(); list.setOnItemClickListener(new OnItemClickListener() { @Override public void onItemClick(AdapterView<?> arg0, View arg1, int position, long arg3) { pos = position; if(mTwoPane == false){ Bundle bundle = new Bundle(); bundle.putSerializable("zodiac", zodiacFeed); Intent i = new Intent(getApplicationContext(), DetailsActivity.class); i.putExtra("position", position); i.putExtras(bundle); startActivity(i); overridePendingTransition(R.anim.right_in, R.anim.right_out); } else if(mTwoPane == true){ DetailsFragment fragment = (DetailsFragment) getSupportFragmentManager().findFragmentById(R.id.details_container); fragment.setHoroscopeText(zodiacFeed.getItem(position).getText()); fragment.setLargeImage(zodiacFeed.getItem(position).getLargeImage()); fragment.setSign("Dnevni horoskop - "+zodiacFeed.getItem(position).getName()); fragment.setSignDuration(zodiacFeed.getItem(position).getDuration()); // inflate menu from xml /*if(menu != null){ MenuItem item = menu.findItem(R.id.share); Toast.makeText(getApplicationContext(), item.getTitle().toString(), Toast.LENGTH_SHORT).show(); }*/ } } }); if(!Utils.isConnected(getApplicationContext())){ pb.setVisibility(View.GONE); tvNoConnection.setVisibility(View.VISIBLE); ivNoConnection.setVisibility(View.VISIBLE); } //Calling AsyncTask to load data Log.d("TAG", "loading"); HoroscopeAsyncTask task = new HoroscopeAsyncTask(pb); task.execute(); } @Override public void onConfigurationChanged(Configuration newConfig) { // TODO Auto-generated method stub super.onConfigurationChanged(newConfig); } class CustomListAdapter extends BaseAdapter { private LayoutInflater layoutInflater; public CustomListAdapter() { layoutInflater = (LayoutInflater) getBaseContext().getSystemService( Context.LAYOUT_INFLATER_SERVICE); } public int getCount() { // TODO Auto-generated method stub // Set the total list item count return names.length; } public Object getItem(int arg0) { // TODO Auto-generated method stub return null; } public long getItemId(int arg0) { // TODO Auto-generated method stub return 0; } public View getView(int position, View convertView, ViewGroup parent) { // Inflate the item layout and set the views View listItem = convertView; int pos = position; zodiacItem = zodiacList.get(pos); if (listItem == null && mTwoPane == false) { listItem = layoutInflater.inflate(R.layout.list_item, null); } else if(mTwoPane == true){ listItem = layoutInflater.inflate(R.layout.tablet_list_item, null); } // Initialize the views in the layout ImageView iv = (ImageView) listItem.findViewById(R.id.iv_horoscope); iv.setScaleType(ScaleType.CENTER_CROP); TextView tvName = (TextView) listItem.findViewById(R.id.tv_zodiac_name); TextView tvDuration = (TextView) listItem.findViewById(R.id.tv_duration); iv.setImageResource(zodiacItem.getImage()); tvName.setText(zodiacItem.getName()); tvDuration.setText(zodiacItem.getDuration()); Animation animation = AnimationUtils.loadAnimation(getBaseContext(), R.anim.push_up); listItem.startAnimation(animation); animation = null; return listItem; } } private void getHoroscope() { String urlString = "http://balkanandroid.com/download/horoskop/examples/dnevnihoroskop.php"; try { HttpClient client = new DefaultHttpClient(); HttpPost post = new HttpPost(urlString); HttpResponse response = client.execute(post); resEntity = response.getEntity(); response_str = EntityUtils.toString(resEntity); if (resEntity != null) { Log.i("RESPONSE", response_str); runOnUiThread(new Runnable() { public void run() { try { Log.d("TAG", "Response from server : n " + response_str); } catch (Exception e) { e.printStackTrace(); } } }); } } catch (Exception ex) { Log.e("TAG", "error: " + ex.getMessage(), ex); } } private class HoroscopeAsyncTask extends AsyncTask<String, Void, Void> { public HoroscopeAsyncTask(ProgressBar pb1){ pb = pb1; } @Override protected void onPreExecute() { pb.setVisibility(View.VISIBLE); super.onPreExecute(); } @Override protected Void doInBackground(String... params) { getHoroscope(); try { Log.d("TAG", "test u try"); JSONObject jsonObject = new JSONObject(response_str); JSONArray jsonArray = jsonObject.getJSONArray("horoscope"); for(int i=0;i<jsonArray.length();i++){ Log.d("TAG", "test u for"); JSONObject horoscopeObj = jsonArray.getJSONObject(i); String horoscopeSign = horoscopeObj.getString("name_sign"); String horoscopeText = horoscopeObj.getString("txt_hrs"); zodiacItem = new ZodiacItem(horoscopeSign, horoscopeText, duration[i], images[i], largeImages[i]); zodiacList.add(zodiacItem); zodiacFeed.addItem(zodiacItem); //Treba u POJO klasu ubaciti sve. Log.d("TAG", "ZNAK: "+zodiacItem.getName()+" HOROSKOP: "+zodiacItem.getText()); } } catch (JSONException e) { // TODO Auto-generated catch block e.printStackTrace(); Log.e("TAG", "error: " + e.getMessage(), e); } return null; } @Override protected void onPostExecute(Void result) { pb.setVisibility(View.GONE); list.setAdapter(adapter); adapter.notifyDataSetChanged(); super.onPostExecute(result); } } Here is the code for ListFragment class: public class ListFragment extends Fragment { @Override public void onCreate(Bundle savedInstanceState) { // TODO Auto-generated method stub // Retain this fragment across configuration changes. setRetainInstance(true); super.onCreate(savedInstanceState); } @Override public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) { // TODO Auto-generated method stub View view = inflater.inflate(R.layout.fragment_list, container, false); return view; } }

