Search Results

Search found 46582 results on 1864 pages for 'ibm system x'.

Page 453/1864 | < Previous Page | 449 450 451 452 453 454 455 456 457 458 459 460  | Next Page >

  • Problem regarding listShuttle component in richFaces ?

    - by Hari
    I am a newbee for Richfaces components, When i am using the <rich:listShuttle> the Arraylist specified in the targetValue is now getting updated with the latest data? Kindly help MyJSF File <a4j:region> <rich:listShuttle sourceValue="#{bean.selectItems}" id="one" targetValue="#{bean.selectItemsone}" var="items" listsHeight="150" sourceListWidth="130" targetListWidth="130" sourceCaptionLabel="Intial Items" targetCaptionLabel="Selected Items" converter="Listconverter"> <rich:column> <h:outputText value="#{items.value}"></h:outputText> </rich:column> </rich:listShuttle> </a4j:region> <a4j:region> <a4j:commandButton value="Submit" action="#{bean.action}" /> </a4j:region> My Managed Bean enter code here private List<String> selectedData; private List<BeanItems> selectItems; private List<BeanItems> selectItemsone; public String action() { System.out.println(selectItems); System.out.println(selectItemsone); System.out.println("Select Item List"); Iterator<BeanItems> iterator = selectItems.iterator(); while (iterator.hasNext()) { BeanItems item = (BeanItems) iterator.next(); System.out.println(item.getValue()); } System.out.println("/nSelect Item one list "); Iterator<BeanItems> iterator2 = selectItemsone.iterator(); while (iterator2.hasNext()) { BeanItems item = (BeanItems) iterator2.next(); System.out.println(item.getValue()); } return ""; } public void setSelectedData(List<String> selectedData) { this.selectedData = selectedData; } public List<String> getSelectedData() { return selectedData; } /** * @return the selectItems */ public List<BeanItems> getSelectItems() { if (selectItems == null) { selectItems = new ArrayList<BeanItems>(); selectItems.add(new BeanItems("value4", "label4")); selectItems.add(new BeanItems("value5", "label5")); selectItems.add(new BeanItems("value6", "label6")); selectItems.add(new BeanItems("value7", "label7")); selectItems.add(new BeanItems("value8", "label8")); selectItems.add(new BeanItems("value9", "label9")); selectItems.add(new BeanItems("value10", "label10")); } return selectItems; } /** * @return the selectItemsone */ public List<BeanItems> getSelectItemsone() { if (selectItemsone == null) { selectItemsone = new ArrayList<BeanItems>(); selectItemsone.add(new BeanItems("value1", "label1")); selectItemsone.add(new BeanItems("value2", "label2")); selectItemsone.add(new BeanItems("value3", "label3")); } return selectItemsone; } My Converter Class enter code here public Object getAsObject(FacesContext context, UIComponent component,String value) { int index = value.indexOf(':'); return new BeanItems(value.substring(0, index), value.substring(index + 1)); } public String getAsString(FacesContext context, UIComponent component,Object value) { BeanItems beanItems = (BeanItems) value; return beanItems.getValue() + ":" + beanItems.getData(); } My BeanItems Class enter code here private String data; //Getter & setter private String value; //Getter & setter public BeanItems() { } public BeanItems(String value, String data) { this.value = value; this.data = data; } public int hashCode() { final int prime = 31; int result = 1; result = prime * result + ((data == null) ? 0 : data.hashCode()); result = prime * result + ((value == null) ? 0 : value.hashCode()); return result; } public boolean equals(Object obj) { if (this == obj) return true; if (obj == null) return false; if (getClass() != obj.getClass()) return false; final BeanItems other = (BeanItems) obj; if (data == null) { if (other.data != null) return false; } else if (!data.equals(other.data)) return false; if (value == null) { if (other.value != null) return false; } else if (!value.equals(other.value)) return false; return true; }

    Read the article

  • C# Winform : Deployment Problem after using DataRepeater of MS Visual Basics power pack

    - by Mohsan
    hi. Microsoft Visual Studio 2008 Service pack 1 comes with Visual Basic Powerpacks which has the DataRepeater control. I used this control in my c# winform application. in my system everything is running fine. now i copied the debug folder to other system which has only .Net Framework 3.5 SP1 installed. in this system is giving me error cannot load dependency Microsoft.VisualBasic.PowerPacks.dll even i set the Copy Local to "true" for "Microsoft.VisualBasic.dll" and "Microsoft.VisualBasic.PowerPacks.Vs.dll" please tell me how to solve this problem

