Search Results

Search found 16061 results on 643 pages for 'array indexing'.

Page 485/643 | < Previous Page | 481 482 483 484 485 486 487 488 489 490 491 492  | Next Page >

  • http_post_data basic authentication?

    - by kristian nissen
    I have a remote service that I need to access, according to the documentation it's restricted using basic authentication and all requests have to be posted (HTTP POST). The documentation contains this code example - VB script: Private Function SendRequest(ByVal Url, ByVal Username, ByVal Password, ByVal Request) Dim XmlHttp Set XmlHttp = CreateObject("MSXML2.XmlHttp") XmlHttp.Open "POST", Url, False, Username, Password XmlHttp.SetRequestHeader "Content-Type", "text/xml" XmlHttp.Send Request Set SendRequest = XmlHttp End Function how can I accomplish this in PHP? When I post data to the remote server it replies: 401 Unauthorized Access which is fine because I'm not posting my user/pass just the data. Bu when I add my user/pass as it's describe here: http://dk.php.net/manual/en/http.request.options.php like this: $res = http_post_data('https://example.com', $data, array( 'Content-Type: "text/xml"', 'httpauth' => base64_encode('user:pass'), 'httpauthtype' => HTTP_AUTH_BASIC ) ); the protocol is https - I get a runtime error in return (it's a .Net service). I have tried it without the base64_encode but with the same result.

    Read the article

  • Refreshing a UITableView

    - by MihaiD
    I have a UITableView subclass and a UITableViewCell sublass that I'm using for cells. I'm bulding all my cells in advance and store them in an array from where I use them in cellForRowAtIndexPath. Aside from this I have a thread that loads some images in each cell, in the background. The problem is that the cells don't get refreshed as fast as the images are loaded. For example, if I don't scroll my table view, the first cells only get refreshed when all cells have been modified and the thread has exited. Any ideas on how I can effectively refresh my tableview/cell?

    Read the article

  • A controller problem using a base CRUD model

    - by rkj
    In CodeIgniter I'm using a base CRUD My_model, but I have this small problem in my browse-controller.. My $data['posts'] gets all posts from the table called "posts". Though the author in that table is just a user_id, which is why I need to use my "getusername" function (gets the username from a ID - the ID) to grab the username from the users table. Though I don't know how to proceed from here, since it is not just one post. Therefore I need the username to either be a part of the $data['posts'] array or some other smart solution. Anyone who can help me out? function index() { $this->load->model('browse_model'); $data['posts'] = $this->browse_model->get_all(); $data['user'] = $this->browse_model->getusername(XX); $this->load->view('header'); $this->load->view('browse/index', $data); $this->load->view('footer'); }

    Read the article

  • Helper functions & prototype methods to replace heavy frameworks?

    - by Rob
    All frameworks aside, what are some of the common helper functions/prototype methods you use on a daily basis? Please note I am not arguing against frameworks. I've simply found that the majority of what I do on a daily basis can, most often, be done with a few dozen Array, String and Element.prototype methods. With the addition of a few helper functions like $ (getElementsById) and $$$ (getElementsByClass), I am able to satisfy some of the core benefits, however basic, of a much heavier framework. If you were to collect a small library of basic methods and functions to replace the core functionality of some of the popular frameworks, what would they be?

    Read the article

  • Defining a dd/mm/yyyy field within an abstract table model

    - by Simon Andi
    I have defined an abstract table model but one of the columns should house date values as dd/mm/yyyy format not sure how to do this. I have a external global file and have hard coded the dates as dd/mm/yyyy. How can I define this column within my abstract table model so that to only allow only dates having dd/mm/yyyy format. public class OptraderGlobalParameters { public static boolean DEBUG = true; //Set DEBUG = true for Debugging /*=========================*/ /*Table Array For Dividends*/ /*=========================*/ public static String[] columnNames = {"Date", "Dividend", "Actual", "Yield (%)" }; public static Object[][] data = { {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, }; }

    Read the article

  • How do I put my return data from an asmx into JSON? I'm having trouble finding decent literature

    - by jphenow
    I want to return an array of javascript objects from my asp.net asmx file. ie. variable = [ { *value1*: 'value1', *value2*: 'value2', ..., }, { . . } ]; I seem have been having trouble reaching this. I'd put this into code but I've been hacking away at it so much it'd probably do more harm than good in having this answered. Basically I am using a web service to find names as people type the name. I'd use a regular text file or something but its a huge database that's always changing - and don't worry I've indexed the names so searching can be a little snappier - but I would really prefer to stick with this method and just figure out how to get usable JSON back to javascript. I've seen a few that sort of attempt to describe how one would approach this but I honestly think microsofts articles are damn near unreadable. Thanks in advance for assistance.

