Search Results

Search found 16061 results on 643 pages for 'array indexing'.

Page 484/643 | < Previous Page | 480 481 482 483 484 485 486 487 488 489 490 491  | Next Page >

  • Kohana input & validation libraries - overlap?

    - by keithjgrant
    I'm familiarizing myself with Kohana. I've been reading up on the Input library, which automatically pre-filters GET and POST data for me, and the Validation libary, which helps with form validation. Should I use both together? The examples given in the Validation library documentation use the unfiltered $_POST array instead of $this->input->post(). Seems to me it would be more secure to chain the two, but the two sets of documentation seem to make no mention of each other, so I don't know if this would be redundant or not.

    Read the article

  • Equality Comparison with Multiple Instances/IEqualityComparer problems in LINQ

    - by Stacey
    This is similar to my last question; but from a different angle. http://stackoverflow.com/questions/2792393/see-if-item-exists-once-in-enumerable-linq Given the following set of items, and lists containing them... Item 1 Item 2 Item 3 Item 4 Item 5 class Item { string Name { get; set; } } List<Item> available = new List<Item>() { Item 1 Item 1 Item 2 Item 3 Item 5 } List<Item> selected = new List<Item>() { Item 1 Item 2 Item 3 } I need to make a third List that has everything from "available", except what is in "selected". However 'Item 1' is in 'available' twice, but only in 'selected' once. Since they are instances of the same item, I am having trouble figuring out the appropriate logic to accomodate this. The final array should look like... List<Item> selectable = new List<Item>() { Item 1 Item5 }

    Read the article

  • Scala wont pattern match with java.lang.String and Case Class

    - by Stefan
    Hello fellow Scala Programmers I have been working with Scala for some month now, however I have a problem with some properly basic stuff, I am hoping you will help my out with it. case class PersonClass(name: String, age: Int) object CaseTester { def main(args:Array[String]) { val string = "hej" string match { case e:String => println(string) case PersonClass => println(string) } } } When I am doing like this I get error: pattern type is incompatible with expected type; found : object PersonClass required: java.lang.String case PersonClass = println(string) And if I then change the second line in the pattern matching to the following: case e:PersonClass => println(string) I then get the error: error: scrutinee is incompatible with pattern type; found : PersonClass required: java.lang.String case e:PersonClass = println(string) However if I change the string definition to the following it compiles fine in both cases. val string:AnyRef = "hej"

    Read the article

  • Building resultset using collection object

    - by Bhaskara Krishna Mohan Potam
    Hi, I had an issue in building the resultset using java. Here it goes... I am storing a collection object which is organized as row wise taken from a resultset object and putting the collection object(which is stored as vector/array list) in cache and trying to retrieve the same collection object. Here i need to build back the resultset again using the collection object. Now my doubt is building the resultset in this way possible or not? Please let me know asap. Thanks in advance, Bhaskar

    Read the article

  • Marshal a list of objects from VB6 to C#

    - by Andrew
    I have a development which requires the passing of objects between a VB6 application and a C# class library. The objects are defined in the C# class library and are used as parameters for methods exposed by other classes in the same library. The objects all contain simple string/numeric properties and so marshaling has been relatively painless. We now have a requirement to pass an object which contains a list of other objects. If I was coding this in VB6 I might have a class containing a collection as a member variable. In C# I might have a class with a List member variable. Is it possible to construct a C# class in such a way that the VB6 application could populate this inner list and marshal it successfully? I don't have a lot of experience here but I would guess Id have to use an array of Object types.

    Read the article

  • Sending POST variables through a PHP proxy for AJAX?

    - by b. e. hollenbeck
    I've decided that using a PHP proxy for AJAX calls for a project is the best way to go - but I have a question regarding passing POST data through the proxy. As in - how to do it. Should I need to create a single variable in the javascript using alternate characters, then have the PHP proxy parse and modify the variable to reassemble a valid HTTP request? Or is there some means of passing along the $_POST array in new request to the external server by pulling the data out of the headers and re-sending it?

