Search Results

Search found 40287 results on 1612 pages for 'try statement'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 457/1612 | < Previous Page | 453 454 455 456 457 458 459 460 461 462 463 464  | Next Page >

  • IPod Touch - Refreshing Web Page while Offline?

    - by Anduril66
    Using my home wifi network, I open several browser windows on my Ipod Touch and load different web pages on them so I can read them on the bus later. Often, I can switch between windows and read the pages while WiFi is turned off but occasionally web pages try to refresh themselves when I switch to them. Why is this?

    Read the article

  • Wherer can I get Windows XP Images for WMware Workstation

    - by Saif Bechan
    Does anyone know where I can get windows images for vmware. I know Microsoft gives away the images for Virtual PC. These images work pretty well, but when I try to import them in VMware I need to activate the copies again, because the virtual hardware they use is just to different. I want Images of different versions of windows 2000,xp,vista. Does anyone where I can download them, or do I need to build them from CD.

    Read the article

  • Ubuntu 10.04 doesn't accept keyboard input when running under VMware on Windows 7

    - by anwar
    I have just installed Ubuntu for the first time using VMWare on Windows 7. Everything has been installed smoothly but after the installation in the login screen username is coming and when I try to enter password it is not taking any input, keyboard is not working at all. After moving away from Ubuntu keyboard and everthing else is working fine. Does anyone know what's the cause behind this ?

    Read the article

  • XP, how can I copy permissions from one partition to another, had no permssions and getting access denied trying to fix ?

    - by Jules
    For some reason, I'm not sure why, I have no permissions in the security tab/advanced tab for one partition. I'm trying to add them back by copying them manually from another partition. However when I try to replace permissions entries on some files it says access denied, then I have to click continue. I haven't much clue what this is all about, but I'd like to fix this as some folders in my partition aren't accessible in shares from other machines.

    Read the article

  • SQL Server: can SecurityAdmin role read error log?

    - by atricapilla
    I have read, e.g from here http://wiki.lessthandot.com/index.php/Find_Out_Server_Roles_For_a_SQL_Server_Login that SecurityAdmin role can read Error logs. I'm on SecurityAdmin role and when I try to execute xp_readerrorlog I get a following error: Msg 229, Level 14, State 5, Procedure xp_readerrorlog, Line 1 The EXECUTE permission was denied on the object 'xp_readerrorlog', database 'mssqlsystemresource', schema 'sys'. What I'm missing? Can this role read error logs or not?

    Read the article

  • Pinning based on origin of a reprepro repository.

    - by Shtééf
    I'm on Ubuntu 10.04, and trying to set up a repository using reprepro. I'd also like the pin everything in that repository to be preferred over anything else, even if packages are older versions. (It will only contain a select set of packages.) However, I cannot seem to get the pinning to work, and believe it has something to do with the repository side of things, rather than the apt configuration on the client. I've taken the following steps to set up my repository Installed a web server (my personal choice here is Cherokee), Created the directory /var/www/apt/, Created the file conf/distributions, like so: Origin: Shteef Label: Shteef Suite: lucid Version: 10.04 Codename: lucid Architectures: i386 amd64 source Components: main Description: My personal repository Ran reprepro export from the /var/www/apt/ directory. Now on any other machine, I can add this (empty) repository over HTTP to my /etc/apt/sources.list, and run apt-get update without any errors: Ign http://archive.lan lucid Release.gpg Ign http://archive.lan/apt/ lucid/main Translation-en_US Get:1 http://archive.lan lucid Release [2,244B] Ign http://archive.lan lucid/main Packages Ign http://archive.lan lucid/main Sources Ign http://archive.lan lucid/main Packages Ign http://archive.lan lucid/main Sources Hit http://archive.lan lucid/main Packages Hit http://archive.lan lucid/main Sources In my case, now I want to use an old version of Asterisk, namely Asterisk 1.4. I rebuilt the asterisk-1:1.4.21.2~dfsg-3ubuntu2.1 package from Ubuntu 9.04 (with some small changes to fix dependencies) and uploaded it to my repository. At this point I can see the new package in aptitude, but it naturally prefers the newer Asterisk 1.6 currently in the Ubuntu 10.04 repositories. To try and fix that, I have created /etc/apt/preferences.d/personal like so: Package: * Pin: release o=Shteef Pin-Priority: 1000 But when I try to install the asterisk package, it will still prefer the 1.6 version over my own 1.4 version. This is what apt-cache policy asterisk shows: asterisk: Installed: (none) Candidate: 1:1.6.2.5-0ubuntu1 Version table: 1:1.6.2.5-0ubuntu1 0 500 http://nl.archive.ubuntu.com/ubuntu/ lucid/universe Packages 1:1.4.21.2~dfsg-3ubuntu2.1shteef1 0 500 http://archive.lan/apt/ lucid/main Packages Clearly, it is not picking up my pin. In fact, when I run just apt-cache policy, I get the following: Package files: 100 /var/lib/dpkg/status release a=now 500 http://archive.lan/apt/ lucid/main Packages origin archive.lan 500 http://security.ubuntu.com/ubuntu/ lucid-security/multiverse Packages release v=10.04,o=Ubuntu,a=lucid-security,n=lucid,l=Ubuntu,c=multiverse origin security.ubuntu.com [...] Unlike Ubuntu's repository, apt doesn't seem to pick up a release-line at all for my own repository. I'm suspecting this is the cause why I can't pin on release o=Shteef in my preferences file. But I can't find any noticable difference between my repository's Release files and Ubuntu's that would cause this. Is there a step I've missed or mistake I've made in setting up my repository?

