Search Results

Search found 15273 results on 611 pages for 'subtle array'.

Page 451/611 | < Previous Page | 447 448 449 450 451 452 453 454 455 456 457 458  | Next Page >

• javascript to launch only ONE window for a Java applet with a given URL

  - by Jonathan Dugan

  I need a javascript solution to launch only one window, with a Java Applet in it, for a given URL. I found a solution posted here on Stack Overflow - here: http://stackoverflow.com/questions/528671/javascript-window-open-only-if-the-window-does-not-already-exist But it doesn't seem to work .. I get Error: launchApplication.winrefs is undefined Line: 29 I can't seem to post the code in this little box and make it look right below, so the code (my working code, plus the solution from above) is here: http://pastie.org/833879 Where is the error? As I understand it, the hash or array or whatever I use to store the called references to the windows opened this way will be lost if the calling window is closed. Is there a way to make this work even if the calling window is closed and reopened? To basically ask the browser: "Do you have a window open with the following URL?" and if so, "What is the reference to that window?" (so I can raise it).

  Read the article

• Binding Many-to-Many Core Data relationships in UI

  - by Kevin

  Basically my setup is this. I have a many-to-many relationship in Core Data where a student entity can have multiple courses, and a course entity can have multiple students. My problem is in trying to figure out how to bind this relationship to the UI in Interface Builder. I want to be able to add courses to a course array controller, then have those courses displayed in a popup menu in a NSTableView in the Edit Student window where you can add courses to a student. This is what I have so far: http://vimeo.com/10671726 It's probably easier to understand from the video. Thanks

  Read the article

• How do I get a full Magento session in an external script? (Specifically, Catalog Rules)

  - by Laizer

  I'm running an external script that loads up a Magento session. Within that script, I'm loading products and grabbing a bunch of properties. The one issue is that getFinalPrice() does not apply the catalog rules that apply to the product. I'm doing everything I know to set the session, even a bunch of stuff that I think is superfluous. Nothing seems to get these rules applied. Here's a test script: require_once "app/Mage.php"; umask(0); $app = Mage::app("default"); $app->getTranslator()->init('frontend'); //Probably not needed Mage::getSingleton('core/session', array('name'=>'frontend')); $session = Mage::getSingleton("customer/session"); $session->start(); //Probably not needed $session->loginById(122); $product = Mage::getModel('catalog/product')->load(1429); echo $product->getFinalPrice(); Any insight is appreciated.

  Read the article

• Finding the closest grid coordinate to the mouse onclick with javascript/jQuery

  - by Acorn

  What I'm trying to do is make a grid of invisible coordinates on the page equally spaced. I then want a <div> to be placed at whatever grid coordinate is closest to the pointer when onclick is triggered. Here's the rough idea: I have the tracking of the mouse coordinates and the placing of the <div> worked out fine. What I'm stuck with is how to approach the problem of the grid of coordinates. First of all, should I have all my coordinates in an array which I then compare my onclick coordinate to? Or seeing as my grid coordinates follow a rule, could I do something like finding out which coordinate that is a multiple of whatever my spacing is is closest to the onclick coordinate? And then, where do I start with working out which grid point coordinate is closest? What's the best way of going about it? Thanks!

  Read the article

• Do i *have* to use ObservableCollection in Silverlight WCF client?

  - by Simon_Weaver

  When accessing Silverlight in WCF you get proxies generated with ObservableCollection Thats fine when you're databinding, but a little clumsy when you're just calling a method. For instance the following service method : [OperationContract] public SearchOrdersMsgOut SearchOrders(ShippingStatusType[] shippingStatuses, string[] orderId) { } gets generated with ObservableCollection. What! They're just parameters. Why would I ever want to 'observe' them? I'm fine if I have to do this - but it seems like there should be a way to force simple array structures when I know I'm never databinding - especially on input messages. I'd much rather do this : searchCriteria.PaymentStatus = new [] { PaymentStatusType.PaymentFailed, PaymentStatusType.Unpaid }; than this : searchCriteria.PaymentStatus = new ObservableCollection<PaymentStatusType> { PaymentStatusType.PaymentFailed, PaymentStatusType.Unpaid }; Is there a way? PS. I do actually use a SearchCriteria object for my search criteria - but I simplified for this example wondering if parameters were handled differently.