    Read the article

  • CoreData: Same predicate (IN) returns different fetched results after a Save operation

    - by Jason Lee
    I have code below: NSArray *existedTasks = [[TaskBizDB sharedInstance] fetchTasksWatchedByMeOfProject:projectId]; [context save:&error]; existedTasks = [[TaskBizDB sharedInstance] fetchTasksWatchedByMeOfProject:projectId]; NSArray *allTasks = [[TaskBizDB sharedInstance] fetchTasksOfProject:projectId]; First line returns two objects; Second line save the context; Third line returns just one object, which is contained in the 'two objects' above; And the last line returns 6 objects, containing the 'two objects' returned at the first line. The fetch interface works like below: WXModel *model = [WXModel modelWithEntity:NSStringFromClass([WQPKTeamTask class])]; NSPredicate *predicate = [NSPredicate predicateWithFormat:@"(%@ IN personWatchers) AND (projectId == %d)", currentLoginUser, projectId]; [model setPredicate:predicate]; NSArray *fetchedTasks = [model fetch]; if (fetchedTasks.count == 0) return nil; return fetchedTasks; What confused me is that, with the same fetch request, why return different results just after a save? Here comes more detail: The 'two objects' returned at the first line are: <WQPKTeamTask: 0x1b92fcc0> (entity: WQPKTeamTask; id: 0x1b9300f0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p9> ; data: { projectId = 372004; taskId = 338001; personWatchers = ( "0xf0bf440 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WWPerson/p1>" ); } <WQPKTeamTask: 0xf3f6130> (entity: WQPKTeamTask; id: 0xf3cb8d0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p11> ; data: { projectId = 372004; taskId = 340006; personWatchers = ( "0xf0bf440 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WWPerson/p1>" ); } And the only one object returned at third line is: <WQPKTeamTask: 0x1b92fcc0> (entity: WQPKTeamTask; id: 0x1b9300f0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p9> ; data: { projectId = 372004; taskId = 338001; personWatchers = ( "0xf0bf440 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WWPerson/p1>" ); } Printing description of allTasks: <_PFArray 0xf30b9a0>( <WQPKTeamTask: 0xf3ab9d0> (entity: WQPKTeamTask; id: 0xf3cda40 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p6> ; data: <fault>), <WQPKTeamTask: 0xf315720> (entity: WQPKTeamTask; id: 0xf3c23a0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p7> ; data: <fault>), <WQPKTeamTask: 0xf3a1ed0> (entity: WQPKTeamTask; id: 0xf3cda30 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p8> ; data: <fault>), <WQPKTeamTask: 0x1b92fcc0> (entity: WQPKTeamTask; id: 0x1b9300f0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p9> ; data: { projectId = 372004; taskId = 338001; personWatchers = ( "0xf0bf440 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WWPerson/p1>" ); }), <WQPKTeamTask: 0xf325e50> (entity: WQPKTeamTask; id: 0xf343820 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p10> ; data: <fault>), <WQPKTeamTask: 0xf3f6130> (entity: WQPKTeamTask; id: 0xf3cb8d0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p11> ; data: { projectId = 372004; taskId = 340006; personWatchers = ( "0xf0bf440 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WWPerson/p1>" ); }) ) UPDATE 1 If I call the same interface fetchTasksWatchedByMeOfProject: in: #pragma mark - NSFetchedResultsController Delegate - (void)controllerDidChangeContent:(NSFetchedResultsController *)controller { I will get 'two objects' as well. UPDATE 2 I've tried: NSPredicate *predicate = [NSPredicate predicateWithFormat:@"(ANY personWatchers == %@) AND (projectId == %d)", currentLoginUser, projectId]; NSPredicate *predicate = [NSPredicate predicateWithFormat:@"(ANY personWatchers.personId == %@) AND (projectId == %d)", currentLoginUserId, projectId]; Still the same result. UPDATE 3 I've checked the save:&error, error is nil.