    Read the article

  • My virtualbox fstab will not auto-mount on reboot?

    - by stephenmm
    I am able to mount my drive manually like this (ubuntu): sudo mount -t vboxsf C_DRIVE /mnt/saga_c But when I try and add it to my fstab it does not mount when I restart the machine. Is there something wrong with my /etc/fstab line: C_DRIVE /mnt/saga_c vboxsf defaults 0 0 Do I need something in addition to the vboxsf? Or is there something else I am doing incorrectly?

    Read the article

  • Trying to use the 7-zip self extracting archive GUI and it fails [closed]

    - by djangofan
    Trying to use the 7-zip self extracting archive GUI and it fails. When I try to create a "Self Extracting Installer" option, at the end of the install it runs my batch file and it appears to be extracting all the files just before it does that, but after extraction, the files are nowhere to be found (except within the .7z archive). Any idea on why this occurs? https://code.google.com/p/sfx-creator/

    Read the article

  • Rsync --backup-dir seems to be ignored

    - by Patrik
    I want to use rsync to backup a directory from a local location to a remote location, and store changed files in another remote location. I did use: rsync -rcvhL --progress --backup [email protected]:/home/user/Changes/`date +%Y.%m.%d` . [email protected]:/home/user/Files/ The --backup-dir stays empty, while it should be filled. Is it possible what I try to accomplish, and am I doing something wrong? Thanks

    Read the article

  • server 2008 r2 - wbadmin systemstatebackup - system writer not found in the backup

    - by TWood
    I am trying to manually run a systemstatebackup command on my server 2008 r2 box and I am getting an error code '2155347997' when I view the backup event log details. The command line tells me that I have log files written to the c:\windows\logs\windowsserverbackup\ path but I have no files of the .log type there. My command window tells me "System Writer is not found in the backup". However when I run vssadmin list writers I find System Writer in the list and it shows normal status with no last errors stored. I am running this from an elevated command prompt as well as from a logged on administrator account. My backup target path has permission for network service to have full control and it has plenty of free space. Looking in eventlog I have two VSS error 8194 that happen immediately before the Backup error 517 which has the errorcode 2155347997 listed. All three of these errors are a result of trying to run the command for the systemstatebackup. It's my belief that some VSS related permission is failing and exiting the backup process before it ever gets started. Because of this the initial code that creates the log files must not be running and this is why I have no files. When running the systemstatebackup command from the command prompt and watching the windowsserverbackup directory I do see that I have a Wbadmin.0.etl file which gets created but it is deleted when the backup errors out and stops. I have looked online and there are numerous opinions as to the cause of this error. These are the things I have corrected to try and fix this issue before posting here: Machine runs a HP 1410i smart array controller but at one time also used a LSI scsi card. Used networkadminkb.com's kb# a467 to find one LSI_SCSI entry in HKLMSysCurrentControlSetServices which start was set to 0x0 and I modified to 0x3. No changes. In HKLMSystemCurrentControlSetServicesVSSDiag I gave network service full control where it previously only had "Special Permission". No changes. I followed KB2009272 to manually try to fix system writer. These are all of the things I have tried. What else should I look at to resolve this issue? It may be important to note that I run Mozy Pro on this server and that was known in the past to use VSS for copying operations and it occasionally threw an error. However since an update last year those error event log entries have stopped.

    Read the article

  • Windows 2012 VPN setup without Active Directory

    - by iss42
    I have followed the guide here: http://www.youtube.com/watch?v=9qbpxKRb-94 But my situation differs with respect to there being no AD (Active Directory) setup. When I try to connect I get this in the server event log: "The user xx connected from x.x.x.x but failed an authentication attempt due to the following reason: The account does not have permission to dial in." Is there a way to enable this without AD?

    Read the article

  • Printing Large PDF from Outlook 2003

    - by mrach
    Whenever I try to print an attached oversized PFF sheet (larger then letter sized) from Outlook, the print is cut off. How can I configure Outlook to automatically fit the PDF to page sized with out having to open it up in Adobe Reader?

    Read the article

  • What setting can cause a monitor to flicker under X11?