  Read the article

• Difference between mutableArrayValueForKey and calling insertObject:inEmployeesAtIndex: directly

  - by jasonbogd

  I have a question regarding using KVO-compliant methods to insert/remove objects from an array. I'm working through Aaron Hillegass' Cocoa Programming for Mac OS X and I saw the following line of code (in the insertObject:inEmployeesAtIndex: method: [[undoManager prepareWithInvocationTarget:self] removeObjectFromEmployeesAtIndex:index]; Correct me if I'm wrong, but I always thought it was better to call mutableArrayValueForKey: and then removeObjectAtIndex:...so I tried changing the above line to this: [[undoManager prepareWithInvocationTarget:[self mutableArrayValueForKey:@"employees"]] removeObjectAtIndex:index]; And it didn't work. Can someone explain the difference and why the first line works but the second line doesn't?

  Read the article

• Interpretation of Greek characters by FOP

  - by Geek

  Hi, Can you please help me interpret the Greek Characters with HTML display as HTML= & #8062; and Hex value 01F7E Details of these characters can be found on the below URL http://www.isthisthingon.org/unicode/index.php?page=01&subpage=F&hilite=01F7E When I run this character in Apache FOP, they give me an ArrayIndexOut of Bounds Exception Caused by: java.lang.ArrayIndexOutOfBoundsException: -1 at org.apache.fop.text.linebreak.LineBreakUtils.getLineBreakPairProperty(LineBreakUtils.java:668) at org.apache.fop.text.linebreak.LineBreakStatus.nextChar(LineBreakStatus.java:117) When I looked into the FOP Code, I was unable to understand the need for lineBreakProperties[][] Array in LineBreakUtils.java. I also noticed that FOP fails for all the Greek characters mentioned on the above page which are non-displayable with the similar error. What are these special characters ? Why is their no display for these characters are these Line Breaks or TAB’s ? Has anyone solved a similar issue with FOP ?

  Read the article

• Strategy for storing and displaying form dropdown data for provinces, states, prefixes?

  - by meder

  I'm currently migrating from a class that stores lists of countries, states & provinces in the form of arrays to using Zend's Locale data in the form of ldml xml files. These ldml files provide localised lists of countries, currencies, languages - so I'm not exactly sure where I should store US States, ( Canadian Provinces ), Prefixes - I was thinking possibly just create a generic xml file and store it in the same directory as the ldml files, but having doubts because it wouldn't really be localised as I'd store it in English. Should I go with storing it in a generic xml file, or possibly update each of the locale files ( eg en.xml ) and append them? The latter is probably not worth the work, which is why I'm swaying towards just a general.xml or dropdown-data.xml. As for generating dropdown options, I suppose I could just say, grab all US states, append the array with Canadian provinces, and append that with an 'Other' option - does this seem like the right way to go about?

  Read the article

• Why is the event object different coming from jquery bind vs. addEventListener

  - by yodaisgreen

  Why is it when I use the jQuery bind the event object I get back is different from the event object I get back using addEventListener? The event object resulting from this jQuery bind does not have the targetTouches array (among other things) but the event from the addEventListener does. Is it me or is something not right here? $(document).ready (function () { $("#test").bind("touchmove", function (event) { console.log(event.targetTouches[0].pageX); // targetTouches is undefined }); }); vs. $(document).ready (function () { var foo = document.querySelectorAll('#test') foo[0].addEventListener('touchmove', function (event) { console.log(event.targetTouches[0].pageX); // returns the correct values }, false); });

  Read the article

• Why does my program crash when given negative values?