    Read the article

  • Uploading multiple files using Spring MVC 3.0.2 after HiddenHttpMethodFilter has been enabled

    - by Tiny
    I'm using Spring version 3.0.2. I need to upload multiple files using the multiple="multiple" attribute of a file browser such as, <input type="file" id="myFile" name="myFile" multiple="multiple"/> (and not using multiple file browsers something like the one stated by this answer, it indeed works I tried). Although no versions of Internet Explorer supports this approach unless an appropriate jQuery plugin/widget is used, I don't care about it right now (since most other browsers support this). This works fine with commons fileupload but in addition to using RequestMethod.POST and RequestMethod.GET methods, I also want to use other request methods supported and suggested by Spring like RequestMethod.PUT and RequestMethod.DELETE in their own appropriate places. For this to be so, I have configured Spring with HiddenHttpMethodFilter which goes fine as this question indicates. but it can upload only one file at a time even though multiple files in the file browser are chosen. In the Spring controller class, a method is mapped as follows. @RequestMapping(method={RequestMethod.POST}, value={"admin_side/Temp"}) public String onSubmit(@RequestParam("myFile") List<MultipartFile> files, @ModelAttribute("tempBean") TempBean tempBean, BindingResult error, Map model, HttpServletRequest request, HttpServletResponse response) throws IOException, FileUploadException { for(MultipartFile file:files) { System.out.println(file.getOriginalFilename()); } } Even with the request parameter @RequestParam("myFile") List<MultipartFile> files which is a List of type MultipartFile (it can always have only one file at a time). I could find a strategy which is likely to work with multiple files on this blog. I have gone through it carefully. The solution below the section SOLUTION 2 – USE THE RAW REQUEST says, If however the client insists on using the same form input name such as ‘files[]‘ or ‘files’ and then populating that name with multiple files then a small hack is necessary as follows. As noted above Spring 2.5 throws an exception if it detects the same form input name of type file more than once. CommonsFileUploadSupport – the class which throws that exception is not final and the method which throws that exception is protected so using the wonders of inheritance and subclassing one can simply fix/modify the logic a little bit as follows. The change I’ve made is literally one word representing one method invocation which enables us to have multiple files incoming under the same form input name. It attempts to override the method protected MultipartParsingResult parseFileItems(List fileItems, String encoding) {} of the abstract class CommonsFileUploadSupport by extending the class CommonsMultipartResolver such as, package multipartResolver; import java.io.UnsupportedEncodingException; import java.util.HashMap; import java.util.Iterator; import java.util.List; import java.util.Map; import javax.servlet.ServletContext; import org.apache.commons.fileupload.FileItem; import org.springframework.util.StringUtils; import org.springframework.web.multipart.MultipartException; import org.springframework.web.multipart.MultipartFile; import org.springframework.web.multipart.commons.CommonsMultipartFile; import org.springframework.web.multipart.commons.CommonsMultipartResolver; final public class MultiCommonsMultipartResolver extends CommonsMultipartResolver { public MultiCommonsMultipartResolver() { } public MultiCommonsMultipartResolver(ServletContext servletContext) { super(servletContext); } @Override @SuppressWarnings("unchecked") protected MultipartParsingResult parseFileItems(List fileItems, String encoding) { Map<String, MultipartFile> multipartFiles = new HashMap<String, MultipartFile>(); Map multipartParameters = new HashMap(); // Extract multipart files and multipart parameters. for (Iterator it = fileItems.iterator(); it.hasNext();) { FileItem fileItem = (FileItem) it.next(); if (fileItem.isFormField()) { String value = null; if (encoding != null) { try { value = fileItem.getString(encoding); } catch (UnsupportedEncodingException ex) { if (logger.isWarnEnabled()) { logger.warn("Could not decode multipart item '" + fileItem.getFieldName() + "' with encoding '" + encoding + "': using platform default"); } value = fileItem.getString(); } } else { value = fileItem.getString(); } String[] curParam = (String[]) multipartParameters.get(fileItem.getFieldName()); if (curParam == null) { // simple form field multipartParameters.put(fileItem.getFieldName(), new String[] { value }); } else { // array of simple form fields String[] newParam = StringUtils.addStringToArray(curParam, value); multipartParameters.put(fileItem.getFieldName(), newParam); } } else { // multipart file field CommonsMultipartFile file = new CommonsMultipartFile(fileItem); if (multipartFiles.put(fileItem.getName(), file) != null) { throw new MultipartException("Multiple files for field name [" + file.getName() + "] found - not supported by MultipartResolver"); } if (logger.isDebugEnabled()) { logger.debug("Found multipart file [" + file.getName() + "] of size " + file.getSize() + " bytes with original filename [" + file.getOriginalFilename() + "], stored " + file.getStorageDescription()); } } } return new MultipartParsingResult(multipartFiles, multipartParameters); } } What happens is that the last line in the method parseFileItems() (the return statement) i.e. return new MultipartParsingResult(multipartFiles, multipartParameters); causes a compile-time error because the first parameter multipartFiles is a type of Map implemented by HashMap but in reality, it requires a parameter of type MultiValueMap<String, MultipartFile> It is a constructor of a static class inside the abstract class CommonsFileUploadSupport, public abstract class CommonsFileUploadSupport { protected static class MultipartParsingResult { public MultipartParsingResult(MultiValueMap<String, MultipartFile> mpFiles, Map<String, String[]> mpParams) { } } } The reason might be - this solution is about the Spring version 2.5 and I'm using the Spring version 3.0.2 which might be inappropriate for this version. I however tried to replace the Map with MultiValueMap in various ways such as the one shown in the following segment of code, MultiValueMap<String, MultipartFile>mul=new LinkedMultiValueMap<String, MultipartFile>(); for(Entry<String, MultipartFile>entry:multipartFiles.entrySet()) { mul.add(entry.getKey(), entry.getValue()); } return new MultipartParsingResult(mul, multipartParameters); but no success. I'm not sure how to replace Map with MultiValueMap and even doing so could work either. After doing this, the browser shows the Http response, HTTP Status 400 - type Status report message description The request sent by the client was syntactically incorrect (). Apache Tomcat/6.0.26 I have tried to shorten the question as possible as I could and I haven't included unnecessary code. How could be made it possible to upload multiple files after Spring has been configured with HiddenHttpMethodFilter? That blog indicates that It is a long standing, high priority bug. If there is no solution regarding the version 3.0.2 (3 or higher) then I have to disable Spring support forever and continue to use commons-fileupolad as suggested by the third solution on that blog omitting the PUT, DELETE and other request methods forever. Just curiously waiting for a solution and/or suggestion. Very little changes to the code in the parseFileItems() method inside the class MultiCommonsMultipartResolver might make it to upload multiple files but I couldn't succeed in my attempts (again with the Spring version 3.0.2 (3 or higher)).