    Read the article

  • Replacing backslash with another symbol in PHP

    - by Skyfe
    Hi there, Been struggling with replacing a backslash by another symbol such as '.-.' just to indicate the position of backslashes as I could not send a string such as 'C\xampp\etc.' through url as GET variable so I thought I'd first replace the backslashes in that string by another symbol, then send through url, and then replace them back to backslashes in the PHP file that handles it. Though would there be a better way to send such strings through url? Because when I try a script such as: $tmp_name = preg_replace("\", ".-.", $_FILES['uploadfile']['tmp_name']); It turns out into a php error as \ is also used as delimiter.. Could anyone help me out on this? Thanks in advanced! Btw, if I'd be able to send a full array through url, this whole problem would be solved, but I don't think it's possible?

    Read the article

  • Why does my program crash when given negative values?

    - by Wayfarer
    Alright, I am very confused, so I hope you friends can help me out. I'm working on a project using Cocos2D, the most recent version (.99 RC 1). I make some player objects and some buttons to change the object's life. But the weird thing is, the code crashes when I try to change their life by -5. Or any negative value for that matter, besides -1. NSMutableArray *lifeButtons = [[NSMutableArray alloc] init]; CCTexture2D *buttonTexture = [[CCTextureCache sharedTextureCache] addImage:@"Button.png"]; LifeChangeButtons *button = nil; //top left button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(50 , size.height - 30); [button buttonText:-5]; [lifeButtons addObject:button]; //top right button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(size.width - 50 , size.height - 30); [button buttonText:1]; [lifeButtons addObject:button]; //bottom left button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(50 , 30); [button buttonText:5]; [lifeButtons addObject:button]; //bottom right button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(size.width - 50 , 30); [button buttonText:-1]; [lifeButtons addObject:button]; for (LifeChangeButtons *theButton in lifeButtons) { [self addChild:theButton]; } This is the code that makes the buttons. It simply makes 4 buttons, puts them in each corner of the screen (size is the screen) and adds their life change ability, 1,-1,5, or -5. It adds them to the array and then goes through the array at the end and adds all of them to the screen. This works fine. Here is my code for the button class: (header file) // // LifeChangeButtons.h // Coco2dTest2 // // Created by Ethan Mick on 3/14/10. // Copyright 2010 Wayfarer. All rights reserved. // #import "cocos2d.h" @interface LifeChangeButtons : CCSprite <CCTargetedTouchDelegate> { NSNumber *lifeChange; } @property (nonatomic, readonly) CGRect rect; @property (nonatomic, retain) NSNumber *lifeChange; + (id)lifeButton:(CCTexture2D *)texture; - (void)buttonText:(int)number; @end Implementation file: // // LifeChangeButtons.m // Coco2dTest2 // // Created by Ethan Mick on 3/14/10. // Copyright 2010 Wayfarer. All rights reserved. // #import "LifeChangeButtons.h" #import "cocos2d.h" #import "CustomCCNode.h" @implementation LifeChangeButtons @synthesize lifeChange; //Create the button +(id)lifeButton:(CCTexture2D *)texture { return [[[self alloc] initWithTexture:texture] autorelease]; } - (id)initWithTexture:(CCTexture2D *)atexture { if ((self = [super initWithTexture:atexture])) { //NSLog(@"wtf"); } return self; } //Set the text on the button - (void)buttonText:(int)number { lifeChange = [NSNumber numberWithInt:number]; NSString *text = [[NSString alloc] initWithFormat:@"%d", number]; CCLabel *label = [CCLabel labelWithString:text fontName:@"Times New Roman" fontSize:20]; label.position = CGPointMake(35, 20); [self addChild:label]; } - (CGRect)rect { CGSize s = [self.texture contentSize]; return CGRectMake(-s.width / 2, -s.height / 2, s.width, s.height); } - (BOOL)containsTouchLocation:(UITouch *)touch { return CGRectContainsPoint(self.rect, [self convertTouchToNodeSpaceAR:touch]); } - (void)onEnter { [[CCTouchDispatcher sharedDispatcher] addTargetedDelegate:self priority:0 swallowsTouches:YES]; [super onEnter]; } - (void)onExit { [[CCTouchDispatcher sharedDispatcher] removeDelegate:self]; [super onExit]; } - (BOOL)ccTouchBegan:(UITouch *)touch withEvent:(UIEvent *)event { CGPoint touchPoint = [touch locationInView:[touch view]]; touchPoint = [[CCDirector sharedDirector] convertToGL:touchPoint]; if ( ![self containsTouchLocation:touch] ) return NO; NSLog(@"Button touch event was called returning yes. "); //this is where we change the life to each selected player NSLog(@"Test1"); NSMutableArray *tempArray = [[[UIApplication sharedApplication] delegate] selectedPlayerObjects]; NSLog(@"Test2"); for (CustomCCNode *aPlayer in tempArray) { NSLog(@"we change the life by %d.", [lifeChange intValue]); [aPlayer changeLife:[lifeChange intValue]]; } NSLog(@"Test3"); return YES; } - (void)ccTouchMoved:(UITouch *)touch withEvent:(UIEvent *)event { CGPoint touchPoint = [touch locationInView:[touch view]]; touchPoint = [[CCDirector sharedDirector] convertToGL:touchPoint]; NSLog(@"You moved in a button!"); } - (void)ccTouchEnded:(UITouch *)touch withEvent:(UIEvent *)event { NSLog(@"You touched up in a button"); } @end Now, This function: - (BOOL)ccTouchBegan:(UITouch *)touch withEvent:(UIEvent *)event Is where all the shit goes down. It works for all of the buttons except the -5 one. And then, it gets to: NSLog(@"we change the life by %d.", [lifeChange integerValue]); And it crashes at that statement. It only crashes when given anything less than -1. -1 works, but nothing smaller does. Here is the code in the CustomCCNode Class, "changeLife" that is being called. - (void)changeLife:(int)lifeChange { NSLog(@"change life in Custom Class was called"); NSLog(@"wtf is lifechange: %d", lifeChange); life += lifeChange; lifeString = [[NSString alloc] initWithFormat:@"%d",life]; [text setString:lifeString]; } Straight forward, but when the NSnumber is -5, it doesn't even get called, it crashes at the NSlog statement. So... what's up with that?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Powershell GUI: Adding multiple instances of .tooltipseperate to menu