  - by Wayfarer

  Alright, I am very confused, so I hope you friends can help me out. I'm working on a project using Cocos2D, the most recent version (.99 RC 1). I make some player objects and some buttons to change the object's life. But the weird thing is, the code crashes when I try to change their life by -5. Or any negative value for that matter, besides -1. NSMutableArray *lifeButtons = [[NSMutableArray alloc] init]; CCTexture2D *buttonTexture = [[CCTextureCache sharedTextureCache] addImage:@"Button.png"]; LifeChangeButtons *button = nil; //top left button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(50 , size.height - 30); [button buttonText:-5]; [lifeButtons addObject:button]; //top right button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(size.width - 50 , size.height - 30); [button buttonText:1]; [lifeButtons addObject:button]; //bottom left button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(50 , 30); [button buttonText:5]; [lifeButtons addObject:button]; //bottom right button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(size.width - 50 , 30); [button buttonText:-1]; [lifeButtons addObject:button]; for (LifeChangeButtons *theButton in lifeButtons) { [self addChild:theButton]; } This is the code that makes the buttons. It simply makes 4 buttons, puts them in each corner of the screen (size is the screen) and adds their life change ability, 1,-1,5, or -5. It adds them to the array and then goes through the array at the end and adds all of them to the screen. This works fine. Here is my code for the button class: (header file) // // LifeChangeButtons.h // Coco2dTest2 // // Created by Ethan Mick on 3/14/10. // Copyright 2010 Wayfarer. All rights reserved. // #import "cocos2d.h" @interface LifeChangeButtons : CCSprite <CCTargetedTouchDelegate> { NSNumber *lifeChange; } @property (nonatomic, readonly) CGRect rect; @property (nonatomic, retain) NSNumber *lifeChange; + (id)lifeButton:(CCTexture2D *)texture; - (void)buttonText:(int)number; @end Implementation file: // // LifeChangeButtons.m // Coco2dTest2 // // Created by Ethan Mick on 3/14/10. // Copyright 2010 Wayfarer. All rights reserved. // #import "LifeChangeButtons.h" #import "cocos2d.h" #import "CustomCCNode.h" @implementation LifeChangeButtons @synthesize lifeChange; //Create the button +(id)lifeButton:(CCTexture2D *)texture { return [[[self alloc] initWithTexture:texture] autorelease]; } - (id)initWithTexture:(CCTexture2D *)atexture { if ((self = [super initWithTexture:atexture])) { //NSLog(@"wtf"); } return self; } //Set the text on the button - (void)buttonText:(int)number { lifeChange = [NSNumber numberWithInt:number]; NSString *text = [[NSString alloc] initWithFormat:@"%d", number]; CCLabel *label = [CCLabel labelWithString:text fontName:@"Times New Roman" fontSize:20]; label.position = CGPointMake(35, 20); [self addChild:label]; } - (CGRect)rect { CGSize s = [self.texture contentSize]; return CGRectMake(-s.width / 2, -s.height / 2, s.width, s.height); } - (BOOL)containsTouchLocation:(UITouch *)touch { return CGRectContainsPoint(self.rect, [self convertTouchToNodeSpaceAR:touch]); } - (void)onEnter { [[CCTouchDispatcher sharedDispatcher] addTargetedDelegate:self priority:0 swallowsTouches:YES]; [super onEnter]; } - (void)onExit { [[CCTouchDispatcher sharedDispatcher] removeDelegate:self]; [super onExit]; } - (BOOL)ccTouchBegan:(UITouch *)touch withEvent:(UIEvent *)event { CGPoint touchPoint = [touch locationInView:[touch view]]; touchPoint = [[CCDirector sharedDirector] convertToGL:touchPoint]; if ( ![self containsTouchLocation:touch] ) return NO; NSLog(@"Button touch event was called returning yes. "); //this is where we change the life to each selected player NSLog(@"Test1"); NSMutableArray *tempArray = [[[UIApplication sharedApplication] delegate] selectedPlayerObjects]; NSLog(@"Test2"); for (CustomCCNode *aPlayer in tempArray) { NSLog(@"we change the life by %d.", [lifeChange intValue]); [aPlayer changeLife:[lifeChange intValue]]; } NSLog(@"Test3"); return YES; } - (void)ccTouchMoved:(UITouch *)touch withEvent:(UIEvent *)event { CGPoint touchPoint = [touch locationInView:[touch view]]; touchPoint = [[CCDirector sharedDirector] convertToGL:touchPoint]; NSLog(@"You moved in a button!"); } - (void)ccTouchEnded:(UITouch *)touch withEvent:(UIEvent *)event { NSLog(@"You touched up in a button"); } @end Now, This function: - (BOOL)ccTouchBegan:(UITouch *)touch withEvent:(UIEvent *)event Is where all the shit goes down. It works for all of the buttons except the -5 one. And then, it gets to: NSLog(@"we change the life by %d.", [lifeChange integerValue]); And it crashes at that statement. It only crashes when given anything less than -1. -1 works, but nothing smaller does. Here is the code in the CustomCCNode Class, "changeLife" that is being called. - (void)changeLife:(int)lifeChange { NSLog(@"change life in Custom Class was called"); NSLog(@"wtf is lifechange: %d", lifeChange); life += lifeChange; lifeString = [[NSString alloc] initWithFormat:@"%d",life]; [text setString:lifeString]; } Straight forward, but when the NSnumber is -5, it doesn't even get called, it crashes at the NSlog statement. So... what's up with that?