    Read the article

  • c++ to vb.net , problem with callback function

    - by johan
    I'm having a hard time here trying to find a solution for my problem. I'm trying to convert a client API funktion from C++ to VB.NET, and i think have some problems with the callback function. parts of the C++ code: typedef struct{ BYTE m_bRemoteChannel; BYTE m_bSendMode; BYTE m_nImgFormat; // =0 cif ; = 1 qcif char *m_sIPAddress; char *m_sUserName; char *m_sUserPassword; BOOL m_bUserCheck; HWND m_hShowVideo; }CLIENT_VIDEOINFO, *PCLIENT_VIDEOINFO; CPLAYER_API LONG __stdcall MP4_ClientStart(PCLIENT_VIDEOINFO pClientinfo,void(CALLBACK *ReadDataCallBack)(DWORD nPort,UCHAR *pPacketBuffer,DWORD nPacketSize)); void CALLBACK ReadDataCallBack(DWORD nPort,UCHAR *pPacketBuffer,DWORD nPacketSize) { TRACE("%d\n",nPacketSize); } ..... aa5.m_sUserName = "123"; aa5.m_sUserPassword="w"; aa5.m_bUserCheck = TRUE; MP4_ClientSetTTL(64); nn1 = MP4_ClientStart(&aa5,ReadDataCallBack); if (nn1 == -1) { MessageBox("error"); return; } SDK description: MP4_ClientStart This function starts a connection. The format of the call is: LONG __stdcall MP4_ClientStart(PCLIENT_VIDEOINFO pClientinfo, void(*ReadDataCallBack)(DWORD nChannel,UCHAR *pPacketBuffer,DWORD nPacketSize)) Parameters pClientinfo holds the information. of this connection. nChannel holds the channel of card. pPacketBuffer holds the pointer to the receive buffer. nPacketSize holds the length of the receive buffer. Return Values If the function succeeds the return value is the context of this connection. If the function fails the return value is -1. Remarks typedef struct{ BYTE m_bRemoteChannel; BYTE m_bSendMode; BYTE m_bImgFormat; char *m_sIPAddress; char *m_sUserName; char *m_sUserPassword; BOOL m_bUserCheck; HWND m_hShowVideo; } CLIENT_VIDEOINFO, * PCLIENT_VIDEOINFO; m_bRemoteChannel holds the channel which the client wants to connect to. m_bSendMode holds the network mode of the connection. m_bImgFormat : Image format, 0 is main channel video, 1 is sub channel video m_sIPAddress holds the IP address of the server. m_sUserName holds the user’s name. m_sUserPassword holds the user’s password. m_bUserCheck holds the value whether sends the user’s name and password or not. m_hShowVideo holds Handle for this video window. If m_hShowVideo holds NULL, the client can be record only without decoder. If m_bUserCheck is FALSE, we will send m_sUserName and m_sUserPassword as NULL, else we will send each 50 bytes. The length of m_sIPAddress and m_sUserName must be more than 50 bytes. ReadDataCallBack: When the library receives a packet from a server, this callback is called. My VB.Net code: Imports System.Runtime.InteropServices Public Class Form1 Const WM_USER = &H400 Public Structure CLIENT_VIDEOINFO Public m_bRemoteChannel As Byte Public m_bSendMode As Byte Public m_bImgFormat As Byte Public m_sIPAddress As String Public m_sUserName As String Public m_sUserPassword As String Public m_bUserCheck As Boolean Public m_hShowVideo As Long 'hWnd End Structure Public Declare Function MP4_ClientSetNetPort Lib "hikclient.dll" (ByVal dServerPort As Integer, ByVal dClientPort As Integer) As Boolean Public Declare Function MP4_ClientStartup Lib "hikclient.dll" (ByVal nMessage As UInteger, ByVal hWnd As System.IntPtr) As Boolean <DllImport("hikclient.dll")> Public Shared Function MP4_ClientStart(ByVal Clientinfo As CLIENT_VIDEOINFO, ByRef ReadDataCallBack As CALLBACKdel) As Long End Function Public Delegate Sub CALLBACKdel(ByVal nPort As Long, <MarshalAs(UnmanagedType.LPArray)> ByRef pPacketBuffer As Byte(), ByVal nPacketSize As Long) Public Sub CALLBACK(ByVal nPort As Long, <MarshalAs(UnmanagedType.LPArray)> ByRef pPacketBuffer As Byte(), ByVal nPacketSize As Long) End Sub Public mydel As New CALLBACKdel(AddressOf CALLBACK) Private Sub Form1_Load(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles MyBase.Load Dim Clientinfo As New CLIENT_VIDEOINFO() Clientinfo.m_bRemoteChannel = 0 Clientinfo.m_bSendMode = 0 Clientinfo.m_bImgFormat = 0 Clientinfo.m_sIPAddress = "193.168.1.100" Clientinfo.m_sUserName = "1" Clientinfo.m_sUserPassword = "a" Clientinfo.m_bUserCheck = False Clientinfo.m_hShowVideo = Me.Handle 'Nothing MP4_ClientSetNetPort(850, 850) MP4_ClientStartup(WM_USER + 1, Me.Handle) MP4_ClientStart(Clientinfo, mydel) End Sub End Class here is some other examples of the code in: C# http://blog.csdn.net/nenith1981/archive/2007/09/17/1787692.aspx VB ://read.pudn.com/downloads70/sourcecode/graph/250633/MD%E5%AE%A2%E6%88%B7%E7%AB%AF%28VB%29/hikclient.bas__.htm ://read.pudn.com/downloads70/sourcecode/graph/250633/MD%E5%AE%A2%E6%88%B7%E7%AB%AF%28VB%29/Form1.frm__.htm Delphi ://read.pudn.com/downloads91/sourcecode/multimedia/streaming/349759/Delphi_client/Unit1.pas__.htm