    Read the article

  • Enable access for assistive device programmatically

    - by Dheeraj
    Hi All, I want to enable Access for assistive devices in System Preferences programmatically. But Problem is that my application is not running as root user and i do not want my application to be as root user and also should not ask for any authentication in between. I want to tap all keyboard events globally. I am using CGEventTapCreate() for the same.In the documentation of CGEventTapCreate() API it is mentioned that, Event taps receive key up and key down events if one of the following conditions is true: The current process is running as the root user. Access for assistive devices is enabled. In Mac OS X v10.4 & later, you can enable this feature using System Preferences, Universal Access panel, Keyboard view. I tried manually by checking the Enable Access for assistive devices from System Preference and it gives me expected output. So is there any way to do the same via program without asking for authentication and also application is not running as root user? Thanks, Dheeraj.

    Read the article

  • Linking IronPython to WPF

    - by DonnyD
    I just installed VS2010 and the great new IronPython Tools extension. Currently this extension doesn't yet generate event handlers in code upon double-clicking wpf visual controls. Is there anyone that can provide or point me to an example as to how to code wpf event handlers manually in python. I've had no luck finding any and I am new to visual studio. Upon generating a new ipython wpf project the auto-generated code is: import clr clr.AddReference('PresentationFramework') from System.Windows.Markup import XamlReader from System.Windows import Application from System.IO import FileStream, FileMode app = Application() app.Run(XamlReader.Load(FileStream('WpfApplication7.xaml', FileMode.Open))) and the XAML is: <Window xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" Title="WpfApplication7" Height="300" Width="300"> <Button>Click Me</Button> </Window> Any help would be appreciated.

    Read the article

  • Problem with running c# application on another PC

    - by draghia-aurelian
    I wrote a Windows Form Application in C# and it works well for my computer. But on another PC, an error occurs when i try to do some stuff. code 1 private void rUNToolStripMenuItem_Click(object sender, EventArgs e) { MessageBox.Show("I'm in rUNToolStripMenuItem_Click!"); ... } code 2 private void dataPositionToolStripMenuItem_Click(object sender, EventArgs e) { MessageBox.Show("I'm in dataPositionToolStripMenuItem_Click!"); ... } Running on my computer: code1: MessageBox appears! code2: MessageBox appears! Running on another computer: code1: MessageBox doesn't appear and the error happens! code2: MessageBox appears! The error is: Method not found: "Void Microsoft.CSharp.RuntimeBinder.CSharpGetMemberBider..ctor(System.String.System.Type, System.Collections.Generic.IEnumerable'1)'. This is the PrintScreen with error: Please help me to solve the problem!

    Read the article

  • What is the Worst Depiction of Computer Use in a Movie

    - by Robert Cartaino
    You know the type: "It's a Unix system. I know this" -- in Jurassic park where a computer-genius girl sees a computer and quickly takes over like a 3-D video game, flying through the file system to shut down the park. [video link to the scene] So what's your favorite movie gaff that shows Hollywood can be completely clueless when it comes to portraying technology?

    Read the article

  • iphone build error that makes me want to buy a nail gun

    - by sol
    I'm just trying to build a simple update (which I have done before) for an iphone app, but now for some reason I'm getting this error. Can anyone tell me what it means? Command/Developer/Library/Xcode/Plug-ins/CoreBuildTasks.xcplugin/Contents/Resources/copyplist failed with exit code 127 sh: plutil: command not found Here are the Build Results: CopyPNGFile /Users/me/path/build/Dist-iphoneos/MyApp.app/img_000.png images/img_000.png cd /Users/me/ setenv COPY_COMMAND /Developer/Library/PrivateFrameworks/DevToolsCore.framework/Resources/pbxcp setenv PATH "/Developer/Platforms/iPhoneOS.platform/Developer/usr/bin:/Developer/usr/bin:/System/Library/Frameworks/JavaVM.frameworK/Versions/1.6/Home/" "/Developer/Platforms/iPhoneOS.platform/Developer/Library/Xcode/Plug-ins/iPhoneOS Build System Support.xcplugin/Contents/Resources/copypng" -compress "" /Users/path/images/img_000.png /Users/me/path/build/Dist-iphoneos/MyApp.app/img_000.png sh: dirname: command not found CopyPlistFile /Users/me/path/build/Dist-iphoneos/MyApp.app/Entitlements.plist Entitlements.plist cd /Users/me/ setenv PATH "/Developer/Platforms/iPhoneOS.platform/Developer/usr/bin:/Developer/usr/bin:/System/Library/Frameworks/JavaVM.frameworK/Versions/1.6/Home/" /Developer/Library/Xcode/Plug-ins/CoreBuildTasks.xcplugin/Contents/Resources/copyplist --convert binary1 Entitlements.plist --outdir /Users/me/path/build/Dist-iphoneos/MyApp.app sh: plutil: command not found