  Read the article

• Where are my $_FILES? Ajax Uploading

  - by Richard Testani

  I've built a form to upload images, and processed with Prototype/PHP. $('image_upload').observe('submit', function() { var params = $H(); params.set('name', $('image_title').value); params.set('from', $('from_who').value); params.set('upload_file', $('upload_file').value); new Ajax.Request('/files/upload_process.php', { method:'post', parameters: params, onSuccess: function(r) { $('uploadbox').update('<img src="/images/interface/thankyou.png" />'); } }) }); The form itself sends the data to the server, but when I try to output print_r($_FILES['upload_file']); nothing appears, not even an empty array. If I output print_r($_POST), the parameters are sent properly, but only the file name of the image. So it seems the files themselves are not being sent along. How do I handle this? Thanks Rich

  Read the article

• Using UIImageView for a flipbook anim on iphone

  - by Joey

  I'm using UIImageView to run a flipbook anim like this: mIntroAnimFrame = [[UIImageView alloc] initWithFrame:CGRectMake( 0, 0, 480, 320); mIntroAnimFrame.image = [UIImage imageNamed:@"frame0000.tif"]; Basically, when determine it is time, I flip the image by just calling: mIntroAnimFrame.image = [UIImage imageNamed:@"frame0000.tif"]; again with the right frame. Should I be doing this differently? Are repeated calls to set the image this way possibly bogging down main memory, or does each call essentially free the previous UIImage because nothing else references it? I suspect the latter is true. Also, is there an easy way to preload the images? The anim seems to slow down at times. Should I simply load all the images into a dummy UIImage array so they are preloaded, then refer to it when I want to show it with mIntroAnimFrame.image = mPreloadedArray[i]; ?

  Read the article

• Multiple records with one request in RESTful system

  - by keithjgrant

  All the examples I've seen regarding a RESTful architecture have dealt with a single record. For example, a GET request to mydomain.com/foo/53 to get foo 53 or a POST to mydomain.com/foo to create a new Foo. But what about multiple records? Being able to request a series of Foos by id or post an array of new Foos generally would be more efficient with a single API request rather than dozens of individual requests. Would you "overload" mydomain.com/foo to handle requests for both a single or multiple records? Or would you add a mydomain.com/foo-multiple to handle plural POSTs and GETs? I'm designing a system that may potentially need to get many records at once (something akin to mydomain.com/foo/53,54,66,86,87) But since I haven't seen any examples of this, I'm wondering if there's something I'm just not getting about a RESTful architecture that makes this approach "wrong".