    - by BCS
    I've been dinking with the xorg.conf file on my system and now when I try to start X I get a flickering effect and no usable image. I think (and this is just a guess) that it's a settings out of bound error of some kind but I don't know what setting. I'm almost completely sure that the hardware is good given that everything is brand new.and works just fine in text mode. Any ideas?

    Read the article

  • Clear Type problem in Windows 7

    - by Florin Sabau
    I try to tune ClearType in Windows 7 x64 using the ClearType Text Tuner. I can choose whatever options I want on the first 3 pages, but on the last page, whatever I choose is reverted as soon as I click finish. Next time I run the tuner I can see that the second option is selected, not the option that I wanted (the last one). Has anybody else found this odd behavior?

    Read the article

  • Thunderbird loses all settings if PC is being shut down abnormally

    - by Roland
    If my PC shut downs suddenly with power dips etc I loose all my Thunderburd settings and mail in Thunderbird, although the Profiles folder still exists. I had a look in the profiles text file and that file looks unchanged. Are there things I could try to solve this issue? I do not know what do do? Any help will be greaatly appreciated. OS: Win XP Professional SP2 Thunderbird Version: 2.0.0.19

    Read the article

  • "make menuconfig" throwing cannot find -lc error in my Fedora 11 PC

    - by Sen
    When i try to do a make menuconfig in a Fedora 11 machine it is throwing the following error message: [root@PC04 kernel]# make menuconfig HOSTCC -static scripts/basic/fixdep scripts/basic/fixdep.c: In function âtrapsâ: scripts/basic/fixdep.c:377: warning: dereferencing type-punned pointer will break strict-aliasing rules scripts/basic/fixdep.c:379: warning: dereferencing type-punned pointer will break strict-aliasing rules /usr/bin/ld: cannot find -lc collect2: ld returned 1 exit status make[1]: *** [scripts/basic/fixdep] Error 1 make: *** [scripts_basic] Error 2 Please help me on this issue? How can i solve this? Thanks, Sen

    Read the article

  • Problem with bash scripting

    - by eple
    Hi. I terrible with bash scripting, and need some help with the following: #!/bin/bash if [ -e Pretty* ];then ncftpput -R -DD -v -u xbmc -p xbmc 192.168.1.100 /home/xbmc/TV/Pretty_Little_Liars/ Pretty* else echo "No new folders" fi find -depth -type d -empty -exec rmdir {} \; Problem here is the ncftpput line.. if I just do a simple [ echo "working" ] instead, everything is OK, but when I try the ncftpput-line it just gives me [ line 5: [: too many arguments ] the ncftpput command alone works fine.. Any ideas?

    Read the article

  • Can I burn a CD ISO to DVD?

    - by Peter Turner
    Well, I just figured I'd ask because this site is so awesome that it probably is faster to ask than try it and waste a few cents. So can I burn an CD ISO to DVD? We've just got a bunch of DVD-R's lying around and I don't want to bother with torrents to download the new Fedora DVD.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Install WAS 7.0 on RHEL 6

    - by Madhur Ahuja
    I am trying to install Websphere 7 x64 on RHEL 6 x64. I am using Developer edition. When I try to execute ./install on the command prompt, it waits for few seconds and then returns to prompt without any error. I have installed all the pre-requisites as listed in this article: http://pic.dhe.ibm.com/infocenter/wasinfo/v7r0/index.jsp?topic=%2Fcom.ibm.websphere.installation.base.doc%2Finfo%2Faes%2Fae%2Ftins_linuxsetup_rhel6.html Any idea how to troubleshoot this ?

    Read the article

  • Security System Preference won't open on Macos 10.6 Snow Leopard

    - by adambox
    When I try to open the Security preference pane on my iMac running Mac OS 10.6.6, it says "loading..." and it never opens. I get this in the console: 3/5/11 4:16:56 PM System Preferences[724] Could not connect the action resetLocationWarningsSheetOk: to target of class AppleSecurity_Pref 3/5/11 4:16:56 PM System Preferences[724] Could not connect the action resetLocationWarningsSheetCancel: to target of class AppleSecurity_Pref 3/5/11 4:16:56 PM System Preferences[724] *** -[NSCFDictionary initWithObjects:forKeys:count:]: attempt to insert nil value at objects[0] (key: NSFont)

    Read the article

  • Chrooted pygopherd fails to find new directories and files

    - by Carsten R
    I tried to setup a Pygopherd on my server. The default setup works fine, but when I try to change the gophermap to point to a new directory with a new file, I get an error message in my gopher client: --- [1] '/path/to/gopher/newdir' does not exist (no handler found) First I thought this is caused by the chroot in which pygopherd runs as default. But when I disable the chroot, the same error comes up. Did anyone successfully set up pygopherd or knows about a better gopher server?

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 453 454 455 456 457 458 459 460 461 462 463 464  | Next Page >