    - by obious
    So, I'm having a problem whereby for some reason I can only add one instance of a .tooltipseperator to a drop down menu. E.g. I have to create a new .tooltipseperator if I want to add another to a different menu list. I have this: $seperator = new-object System.Windows.Forms.Toolstripseparator $seperator1 = new-object System.Windows.Forms.Toolstripseparator which correlates to this: [Void]$packages_menu_bar.DropDownItems.Add($seperator1) [Void]$packages_menu_bar.DropDownItems.Add($Remove_from_AD) [Void]$process.DropDownItems.Add($Kill_process) [Void]$process.DropDownItems.Add($seperator) My question is this: how can I add the same instance on a .tooltipseperater to different menu items? Some sort of array? Thanks

    Read the article

  • Interpretation of Greek characters by FOP

    - by Geek
    Hi, Can you please help me interpret the Greek Characters with HTML display as HTML= & #8062; and Hex value 01F7E Details of these characters can be found on the below URL http://www.isthisthingon.org/unicode/index.php?page=01&subpage=F&hilite=01F7E When I run this character in Apache FOP, they give me an ArrayIndexOut of Bounds Exception Caused by: java.lang.ArrayIndexOutOfBoundsException: -1 at org.apache.fop.text.linebreak.LineBreakUtils.getLineBreakPairProperty(LineBreakUtils.java:668) at org.apache.fop.text.linebreak.LineBreakStatus.nextChar(LineBreakStatus.java:117) When I looked into the FOP Code, I was unable to understand the need for lineBreakProperties[][] Array in LineBreakUtils.java. I also noticed that FOP fails for all the Greek characters mentioned on the above page which are non-displayable with the similar error. What are these special characters ? Why is their no display for these characters are these Line Breaks or TAB’s ? Has anyone solved a similar issue with FOP ?