    Read the article

  • C++ run error: pointer being freed was not allocated

    - by Dale Reves
    I'm learning c++ and am working on a program that keeps giving me a 'pointer being freed was not allocated' error. It's a grocery store program that inputs data from a txt file, then user can enter item# & qty. I've read through similar questions but what's throwing me off is the 'pointer' issue. I would appreciate if someone could take a look and help me out. I'm using Netbeans IDE 7.2 on a Mac. I'll just post the whole piece I have so far. Thx. #include <iostream> #include <fstream> #include <string> #include <vector> using namespace std; class Product { public: // PLU Code int getiPluCode() { return iPluCode; } void setiPluCode( int iTempPluCode) { iPluCode = iTempPluCode; } // Description string getsDescription() { return sDescription; } void setsDescription( string sTempDescription) { sDescription = sTempDescription; } // Price double getdPrice() { return dPrice; } void setdPrice( double dTempPrice) { dPrice = dTempPrice; } // Type..weight or unit int getiType() { return iType; } void setiType( int iTempType) { iType = iTempType; } // Inventory quantity double getdInventory() { return dInventory; } void setdInventory( double dTempInventory) { dInventory = dTempInventory; } private: int iPluCode; string sDescription; double dPrice; int iType; double dInventory; }; int main () { Product paInventory[21]; // Create inventory array Product paPurchase[21]; // Create customer purchase array // Constructor to open inventory input file ifstream InputInventory ("inventory.txt", ios::in); //If ifstream could not open the file if (!InputInventory) { cerr << "File could not be opened" << endl; exit (1); }//end if int x = 0; while (!InputInventory.eof () ) { int iTempPluCode; string sTempDescription; double dTempPrice; int iTempType; double dTempInventory; InputInventory >> iTempPluCode >> sTempDescription >> dTempPrice >> iTempType >> dTempInventory; paInventory[x].setiPluCode(iTempPluCode); paInventory[x].setsDescription(sTempDescription); paInventory[x].setdPrice(dTempPrice); paInventory[x].setiType(iTempType); paInventory[x].setdInventory(dTempInventory); x++; } bool bQuit = false; //CREATE MY TOTAL VARIABLE HERE! int iUserItemCount; do { int iUserPLUCode; double dUserAmount; double dAmountAvailable; int iProductIndex = -1; //CREATE MY SUBTOTAL VARIABLE HERE! while(iProductIndex == -1) { cout<<"Please enter the PLU Code of the product."<< endl; cin>>iUserPLUCode; for(int i = 0; i < 21; i++) { if(iUserPLUCode == paInventory[i].getiPluCode()) { dAmountAvailable = paInventory[i].getdInventory(); iProductIndex = i; } } //PLU code entry validation if(iProductIndex == -1) { cout << "You have entered an invalid PLU Code."; } } cout<<"Enter the quantity to buy.\n"<< "There are "<< dAmountAvailable << "available.\n"; cin>> dUserAmount; while(dUserAmount > dAmountAvailable) { cout<<"That's too many, please try again"; cin>>dUserAmount; } paPurchase[iUserItemCount].setiPluCode(iUserPLUCode);// Array of objects function calls paPurchase[iUserItemCount].setdInventory(dUserAmount); paPurchase[iUserItemCount].setdPrice(paInventory[iProductIndex].getdPrice()); paInventory[iProductIndex].setdInventory( paInventory[iProductIndex].getdInventory() - dUserAmount ); iUserItemCount++; cout <<"Are you done purchasing items? Enter 1 for yes and 0 for no.\n"; cin >> bQuit; //NOTE: Put Amount * quantity for subtotal //NOTE: Put code to update subtotal (total += subtotal) // NOTE: Need to create the output txt file! }while(!bQuit); return 0; }