  Read the article

• Scala wont pattern match with java.lang.String and Case Class

  - by Stefan

  Hello fellow Scala Programmers I have been working with Scala for some month now, however I have a problem with some properly basic stuff, I am hoping you will help my out with it. case class PersonClass(name: String, age: Int) object CaseTester { def main(args:Array[String]) { val string = "hej" string match { case e:String => println(string) case PersonClass => println(string) } } } When I am doing like this I get error: pattern type is incompatible with expected type; found : object PersonClass required: java.lang.String case PersonClass = println(string) And if I then change the second line in the pattern matching to the following: case e:PersonClass => println(string) I then get the error: error: scrutinee is incompatible with pattern type; found : PersonClass required: java.lang.String case e:PersonClass = println(string) However if I change the string definition to the following it compiles fine in both cases. val string:AnyRef = "hej"

  Read the article

• Replacing backslash with another symbol in PHP

  - by Skyfe

  Hi there, Been struggling with replacing a backslash by another symbol such as '.-.' just to indicate the position of backslashes as I could not send a string such as 'C\xampp\etc.' through url as GET variable so I thought I'd first replace the backslashes in that string by another symbol, then send through url, and then replace them back to backslashes in the PHP file that handles it. Though would there be a better way to send such strings through url? Because when I try a script such as: $tmp_name = preg_replace("\", ".-.", $_FILES['uploadfile']['tmp_name']); It turns out into a php error as \ is also used as delimiter.. Could anyone help me out on this? Thanks in advanced! Btw, if I'd be able to send a full array through url, this whole problem would be solved, but I don't think it's possible?

  Read the article

• F#: Define an abstract class that inherits an infterface, but does not implement it

  - by akaphenom

  I owuld like to define an abstract class that inerhits from UserControl and my own Interface IUriProvider, but doesn't implement it. The goal is to be able to define pages (for silverlight) that implement UserControl but also provide their own Uri's (and then stick them in a list / array and deal with them as a set: type IUriProvider = interface abstract member uriString: String ; abstract member Uri : unit -> System.Uri ; end type UriUserControl() as this = inherit IUriProvider with abstract member uriString: String ; inherit UserControl() Also the Uri in the definition - I would like to implement as a property getter - and am having issues with that as well. this does not compile type IUriProvider = interface abstract member uriString: String with get; end Thank you...

  Read the article

• CommunicationException in WCF

  - by user343159

  Hi I have a problem with a WCF Service I've just created. This was working yesterday but for some reason it's just stopped working. One of my WCF methods returns an array of an Entity Framework entity, like this: public BranchContactDetail[] GetClosestBranches(string postcode, int howManyBranches) { GeoLocation geoLocation = GetLocationFromPostcode(postcode); Location location = new Location(geoLocation.Latitude, geoLocation.Longitude); using (BranchDirectoryEntities entities = new BranchDirectoryEntities()) { var branchesInOrder = entities.BranchContactDetails .Where(b => b.latitude.HasValue && b.longitude.HasValue ) .OrderBy(b => location.DistanceFrom(b.latitude, b.longitude)) .Take(howManyBranches) .ToArray(); return branchesInOrder; } } ...and, as I say, this was working fine yesterday. Now I'm getting a "The underlying connection was closed: The connection was closed unexpectedly." I've hunted all over the web but no-one seems to know the answer. Anyone shed any light on this issue? Regards, Mark

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Multiple key/value pairs in HTTP POST where key is the same name

  - by randombits

  I'm working on an API that accepts data from remote clients, some of which where the key in an HTTP POST almost functions as an array. In english what this means is say I have a resource on my server called "class". A class in this sense, is the type a student sits in and a teacher educates in. When the user submits an HTTP POST to create a new class for their application, a lot of the key value pairs look like: student_name: Bob Smith student_name: Jane Smith student_name: Chris Smith What's the best way to handle this on both the client side (let's say the client is cURL or ActiveResource, whatever..) and what's a decent way of handling this on the server-side if my server is a Ruby on Rails app? Need a way to allow for multiple keys with the same name and without any namespace clashing or loss of data.