    Read the article

  • [OpenGL] I'm having an issue to use GLshort for representing Vertex, and Normal.

    - by Xylopia
    As my project gets close to optimization stage, I notice that reducing Vertex Metadata could vastly improve the performance of 3D rendering. Eventually, I've dearly searched around and have found following advices from stackoverflow. Using GL_SHORT instead of GL_FLOAT in an OpenGL ES vertex array How do you represent a normal or texture coordinate using GLshorts? Advice on speeding up OpenGL ES 1.1 on the iPhone Simple experiments show that switching from "FLOAT" to "SHORT" for vertex and normal isn't tough, but what troubles me is when you're to scale back verticies to their original size (with glScalef), normals are multiplied by the reciprocal of the scale. Then how do you use "short" for both vertex and normal at the same time? I've been trying this and that for about a full day, but I could only go for "float vertex w/ byte normal" or "short vertex w/ float normal" so far. Your help would be truly appreciated.

    Read the article

  • Routing configuration in cakephp

    - by ShiVik
    Hello all I am trying to implement routing in cakephp. I want the urls to mapped like this... www.example.com/nodes/main - www.example.com/main www.example.com/nodes/about - www.example.com/about So for this I wrote in my config/routes.php file.. Router::connect('/:action', array('controller' => 'nodes')); Now, I got the thing going but when I click on the links, the url in browser appears like www.example.com/nodes/main www.example.com/nodes/about Is there some way where I can get the urls to appear the way they are routed? Setting in .htaccess or httpd.conf would be easy - but I don't have access to that. Regards Vikram

    Read the article

  • Help needed with Javascript Variable Scope / OOP and Call Back Functions

    - by gargantaun
    I think this issue goes beyond typical variable scope and closure stuff, or maybe I'm an idiot. Here goes anyway... I'm creating a bunch of objects on the fly in a jQuery plugin. The object look something like this function WedgePath(canvas){ this.targetCanvas = canvas; this.label; this.logLabel = function(){ console.log(this.label) } } the jQuery plugin looks something like this (function($) { $.fn.myPlugin = function() { return $(this).each(function() { // Create Wedge Objects for(var i = 1; i <= 30; i++){ var newWedge = new WedgePath(canvas); newWedge.label = "my_wedge_"+i; globalFunction(i, newWedge]); } }); } })(jQuery); So... the plugin creates a bunch of wedgeObjects, then calls 'globalFunction' for each one, passing in the latest WedgePath instance. Global function looks like this. function globalFunction(indicator_id, pWedge){ var targetWedge = pWedge; targetWedge.logLabel(); } What happens next is that the console logs each wedges label correctly. However, I need a bit more complexity inside globalFunction. So it actually looks like this... function globalFunction(indicator_id, pWedge){ var targetWedge = pWedge; someSql = "SELECT * FROM myTable WHERE id = ?"; dbInterface.executeSql(someSql, [indicator_id], function(transaction, result){ targetWedge.logLabel(); }) } There's a lot going on here so i'll explain. I'm using client side database storage (WebSQL i call it). 'dbInterface' an instance of a simple javascript object I created which handles the basics of interacting with a client side database [shown at the end of this question]. the executeSql method takes up to 4 arguments The SQL String an optional arguments array an optional onSuccess handler an optional onError handler (not used in this example) What I need to happen is: When the WebSQL query has completed, it takes some of that data and manipulates some attribute of a particular wedge. But, when I call 'logLabel' on an instance of WedgePath inside the onSuccess handler, I get the label of the very last instance of WedgePath that was created way back in the plugin code. Now I suspect that the problem lies in the var newWedge = new WedgePath(canvas); line. So I tried pushing each newWedge into an array, which I thought would prevent that line from replacing or overwriting the WedgePath instance at every iteration... wedgeArray = []; // Inside the plugin... for(var i = 1; i <= 30; i++){ var newWedge = new WedgePath(canvas); newWedge.label = "my_wedge_"+i; wedgeArray.push(newWedge); } for(var i = 0; i < wedgeArray.length; i++){ wedgeArray[i].logLabel() } But again, I get the last instance of WedgePath to be created. This is driving me nuts. I apologise for the length of the question but I wanted to be as clear as possible. END ============================================================== Also, here's the code for dbInterface object should it be relevant. function DatabaseInterface(db){ var DB = db; this.sql = function(sql, arr, pSuccessHandler, pErrorHandler){ successHandler = (pSuccessHandler) ? pSuccessHandler : this.defaultSuccessHandler; errorHandler = (pErrorHandler) ? pErrorHandler : this.defaultErrorHandler; DB.transaction(function(tx){ if(!arr || arr.length == 0){ tx.executeSql(sql, [], successHandler, errorHandler); }else{ tx.executeSql(sql,arr, successHandler, errorHandler) } }); } // ---------------------------------------------------------------- // A Default Error Handler // ---------------------------------------------------------------- this.defaultErrorHandler = function(transaction, error){ // error.message is a human-readable string. // error.code is a numeric error code console.log('WebSQL Error: '+error.message+' (Code '+error.code+')'); // Handle errors here var we_think_this_error_is_fatal = true; if (we_think_this_error_is_fatal) return true; return false; } // ---------------------------------------------------------------- // A Default Success Handler // This doesn't do anything except log a success message // ---------------------------------------------------------------- this.defaultSuccessHandler = function(transaction, results) { console.log("WebSQL Success. Default success handler. No action taken."); } }