    Read the article

  • Help Writing Input Data to Database With Wordpress Plugin

    - by HollerTrain
    Hi I am making a wordpress plugin where I need the Admin to enter data into a database table. I am able to install the db table when the Plugin is activated, however I can't figure out how to save the user input. I've asked on the WP forums but they're dead... Any experienced guru who can lend some guidance would be greatly appreciated. <?php /******************************************************************* * INSTALL DB TABLE - ONLY AT RUN TIME * *******************************************************************/ function ed_xml_install() { global $wpdb; $ed_xml_data = $wpdb->prefix . "ed_xml_data"; if($wpdb->get_var("SHOW TABLES LIKE '$ed_xml_data'") != $ed_xml_data) { $sql = "CREATE TABLE " . ed_xml_data . " ( id mediumint(9) NOT NULL AUTO_INCREMENT, name tinytext NOT NULL, address text NOT NULL, url VARCHAR(55) NOT NULL, phone bigint(11) DEFAULT '0' NOT NULL, UNIQUE KEY id (id) );"; require_once(ABSPATH . 'wp-admin/includes/upgrade.php'); dbDelta($sql); $name = "Example Business Name"; $address = "1234 Example Street"; $url = "http://www.google.com"; $phone = "523-3232-323232"; $insert = "INSERT INTO " . ed_xml_data . " (phone, name, address, url) " . "VALUES ('" . phone() . "','" . $wpdb->escape($name) . "','" . $wpdb->escape($address) . "', '" . $wpdb->escape($url) . "')"; $results = $wpdb->query( $insert ); } } //call the install hook register_activation_hook(__FILE__,'ed_xml_install'); /******************************************************************* * CREATE MENU, CREATE MENU CONTENT * *******************************************************************/ if ( is_admin() ){ /* place it under the ED menu */ //TODO $allowed_group = ''; /* Call the html code */ add_action('admin_menu', 'ed_xmlcreator_admin_menu'); function ed_xmlcreator_admin_menu() { add_options_page('ED XML Creator', 'ED XML Creator', 'administrator', 'ed_xml_creator', 'ed_xmlcreator_html_page'); } } /******************************************************************* * CONTENT OF MENU CONTENT * *******************************************************************/ function ed_xmlcreator_html_page() { <div> <h2>Editors Deal XML Options</h2> <p>Fill in the below information which will get passed to the .XML file.</p> <p>[<a href="" title="view XML file">view XML file</a>]</p> <form method="post" action="options.php"> <?php wp_nonce_field('update-options'); ?> <table width="510"> <!-- title --> <tr valign="top"> <th width="92" scope="row">Deal URL</th> <td width="406"> <input name="url" type="text" id="url" value="<?php echo get_option('url'); ?>" /> </td> </tr> <!-- description --> <tr valign="top"> <th width="92" scope="row">Deal Address</th> <td width="406"> <input name="address" type="text" id="address" value="<?php echo get_option('address'); ?>" /> </td> </tr> <!-- business name --> <tr valign="top"> <th width="92" scope="row">Business Phone</th> <td width="406"> <input name="phone" type="text" id="phone" value="<?php echo get_option('phone'); ?>" /> </td> </tr> <!-- address --> <tr valign="top"> <th width="92" scope="row">Business Name</th> <td width="406"> <input name="name" type="text" id="name" value="<?php echo get_option('name'); ?>" /> </td> </tr> </table> <input type="hidden" name="action" value="update" /> <input type="hidden" name="page_options" value="hello_world_data" /> <p> <input type="submit" value="<?php _e('Save Changes') ?>" /> </p> </form> </div> ?>