    Read the article

  • Measuring device drivers CPU/IO utilization caused by my program

    - by Lior Kogan
    Sometimes code can utilize device drivers up to the point where the system is unresponsive. Lately I've optimized a WIN32/VC++ code which made the system almost unresponsive. The CPU usage, however, was very low. The reason was 1000's of creations and destruction of GDI objects (pens, brushes, etc.). Once I refactored the code to create all objects only once - the system became responsive again. This leads me to the question: Is there a way to measure CPU/IO usage of device drivers (GPU/disk/etc) for a given program / function / line of code?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • WxPython Incompatible With Snow Leopard?

    - by Alex
    Hello all, Recently I upgraded to Snow Leopard, and now I can't run programs built with wxPython. The errors I get are (from Eclipse + PyDev): import wx File "/var/tmp/wxWidgets/wxWidgets-13~231/2.6/DSTROOT/System/Library/Frameworks /Python.framework/Versions/2.6/Extras/lib/ python/wx-2.8-mac-unicode/wx/__init__.py", line 45, in <module> File "/var/tmp/wxWidgets/wxWidgets-13~231/2.6/DSTROOT /System/Library/Frameworks/Python.framework/Versions/2.6/Extras/lib /python/wx-2.8-mac-unicode/wx/_core.py", line 4, in <module> ImportError:/System/Library/Frameworks /Python.framework/Versions/2.6/Extras/lib/python /wx-2.8-mac-unicode/wx/_core_.so: no appropriate 64-bit architecture (see "man python" for running in 32-bit mode) I don't really understand them and would appreciate if you could help me to do so, also, if you do know what's going on, how can I go about fixing them? Maybe this has something to do with the fact that Snow Leopard is 64-bit? Thanks!!

    Read the article

  • extend web server to serve static files

    - by Turtle
    Hello, I want to extend a web server which is only able to handle RPC handling now. The web server is written in C#. It provides a abstract handler function like following: public string owsHandler(string request, string path, string param, OSHttpRequest httpRequest, OSHttpResponse httpResponse) And I wrote following code to handle image files: Bitmap queryImg = new Bitmap(path); System.IO.MemoryStream stream = new System.IO.MemoryStream(); queryImg.Save(stream, System.Drawing.Imaging.ImageFormat.Bmp); queryImg.Dispose(); byte[] byteImage = stream.ToArray(); stream.Dispose(); return Convert.ToBase64String(byteImage); And I test it in the browser, the image is returned but the image dimension info is missed. Shall I add something more to the code? Or is any general way to server static files? I do not want to serve it in a ASP.net server. Thanks

    Read the article

  • Deployment Problem after using DataRepeater of MS Visual Bacis power pack

    - by Mohsan
    hi. Microsoft Visual Studio 2008 Service pack 1 comes with Visual Basic Powerpacks which has the DataRepeater control. I used this control in my c# winform application. in my system everything is running fine. now i copied the debug folder to other system which has only .Net Framework 3.5 SP1 installed. in this system is giving me error cannot load dependency Microsoft.VisualBasic.PowerPacks.dll even i set the Copy Local to "true" for "Microsoft.VisualBasic.dll" and "Microsoft.VisualBasic.PowerPacks.Vs.dll" please tell me how to solve this problem

    Read the article

  • SSH Advanced Logging

    - by Radek Šimko
    I've installed OpenSUSE on my server and want to set ssh to log every command, which is send to system over it. I've found this in my sshd_config: # Logging # obsoletes QuietMode and FascistLogging #SyslogFacility AUTH #LogLevel INFO I guess that both of those directives has to be uncommented, but I'd like to log every command, not only authorization (login/logout via SSH). I just want to know, if someone breaks into my system, what did he do.

    Read the article

  • Up to date, JPA compliant GenericDAOImplementation

    - by HDave
    I read this article: http://www.ibm.com/developerworks/java/library/j-genericdao.html several times and believe I understand what it is saying. However, it is 4 years old and I have a JPA compliant Java application to contend with. In addition, I see that there is a JPATemplate in Spring that has some good functionality, but the Spring documentation says it is already deprecated! Can anybody point me to a solid, modern, JPA compliant, Spring based, working example of a GenericDAOImpl that proxies an Interface to provide generic finder execution?