    Read the article

  • Make object available within php functions without passing them or making them global

    - by Matt
    Hey all, This requirement is just for simplicity for developers and beautiful code. I'm building a template system and I really would just like an object variable to simply be there in all functions. Here's some code: Librarian.php: $class = "slideshow"; $function = "basic"; $args = array(...); $librarian = $this; // I WOULD LIKE THIS TO BE PRESENT IN CALLED FUNCTION ... return call_user_func($class.'::'.$function, $args); ... Slideshow.php: public static function basic($args) { echo $librarian; // "Librarian Object" } Thanks! Matt Mueller

    Read the article

  • How to draw/manage a hexagon grid?

    - by W.N.
    I've read this article: generating/creating hexagon grid in C . But look like both the author and answerer have already abandoned it. v(hexagonSide - hexagonWidth * hexagonWidth): What's hexagonSide and hexagonWidth? Isn't it will < 0 (so square root can't be calculated). And, can I put a hexagon into a rectangle? I need to create a grid like this: One more thing, how can I arrange my array to store data, as well as get which cells are next to one cell? I have never been taught about hexagon, so I know nothing about it, but I can easily learn new thing, so if you can explain or give me a clue, I may do it myself.

    Read the article

  • Binding Many-to-Many Core Data relationships in UI

    - by Kevin
    Basically my setup is this. I have a many-to-many relationship in Core Data where a student entity can have multiple courses, and a course entity can have multiple students. My problem is in trying to figure out how to bind this relationship to the UI in Interface Builder. I want to be able to add courses to a course array controller, then have those courses displayed in a popup menu in a NSTableView in the Edit Student window where you can add courses to a student. This is what I have so far: http://vimeo.com/10671726 It's probably easier to understand from the video. Thanks

    Read the article

  • CommunicationException in WCF

    - by user343159
    Hi I have a problem with a WCF Service I've just created. This was working yesterday but for some reason it's just stopped working. One of my WCF methods returns an array of an Entity Framework entity, like this: public BranchContactDetail[] GetClosestBranches(string postcode, int howManyBranches) { GeoLocation geoLocation = GetLocationFromPostcode(postcode); Location location = new Location(geoLocation.Latitude, geoLocation.Longitude); using (BranchDirectoryEntities entities = new BranchDirectoryEntities()) { var branchesInOrder = entities.BranchContactDetails .Where(b => b.latitude.HasValue && b.longitude.HasValue ) .OrderBy(b => location.DistanceFrom(b.latitude, b.longitude)) .Take(howManyBranches) .ToArray(); return branchesInOrder; } } ...and, as I say, this was working fine yesterday. Now I'm getting a "The underlying connection was closed: The connection was closed unexpectedly." I've hunted all over the web but no-one seems to know the answer. Anyone shed any light on this issue? Regards, Mark