    Read the article

  • jQuery .closest returns undefined

    - by Andy Holmes
    I've got the code below which works fine, however the jquery to add the items doesnt find the data-parent-room value and just returns undefined. This is the only thing not working :( HTML: <div id="inventoryRooms"> <!--BOX SHART--> <div class="widget box formHolder" data-parent-room="1"> <!--ROOM NAME--> <form class="widget-header rooms"> <input type="text" placeholder="Type Room name" name="roomName[]" class="form-input add-room-input input-width-xxlarge"> <input type="hidden" class="roomId" name="roomId[]"> <input type="hidden" class="inventoryId" name="inventoryId[]" value="<?=$_GET['inventory_id']?>"> <div class="toolbar no-padding"> <div class="btn-group"> <span class="btn saveRoom"><i class="icon-ok"></i> Save Room</span> </div> </div> </form> <!--/END--> <!--GENERIC ROW TITLES--> <div class="widget-header header-margin hide"> <div class="row row-title"> <div class="col-md-3"><h5>ITEM</h5></div> <div class="col-md-3"><h5>DESCRIPTION</h5></div> <div class="col-md-3"><h5>CONDITION</h5></div> <div class="col-md-2"><h5>PHOTOGRAPH</h5></div> <div class="col-md-1 align-center"><h5><i class="icon-cog"> </i></h5></div> </div> </div> <!--/END--> <!--ADD ITEM--> <div class="items"> </div> <!--/END--> <div class="toolbar-small"> <div class="btn-group"> <span class="btn addItem"><i class="icon-plus"></i> Add Item</span> <span data-toggle="dropdown" class="btn dropdown-toggle"><i class="icon-gear"></i> Options<span class="button-space"></span><i class="icon-angle-down"></i></span> <ul class="dropdown-menu pull-right"> <li><a href="#"><i class="icon-trash"></i> Delete Room</a></li> </ul> </div> </div> </div> </div> jQuery: $(document).on('click','.addItem', function(){ $('<!--ROW START-->\ <form class="widget-content item">\ <div class="row">\ <div class="col-md-3"><input type="text" class="form-control" name="itemName[]"></div>\ <div class="col-md-3"><textarea class="auto form-control" name="itemDescription[]" cols="20" rows="1" style="word-wrap: break-word; resize: vertical;"></textarea></div>\ <div class="col-md-3"><textarea class="auto form-control" name="itemCondition[]" cols="20" rows="1" style="word-wrap: break-word; resize: vertical;"></textarea></div>\ <input type="hidden" class="itemId" name="itemId[]" value="">\ <input type="hidden" name="itemInventoryId[]" value="<?=$_GET["inventory_id"]?>">\ <input type="hidden" name="itemParent[]" value="'+$(this).closest().attr('data-parent-room')+'">\ <div class="col-md-2">\ <div class="fileinput-holder input-group">\ <input id="fileupload" type="file" name="files[]" data-url="uploads/">\ </div>\ </div>\ <div class="col-md-1 align-center"><i class="save icon-ok large"> </i>&nbsp;&nbsp;&nbsp;<i class="delete icon-trash large"> </i></div>\ </div>\ </form>\ <!--/ROW END-->').fadeIn(500).appendTo($(this).parents().siblings('.items')); $(this).parent().parent().siblings('.widget-header, .header-margin, .hide').removeClass('hide').fadeIn(); }); Like i say, it all works fine apart from that damn data-parent-room value. Any help is appreciated! using jQuery 1.10.1

    Read the article

  • how can i update view when fragment change?