    Read the article

  • Networking: Adding specific route for printer, on Mac Connected to Two Networks

    - by Jordan
    I have a Mac connected to two different networks (wireless en1 and ethernet en0 ). The ethernet network is the preferred (System Preferences-Set Service Order). I'd like to be able to print to a printer on the wireless network side, without having to go to System Preferences and make the wireless network come first in the service order. Is there a way to add a route for a specific printer?

    Read the article

  • Location of the fonts on the iPhone?

    - by Kyle
    I'm using the FreeType2 library in an iPhone project, and I'm trying to simply load a TTF file from the system, if possible. FT_Library library; FT_Face face; int error; error = FT_Init_FreeType( &library ); if ( error == 0 ) printf("Initialized FreeType2\r\n"); /* Prints */ error = FT_New_Face(library, "/System/Library/Fonts/Helvetica.ttf", 0, &face); if ( error == FT_Err_Cannot_Open_Resource ) printf("Font not found\r\n"); /* Prints */ That error seems to be for file not found. Is /System/Library/Fonts not the location of the fonts? Or, do iPhone apps simply not have any read access at all to that directory. Thanks!

    Read the article

  • MSSQL Search Proper Names Full Text Index vs LIKE + SOUNDEX

    - by Matthew Talbert
    I have a database of names of people that has (currently) 35 million rows. I need to know what is the best method for quickly searching these names. The current system (not designed by me), simply has the first and last name columns indexed and uses "LIKE" queries with the additional option of using SOUNDEX (though I'm not sure this is actually used much). Performance has always been a problem with this system, and so currently the searches are limited to 200 results (which still takes too long to run). So, I have a few questions: Does full text index work well for proper names? If so, what is the best way to query proper names? (CONTAINS, FREETEXT, etc) Is there some other system (like Lucene.net) that would be better? Just for reference, I'm using Fluent NHibernate for data access, so methods that work will with that will be preferred. I'm using MS SQL 2008 currently.

    Read the article

  • How to take a screenshot with Mono C#?

    - by vagabond
    I'm trying to use use code get a screenshot in Mono C# but I'm getting a System.NotImplementedException when I call CopyFromScreen. My code works with .NET, so is there an alternate way of getting a screenshot using Mono? Bitmap bitmap = new Bitmap(Screen.PrimaryScreen.Bounds.Width, Screen.PrimaryScreen.Bounds.Height); Graphics graphics = Graphics.FromImage(bitmap as Image); graphics.CopyFromScreen(0, 0, 0, 0, bitmap.Size); System.IO.MemoryStream memoryStream = new System.IO.MemoryStream(); bitmap.Save(memoryStream, imageFormat); bitmap.Save(@"\tmp\screenshot.png", ImageFormat.Png); I am using Mono JIT compiler version 2.4.2.3 (Debian 2.4.2.3+dfsg-2)

    Read the article

  • Iframe Facebook application and cookies [Internet Explorer]

    - by Joe P
    I have downloaded the IBM P3P editor, created files and uploaded them to my server. And cookies are still not recognized in Internet Explorer. I've checked the P3P validation tool and it seems to validate. The application can be viewed here: apps.facebook.com/naplesnews and the iframe points to www.naplesnews.com/facebook/app/. Again www.naplesnews.com/facebook/app/ seems to validate with no issues as well. Any idea what I'm missing here?

    Read the article

  • Routing and Remote Access Service won't start after full disk

    - by NKCSS
    The HDD of the server was out of disk space, and after a reboot, RRAS won't start anymore on my 2008 R2 server. Error Details: Log Name: System Source: RemoteAccess Date: 2/5/2012 9:39:52 PM Event ID: 20153 Task Category: None Level: Error Keywords: Classic User: N/A Computer: Windows14111.<snip> Description: The currently configured accounting provider failed to load and initialize successfully. The connection was prevented because of a policy configured on your RAS/VPN server. Specifically, the authentication method used by the server to verify your username and password may not match the authentication method configured in your connection profile. Please contact the Administrator of the RAS server and notify them of this error. Event Xml: <Event xmlns="http://schemas.microsoft.com/win/2004/08/events/event"> <System> <Provider Name="RemoteAccess" /> <EventID Qualifiers="0">20153</EventID> <Level>2</Level> <Task>0</Task> <Keywords>0x80000000000000</Keywords> <TimeCreated SystemTime="2012-02-05T20:39:52.000Z" /> <EventRecordID>12148869</EventRecordID> <Channel>System</Channel> <Computer>Windows14111.<snip></Computer> <Security /> </System> <EventData> <Data>The connection was prevented because of a policy configured on your RAS/VPN server. Specifically, the authentication method used by the server to verify your username and password may not match the authentication method configured in your connection profile. Please contact the Administrator of the RAS server and notify them of this error.</Data> <Binary>2C030000</Binary> </EventData> </Event> I think it has something to do with a corrupt config file, but I am unsure of what to do. I Removed the RRAS role, rebooted, and re-added, but it keeps failing with the same error. Thanks in advance. [UPDATE] If i set the accounting provider from 'Windows' to '' the service starts but VPN won't work. Any ideas how this can be repaired?