    Read the article

  • Defining a dd/mm/yyyy field within an abstract table model

    - by Simon Andi
    I have defined an abstract table model but one of the columns should house date values as dd/mm/yyyy format not sure how to do this. I have a external global file and have hard coded the dates as dd/mm/yyyy. How can I define this column within my abstract table model so that to only allow only dates having dd/mm/yyyy format. public class OptraderGlobalParameters { public static boolean DEBUG = true; //Set DEBUG = true for Debugging /*=========================*/ /*Table Array For Dividends*/ /*=========================*/ public static String[] columnNames = {"Date", "Dividend", "Actual", "Yield (%)" }; public static Object[][] data = { {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, }; }

    Read the article

  • Custom validation works in development but not in unit test

    - by Geolev
    I want to validate that at least one of two columns have a value in my model. I found somewhere on the web that I could create a custom validator as follows: # Check for the presence of one or another field: # :validates_presence_of_at_least_one_field :last_name, :company_name - would require either last_name or company_name to be filled in # also works with arrays # :validates_presence_of_at_least_one_field :email, [:name, :address, :city, :state] - would require email or a mailing type address module ActiveRecord module Validations module ClassMethods def validates_presence_of_at_least_one_field(*attr_names) msg = attr_names.collect {|a| a.is_a?(Array) ? " ( #{a.join(", ")} ) " : a.to_s}.join(", ") + "can't all be blank. At least one field must be filled in." configuration = { :on => :save, :message => msg } configuration.update(attr_names.extract_options!) send(validation_method(configuration[:on]), configuration) do |record| found = false attr_names.each do |a| a = [a] unless a.is_a?(Array) found = true a.each do |attr| value = record.respond_to?(attr.to_s) ? record.send(attr.to_s) : record[attr.to_s] found = !value.blank? end break if found end record.errors.add_to_base(configuration[:message]) unless found end end end end end I put this in a file called lib/acs_validator.rb in my project and added "require 'acs_validator'" to my environment.rb. This does exactly what I want. It works perfectly when I manually test it in the development environment but when I write a unit test it breaks my test environment. This is my unit test: require 'test_helper' class CustomerTest < ActiveSupport::TestCase # Replace this with your real tests. test "the truth" do assert true end test "customer not valid" do puts "customer not valid" customer = Customer.new assert !customer.valid? assert customer.errors.invalid?(:subdomain) assert_equal "Company Name and Last Name can't both be blank.", customer.errors.on(:contact_lname) end end This is my model: class Customer < ActiveRecord::Base validates_presence_of :subdomain validates_presence_of_at_least_one_field :customer_company_name, :contact_lname, :message => "Company Name and Last Name can't both be blank." has_one :service_plan end When I run the unit test, I get the following error: DEPRECATION WARNING: Rake tasks in vendor/plugins/admin_data/tasks, vendor/plugins/admin_data/tasks, and vendor/plugins/admin_data/tasks are deprecated. Use lib/tasks instead. (called from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/tasks/rails.rb:10) Couldn't drop acs_test : #<ActiveRecord::StatementInvalid: PGError: ERROR: database "acs_test" is being accessed by other users DETAIL: There are 1 other session(s) using the database. : DROP DATABASE IF EXISTS "acs_test"> acs_test already exists NOTICE: CREATE TABLE will create implicit sequence "customers_id_seq" for serial column "customers.id" NOTICE: CREATE TABLE / PRIMARY KEY will create implicit index "customers_pkey" for table "customers" NOTICE: CREATE TABLE will create implicit sequence "service_plans_id_seq" for serial column "service_plans.id" NOTICE: CREATE TABLE / PRIMARY KEY will create implicit index "service_plans_pkey" for table "service_plans" /usr/bin/ruby1.8 -I"lib:test" "/usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb" "test/unit/customer_test.rb" "test/unit/service_plan_test.rb" "test/unit/helpers/dashboard_helper_test.rb" "test/unit/helpers/customers_helper_test.rb" "test/unit/helpers/service_plans_helper_test.rb" /usr/lib/ruby/gems/1.8/gems/activerecord-2.3.8/lib/active_record/base.rb:1994:in `method_missing_without_paginate': undefined method `validates_presence_of_at_least_one_field' for #<Class:0xb7076bd0> (NoMethodError) from /usr/lib/ruby/gems/1.8/gems/will_paginate-2.3.12/lib/will_paginate/finder.rb:170:in `method_missing' from /home/george/projects/advancedcomfortcs/app/models/customer.rb:3 from /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `gem_original_require' from /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `require' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:158:in `require' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:265:in `require_or_load' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:224:in `depend_on' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:136:in `require_dependency' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:414:in `load_application_classes' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:413:in `each' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:413:in `load_application_classes' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:411:in `each' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:411:in `load_application_classes' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:197:in `process' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:113:in `send' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:113:in `run' from /home/george/projects/advancedcomfortcs/config/environment.rb:9 from ./test/test_helper.rb:2:in `require' from ./test/test_helper.rb:2 from ./test/unit/customer_test.rb:1:in `require' from ./test/unit/customer_test.rb:1 from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5:in `load' from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5 from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5:in `each' from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5 rake aborted! Command failed with status (1): [/usr/bin/ruby1.8 -I"lib:test" "/usr/lib/ru...] (See full trace by running task with --trace) It seems to have stepped on will_paginate somehow. Does anyone have any suggestions? Is there another way to do the validation I'm attempting to do? Thanks, George