    - by user1524393
    i have a activity that have 2 sherlockfragment in this The first two pages display fragments with custom list views which are built from xml from server using AsyncTask. However, when the app runs, only one list view is displayed, the other page is just blank public class VpiAbsTestActivity extends SherlockFragmentActivity { private static final String[] CONTENT = new String[] { "1","2"}; TestFragmentAdapter mAdapter; ViewPager mPager; PageIndicator mIndicator; protected void onCreate(Bundle savedInstanceState) { setRequestedOrientation(ActivityInfo.SCREEN_ORIENTATION_PORTRAIT); super.onCreate(savedInstanceState); setContentView(R.layout.simple_tabs); mAdapter = new TestFragmentAdapter(getSupportFragmentManager()); mPager = (ViewPager)findViewById(R.id.pager); mPager.setAdapter(mAdapter); mIndicator = (TabPageIndicator)findViewById(R.id.indicator); mIndicator.setViewPager(mPager); mIndicator.notifyDataSetChanged(); } class TestFragmentAdapter extends FragmentPagerAdapter { private int mCount = CONTENT.length; public TestFragmentAdapter(FragmentManager fm) { super(fm); } @Override public Fragment getItem(int position) { switch(position) { case 0: return new customlist(); case 1: return new customlistnotuser(); default: return null; } } @Override public int getCount() { return mCount; } public CharSequence getPageTitle(int position) { return VpiAbsTestActivity.CONTENT[position % VpiAbsTestActivity.CONTENT.length].toUpperCase(); } @Override public void destroyItem(View collection, int position, Object view) { ((ViewPager) collection).removeView((View) view); } } } what can i update viewpager when change pages ? the customlistnotuser page likes customlist page but not show public class customlistnotuser extends SherlockFragment { // All static variables static final String URL = "url"; // XML node keys static final String KEY_TEST = "test"; // parent node static final String KEY_ID = "id"; static final String KEY_TITLE = "title"; static final String KEY_Description = "description"; static final String KEY_DURATION = "duration"; static final String KEY_THUMB_URL = "thumb_url"; static final String KEY_PRICE = "price"; static final String KEY_URL = "url"; private ProgressDialog pDialog; ListView list; LazyAdapterbeth adapter; XMLParser parser = new XMLParser(); public void onActivityCreated(Bundle savedInstanceState) { super.onActivityCreated(savedInstanceState); } public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); new getFeed().execute(); } public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) { View thisfragment = inflater.inflate(R.layout.dovomi, container, false); return thisfragment; } private class getFeed extends AsyncTask<Void, Void, Document> { } protected Document doInBackground(Void... params) { XMLParser parser = new XMLParser(); String xml = parser.getXmlFromUrl(URL); // getting XML from URL Document doc = parser.getDomElement(xml); // getting DOM element return doc; } protected void onPostExecute(Document doc) { ArrayList<HashMap<String, String>> songsList = new ArrayList<HashMap<String, String>>(); NodeList nl = doc.getElementsByTagName(KEY_TEST); // looping through all song nodes <song> for (int i = 0; i < nl.getLength(); i++) { // creating new HashMap HashMap<String, String> map = new HashMap<String, String>(); Element e = (Element) nl.item(i); // adding each child node to HashMap key => value map.put(KEY_ID, parser.getValue(e, KEY_ID)); map.put(KEY_TITLE, parser.getValue(e, KEY_TITLE)); map.put(KEY_Description, parser.getValue(e, KEY_Description)); map.put(KEY_DURATION, parser.getValue(e, KEY_DURATION)); map.put(KEY_THUMB_URL, parser.getValue(e, KEY_THUMB_URL)); map.put(KEY_PRICE, parser.getValue(e, KEY_PRICE)); map.put(KEY_URL, parser.getValue(e, KEY_URL)); // adding HashList to ArrayList songsList.add(map); pDialog.dismiss(); } list=(ListView)getActivity().findViewById(R.id.list); // Getting adapter by passing xml data ArrayList adapter=new LazyAdapterbeth(getActivity(), songsList); list.setAdapter(adapter); // Click event for single list row list.setOnItemClickListener(new OnItemClickListener() {

    Read the article

< Previous Page | 447 448 449 450 451 452 453 454 455 456 457 458  | Next Page >