  Read the article

• Help needed with Javascript Variable Scope / OOP and Call Back Functions

  - by gargantaun

  I think this issue goes beyond typical variable scope and closure stuff, or maybe I'm an idiot. Here goes anyway... I'm creating a bunch of objects on the fly in a jQuery plugin. The object look something like this function WedgePath(canvas){ this.targetCanvas = canvas; this.label; this.logLabel = function(){ console.log(this.label) } } the jQuery plugin looks something like this (function($) { $.fn.myPlugin = function() { return $(this).each(function() { // Create Wedge Objects for(var i = 1; i <= 30; i++){ var newWedge = new WedgePath(canvas); newWedge.label = "my_wedge_"+i; globalFunction(i, newWedge]); } }); } })(jQuery); So... the plugin creates a bunch of wedgeObjects, then calls 'globalFunction' for each one, passing in the latest WedgePath instance. Global function looks like this. function globalFunction(indicator_id, pWedge){ var targetWedge = pWedge; targetWedge.logLabel(); } What happens next is that the console logs each wedges label correctly. However, I need a bit more complexity inside globalFunction. So it actually looks like this... function globalFunction(indicator_id, pWedge){ var targetWedge = pWedge; someSql = "SELECT * FROM myTable WHERE id = ?"; dbInterface.executeSql(someSql, [indicator_id], function(transaction, result){ targetWedge.logLabel(); }) } There's a lot going on here so i'll explain. I'm using client side database storage (WebSQL i call it). 'dbInterface' an instance of a simple javascript object I created which handles the basics of interacting with a client side database [shown at the end of this question]. the executeSql method takes up to 4 arguments The SQL String an optional arguments array an optional onSuccess handler an optional onError handler (not used in this example) What I need to happen is: When the WebSQL query has completed, it takes some of that data and manipulates some attribute of a particular wedge. But, when I call 'logLabel' on an instance of WedgePath inside the onSuccess handler, I get the label of the very last instance of WedgePath that was created way back in the plugin code. Now I suspect that the problem lies in the var newWedge = new WedgePath(canvas); line. So I tried pushing each newWedge into an array, which I thought would prevent that line from replacing or overwriting the WedgePath instance at every iteration... wedgeArray = []; // Inside the plugin... for(var i = 1; i <= 30; i++){ var newWedge = new WedgePath(canvas); newWedge.label = "my_wedge_"+i; wedgeArray.push(newWedge); } for(var i = 0; i < wedgeArray.length; i++){ wedgeArray[i].logLabel() } But again, I get the last instance of WedgePath to be created. This is driving me nuts. I apologise for the length of the question but I wanted to be as clear as possible. END ============================================================== Also, here's the code for dbInterface object should it be relevant. function DatabaseInterface(db){ var DB = db; this.sql = function(sql, arr, pSuccessHandler, pErrorHandler){ successHandler = (pSuccessHandler) ? pSuccessHandler : this.defaultSuccessHandler; errorHandler = (pErrorHandler) ? pErrorHandler : this.defaultErrorHandler; DB.transaction(function(tx){ if(!arr || arr.length == 0){ tx.executeSql(sql, [], successHandler, errorHandler); }else{ tx.executeSql(sql,arr, successHandler, errorHandler) } }); } // ---------------------------------------------------------------- // A Default Error Handler // ---------------------------------------------------------------- this.defaultErrorHandler = function(transaction, error){ // error.message is a human-readable string. // error.code is a numeric error code console.log('WebSQL Error: '+error.message+' (Code '+error.code+')'); // Handle errors here var we_think_this_error_is_fatal = true; if (we_think_this_error_is_fatal) return true; return false; } // ---------------------------------------------------------------- // A Default Success Handler // This doesn't do anything except log a success message // ---------------------------------------------------------------- this.defaultSuccessHandler = function(transaction, results) { console.log("WebSQL Success. Default success handler. No action taken."); } }

  Read the article

• Completion block not being called. How to check validity?