    Read the article

  • Memory leak with preg_replace

    - by Silvio Donnini
    I'm using the preg_replace function to replace accents in a string, I'm working with UTF-8. I have incurred in what seems to be a memory leak, but I can't isolate the root cause, my code is rather simple: preg_replace( array_keys($aToNoAccents), array_values($aToNoAccents), $sText ); where $aToNoAccents is an associative array with entries like '~[A]~u' => 'A', '~[C]~u' => 'C',. My script prints this error for the above line: Fatal error: Allowed memory size of 1073741824 bytes exhausted (tried to allocate 3039 bytes) Obviously it's not a matter of increasing the allowed memory for PHP, (a 1Gb footprint is way off the scale of my application). Also, that line is executed thousands of times without problems but, just for some cases which are difficult to reproduce, it yields the error. Is anyone aware of memory problems with preg_replace and UTF-8 strings? Am I to use special care in passing actual parameters to such function? I'm using PHP 5.2.6-3 with Suhosin-Patch thanks Silvio

    Read the article

  • codeigniter: how to redirect after login to current controller (php_self in regular php)

    - by krike
    Well it's not really a problem but I check if the user exist and log them in and redirect to site/members_area, but I don't want to send the user to a specific page but i want to reload the current controller. So if I login in index/home I would like to be redirected at index/home, how should I proceed? in regular php I would put in the action to redirect to current page <?php echo $_SERVER['PHP_SELF']; ?> This is the code in the framework function validate_credentials() { $this->load->model('membership_model'); $query = $this->membership_model->validate(); if($query) // if the user's credentials validated... { $data = array( 'username' => $this->input->post('username'), 'is_logged_in' => true ); $this->session->set_userdata($data); redirect('site/members_area'); //<-- this line here should be dynamic } else // incorrect username or password { $this->index(); } }

    Read the article

  • Rendering a variable with erb.