    Read the article

  • WebConfigurationManager error after adding siteMap

    - by aron
    Hello I'm getting this error: Compiler Error Message: CS0118: 'Configuration' is a 'namespace' but is used like a 'type' Configuration myWebConfig = WebConfigurationManager.OpenWebConfiguration("~/"); This code has been in place for 5+ months without this issues, only today after adding this sitemap code do I have this issue. <siteMap defaultProvider="ExtendedSiteMapProvider" enabled="true"> <providers> <clear/> <add name="ExtendedSiteMapProvider" type="Configuration.ExtendedSiteMapProvider" siteMapFile="Web.sitemap" securityTrimmingEnabled="true"/> </providers> </siteMap> I tried adding "System.Web." before the "Configuration ", but that did not work either: System.Web.Configuration myWebConfig = WebConfigurationManager.OpenWebConfiguration("~/"); Error 1 'System.Web.Configuration' is a 'namespace' but is used like a 'type'

    Read the article

  • C# LINQ Where Predicate Type Arguments

    - by blu
    I have an XElement with values for mock data. I have an expression to query the xml: Expression<Func<XElement, bool>> simpleXmlFunction = b => int.Parse(b.Element("FooId").Value) == 12; used in: var simpleXml = xml.Elements("Foo").Where(simpleXmlFunction).First(); The design time error is: The type arguments for method 'System.Linq.Enumerable.Where(System.Collections.Generic.IEnumerable, System.Func)' cannot be inferred from the usage. Try specifying the type arguments explicitly' The delegate supplied to Where should take in an XElement and return a bool, marking if the item matches the query, I am not sure how to add anything more to the delegate or the where clause to mark the type. Also, the parallel method for the real function against the Entity Framework does not have this issue. What is not correct with the LINQ-to-XML version?

    Read the article

  • Should I worry about the integrity of my linux software RAID5 after a crash or kernel panic?

    - by Josh
    I have a dual core Intel i5 Ubuntu Server 10.04 LTS system running kernel 2.6.32-22-server #33-Ubuntu SMP with three 1TB SATA hard drives set up in a RAID5 array using linux md devices. I have read about the RAID5 write hole and am concerned: if my linux system locks up or kernel panics, should I be assume that the integrety of my data has been compromised and restore from backup? How can I know if the data on the RAID5 array is "safe"?

    Read the article

  • Build Systems for PHP Web Apps

    - by macinjosh
    I want to start automating more of my web development process so I'm looking for a build system. I write mostly PHP apps on Mac OS X and deploy Linux servers over FTP. A lot of my clients have basic hosting providers so shell access to their servers is typically not available, however remote MySQL access is usually present. Here is what I want to do with a build system: When Building: Lint JavaScript Files Validate CSS Files Validate HTML Files Minify and concatenate JS and CSS files Verify PHP Syntax Set Debug/Production flags When Deploying Checkout latest version from SVN Run build process Upload files to server via FTP Run SQL scripts on remote DB I realize this is a lot of work to automate but I think it would be worth it. So what is the best way to start down this path? Is there a system that can handle builds and deploys, or should I search for separate solutions? What systems would you recommend?

    Read the article

  • Why its not working?

    - by Andrew Hoffmann
    BinaryReader br = new BinaryReader(Console.OpenStandardInput()); BinaryWriter bw = new BinaryWriter(Console.OpenStandardOutput()); int n = br.ReadInt32(); bw.Write(n); always getting this error: Unhandled Exception: System.IO.EndOfStreamException: Failed to read past end of stream. at System.IO.BinaryReader.FillBuffer (Int32 numBytes) [0x00000] in <filename unknown>:0 at System.IO.BinaryReader.ReadInt32 () [0x00000] in <filename unknown>:0 at Program.Main () [0x00025] in /home/skydos/ACM/Csharp/Csharp/Main.cs:24 Is there any way to make reading data in C# faster from Console?

    Read the article

< Previous Page | 449 450 451 452 453 454 455 456 457 458 459 460  | Next Page >