  - by HCHogan

  I have this method which takes a block, but that block isn't always called. See the method: - (void)updateWithCompletion:(void (^)(void))completion { [MYObject myMethodWithCompletion:^(NSArray *array, NSError *error) { if (error) { NSLog(@"%s, ERROR not nil", __FUNCTION__); completion(); return; } NSLog(@"%s, calling completion %d", __FUNCTION__, &completion); completion(); NSLog(@"%s, finished completion", __FUNCTION__); }]; } I have some more NSLogs inside completion. Sometimes this program counter just blows right past the call to completion() in the code above. I don't see why this would be as the calling code always passes a literal block of code as input. If you're curious of the output of the line containing the addressof operator, it's always something different, but never 0 or nil. What would cause completion not to be executed?

  Read the article

• Animation issue caused by C# parameters passed by reference rather than value, but where?

  - by Jordan Roher

  I'm having trouble with sprite animation in XNA that appears to be caused by a struct passed as a reference value. But I'm not using the ref keyword anywhere. I am, admittedly, a C# noob, so there may be some shallow bonehead error in here, but I can't see it. I'm creating 10 ants or bees and animating them as they move across the screen. I have an array of animation structs, and each time I create an ant or bee, I send it the animation array value it requires (just [0] or [1] at this time). Deep inside the animation struct is a timer that is used to change frames. The ant/bee class stores the animation struct as a private variable. What I'm seeing is that each ant or bee uses the same animation struct, the one I thought I was passing in and copying by value. So during Update(), when I advance the animation timer for each ant/bee, the next ant/bee has its animation timer advanced by that small amount. If there's 1 ant on screen, it animates properly. 2 ants, it runs twice as fast, and so on. Obviously, not what I want. Here's an abridged version of the code. How is BerryPicking's ActorAnimationGroupData[] getting shared between the BerryCreatures? class BerryPicking { private ActorAnimationGroupData[] animations; private BerryCreature[] creatures; private Dictionary<string, Texture2D> creatureTextures; private const int maxCreatures = 5; public BerryPickingExample() { this.creatures = new BerryCreature[maxCreatures]; this.creatureTextures = new Dictionary<string, Texture2D>(); } public void LoadContent() { // Returns data from an XML file Reader reader = new Reader(); animations = reader.LoadAnimations(); CreateCreatures(); } // This is called from another function I'm not including because it's not relevant to the problem. // In it, I remove any creature that passes outside the viewport by setting its creatures[] spot to null. // Hence the if(creatures[i] == null) test is used to recreate "dead" creatures. Inelegant, I know. private void CreateCreatures() { for (int i = 0; i < creatures.Length; i++) { if (creatures[i] == null) { // In reality, the name selection is randomized creatures[i] = new BerryCreature("ant"); // Load content and texture (which I create elsewhere) creatures[i].LoadContent( FindAnimation(creatures[i].Name), creatureTextures[creatures[i].Name]); } } } private ActorAnimationGroupData FindAnimation(string animationName) { int yourAnimation = -1; for (int i = 0; i < animations.Length; i++) { if (animations[i].name == animationName) { yourAnimation = i; break; } } return animations[yourAnimation]; } public void Update(GameTime gameTime) { for (int i = 0; i < creatures.Length; i++) { creatures[i].Update(gameTime); } } } class Reader { public ActorAnimationGroupData[] LoadAnimations() { ActorAnimationGroupData[] animationGroup; XmlReader file = new XmlTextReader(filename); // Do loading... // Then later file.Close(); return animationGroup; } } class BerryCreature { private ActorAnimation animation; private string name; public BerryCreature(string name) { this.name = name; } public void LoadContent(ActorAnimationGroupData animationData, Texture2D sprite) { animation = new ActorAnimation(animationData); animation.LoadContent(sprite); } public void Update(GameTime gameTime) { animation.Update(gameTime); } } class ActorAnimation { private ActorAnimationGroupData animation; public ActorAnimation(ActorAnimationGroupData animation) { this.animation = animation; } public void LoadContent(Texture2D sprite) { this.sprite = sprite; } public void Update(GameTime gameTime) { animation.Update(gameTime); } } struct ActorAnimationGroupData { // There are lots of other members of this struct, but the timer is the only one I'm worried about. // TimerData is another struct private TimerData timer; public ActorAnimationGroupData() { timer = new TimerData(2); } public void Update(GameTime gameTime) { timer.Update(gameTime); } } struct TimerData { public float currentTime; public float maxTime; public TimerData(float maxTime) { this.currentTime = 0; this.maxTime = maxTime; } public void Update(GameTime gameTime) { currentTime += (float)gameTime.ElapsedGameTime.TotalSeconds; if (currentTime >= maxTime) { currentTime = maxTime; } } }