    - by TZer0
    I've got the following problem: I have rhtml (html minced together with ruby inside <% % and <%= % tags) stored in a database which I want to render. The information is acquired through a query. I need to be able to evaluate the information I get from the database as though as it was normal content inside the .erb-file. What I currently have: <% @mymods.each do |mod| %> <%= render_text(mod["html"])%> <% end %> Where mod["html"] is the variable containing the rhtml-code and @mymods an array of objects from the query. I have currently no idea what function I should use (render_text does, of course, not work). Help is greatly appreciated. /TZer0

    Read the article

  • friendship and operator overloading help

    - by sil3nt
    hello there, I have the following class #ifndef Container_H #define Container_H #include <iostream> using namespace std; class Container{ friend bool operator==(const Container &rhs,const Container &lhs); public: void display(ostream & out) const; private: int sizeC; // size of Container int capacityC; // capacity of dynamic array int * elements; // pntr to dynamic array }; ostream & operator<< (ostream & out, const Container & aCont); #endif and this source file #include "container.h" /*----------------------------********************************************* note: to test whether capacityC and sizeC are equal, must i add 1 to sizeC? seeing as sizeC starts off with 0?? */ Container::Container(int maxCapacity){ capacityC = maxCapacity; elements = new int [capacityC]; sizeC = 0; } Container::~Container(){ delete [] elements; } Container::Container(const Container & origCont){ //copy constructor? int i = 0; for (i = 0; i<capacityC; i++){ //capacity to be used here? (*this).elements[i] = origCont.elements[i]; } } bool Container::empty() const{ if (sizeC == 0){ return true; }else{ return false; } } void Container::insert(int item, int index){ if ( sizeC == capacityC ){ cout << "\n*** Next: Bye!\n"; return; // ? have return here? } if ( (index >= 0) && (index <= capacityC) ){ elements[index] = item; sizeC++; } if ( (index < 0) && (index > capacityC) ){ cout<<"*** Illegal location to insert--"<< index << ". Container unchanged. ***\n"; }//error here not valid? according to original a3? have i implemented wrong? } void Container::erase(int index){ if ( (index >= 0) && (index <= capacityC) ){ //correct here? legal location? int i = 0; while (i<capacityC){ //correct? elements[index] = elements[index+1]; //check if index increases here. i++; } sizeC=sizeC-1; //correct? updated sizeC? }else{ cout<<"*** Illegal location to be removed--"<< index << ". Container unchanged. ***\n"; } } int Container::size()const{ return sizeC; //correct? } /* bool Container::operator==(const Container &rhs,const Container &lhs){ int equal = 0, i = 0; for (i = 0; i < capacityC ; i++){ if ( rhs.elements[i] == lhs.elements[i] ){ equal++; } } if (equal == sizeC){ return true; }else{ return false; } } ostream & operator<< (ostream & out, const Container & aCont){ int i = 0; for (i = 0; i<sizeC; i++){ out<< aCont.elements[i] << " " << endl; } } */ I dont have the other functions in the header file (just a quikie). Anyways, the last two functions in "/* */" I cant get to work, what am I doing wrong here? the first function is to see whether the two arrays are equal to one another

    Read the article

  • Memory in Eclipse

    - by user247866
    I'm getting the java.lang.OutOfMemoryError exception in Eclipse. I know that Eclipse by default uses heap size of 256M. I'm trying to increase it but nothing happens. For example: eclipse -vmargs -Xmx16g -XX:PermSize=2g -XX:MaxPermSize=2g I also tried different settings, using only the -Xmx option, using different cases of g, G, m, M, different memory sizes, but nothing helps. Does not matter which params I specify, the heap exception is thrown at the same time, so I assume there's something I'm doing wrong that Eclipse ignores the -Xmx parameter. I'm using a 32GB RAM machine and trying to execute something very simple such as: double[][] a = new double[15000][15000]; It only works when I reduce the array size to something around 10000 on 10000. I'm working on Linux and using the top command I can see how much memory the Java process is consuming; it's less than 2%. Thanks!

    Read the article

< Previous Page | 480 481 482 483 484 485 486 487 488 489 490 491  | Next Page >