  Read the article

• [OpenGL] I'm having an issue to use GLshort for representing Vertex, and Normal.

  - by Xylopia

  As my project gets close to optimization stage, I notice that reducing Vertex Metadata could vastly improve the performance of 3D rendering. Eventually, I've dearly searched around and have found following advices from stackoverflow. Using GL_SHORT instead of GL_FLOAT in an OpenGL ES vertex array How do you represent a normal or texture coordinate using GLshorts? Advice on speeding up OpenGL ES 1.1 on the iPhone Simple experiments show that switching from "FLOAT" to "SHORT" for vertex and normal isn't tough, but what troubles me is when you're to scale back verticies to their original size (with glScalef), normals are multiplied by the reciprocal of the scale. Then how do you use "short" for both vertex and normal at the same time? I've been trying this and that for about a full day, but I could only go for "float vertex w/ byte normal" or "short vertex w/ float normal" so far. Your help would be truly appreciated.

  Read the article

• Memory leak with preg_replace

  - by Silvio Donnini

  I'm using the preg_replace function to replace accents in a string, I'm working with UTF-8. I have incurred in what seems to be a memory leak, but I can't isolate the root cause, my code is rather simple: preg_replace( array_keys($aToNoAccents), array_values($aToNoAccents), $sText ); where $aToNoAccents is an associative array with entries like '~[A]~u' => 'A', '~[C]~u' => 'C',. My script prints this error for the above line: Fatal error: Allowed memory size of 1073741824 bytes exhausted (tried to allocate 3039 bytes) Obviously it's not a matter of increasing the allowed memory for PHP, (a 1Gb footprint is way off the scale of my application). Also, that line is executed thousands of times without problems but, just for some cases which are difficult to reproduce, it yields the error. Is anyone aware of memory problems with preg_replace and UTF-8 strings? Am I to use special care in passing actual parameters to such function? I'm using PHP 5.2.6-3 with Suhosin-Patch thanks Silvio

  Read the article

• Powershell GUI: Adding multiple instances of .tooltipseperate to menu

  - by obious

  So, I'm having a problem whereby for some reason I can only add one instance of a .tooltipseperator to a drop down menu. E.g. I have to create a new .tooltipseperator if I want to add another to a different menu list. I have this: $seperator = new-object System.Windows.Forms.Toolstripseparator $seperator1 = new-object System.Windows.Forms.Toolstripseparator which correlates to this: [Void]$packages_menu_bar.DropDownItems.Add($seperator1) [Void]$packages_menu_bar.DropDownItems.Add($Remove_from_AD) [Void]$process.DropDownItems.Add($Kill_process) [Void]$process.DropDownItems.Add($seperator) My question is this: how can I add the same instance on a .tooltipseperater to different menu items? Some sort of array? Thanks

  Read the article

< Previous Page | 447 448 449 450 451 452 453 454 455 456 457 458  | Next Page >