    Read the article

  • Grouping search results with thinking_sphinx plugin for rails

    - by Shagymoe
    I can use the following to group results, but it only returns one result per group. @results = Model.search params[:search_query], :group_by => 'created_at', :group_function => :day, :page => params[:page], :per_page => 50 So, if I display the results by day, I only get one result per day. <% @results.each_with_groupby do |result, group| %> <div class="group"><%= group %></div> <ul class="result"> <li><%= result.name %></li> </ul> <% end %> Do I have to parse the @results array and group them by date manually or am I missing something? Here is the line from the sphinx docs: http://sphinxsearch.com/docs/current.html#clustering "The final search result set then contains one best match per group."

    Read the article

  • rails update whole index of a model with one click

    - by mattherick
    hello! i have a store model, this will handle my leaflet and my shoppingcart for my shop. now i d´like to show all items added from an user to his leaflet in the index of store. in the store an user can change the quantity of the choosen items. and now i want to save that the changes of the different quantities in the database with one click on a button "update store". so how could i implement an update over the whole index with one click? i´d like to do this with ajax and most dynamically. somebody has an idea? i render all items into a form so far, but now i have the problem, when i submit this form only the last quantity and item id are included in the params. further i pushed every quantity into an array and i want to submit this also as a param. but i could not. please give me some tips, will be very fine :) mattherick

    Read the article

  • How to get nearby POIs

    - by balexandre
    I have a database with Points of Interest that all have an address. I want to know what is the method/name/call to get all nearby POIs from a given position. I understand that I need to convert all my addresses to LAT / LON coordinates at least, but my question is: for a given LAT / LONG how do I get from the database/array what POIs are nearby by distance, for example: You are here 0,0 nearest POIs in a 2km radius are: POI A (at 1.1 Km) POI C (at 1.3 Km) POI F (at 1.9 Km) I have no idea what should I look into to get what I want :-( Any help is greatly appreciated. Thank you

    Read the article

  • Which are your favorite programming language gadgets?

    - by FerranB
    There are some gadgets/features for programming languages that I like a lot because they save a lot of coding or simply because they are magical or nice. Some of my favorites are: C++ increment/decrement operator: my_array[++c]; C++ assign and sum or substract (...): a += b C# yield return: yield return 1; C# foreach: foreach (MyClass x in MyCollection) PLSQL for loop: for c in (select col1, col2 from mytable) PLSQL pipe row: for i in 1..x loop pipe row(i); end loop; Python Array access operator: a[:1] PLSQL ref cursors. Which are yours?

    Read the article

  • Zend Regex Route > Track the api version

    - by dskanth
    Hi, i am building a web service with zend and i am using modules to separate my api versions. Ex: "applications/modules/v1/controllers", "applications/modules/v2/controllers" have different set of actions and functionality. I have made "v1" as the default module in "application.ini" file: resources.modules = "" resources.frontController.defaultModule = "v1" resources.frontController.moduleDirectory = APPLICATION_PATH "/modules" resources.frontController.moduleControllerDirectoryName = "controllers" I have written the following in my bootstrap file: $router = $front->getRouter(); $r1 = new Zend_Controller_Router_Route_Regex('api/v1/tags.xml', array('module' => 'v1', 'controller' => 'tags', 'action' => 'index')); $router->addRoute('route1', $r1); Suppose, if this is my url: http://localhost/api/v1/tags.xml then it belongs to version 1 (v1). But i dont want to write many routes like this one, so i want to know how can i track the version from the regex url and dynamically determine the api version to be used (1 or 2).

    Read the article

  • Implementing a configurable factory

    - by Decko
    I'm having difficulties finding out how to implement a 'configurable' behavior in a factory class in PHP. I've got at class, which takes another class as an argument in its constructor. The argument class could take a number of arguments in its constructor. An instance of my main class could look something like this $instance = new MyClass(new OtherClass(20, true)); $instance2 = new MyClass(new DifferentClass('test')); This is rather clumsy and has a number of problems and therefore I would like to move this into a factory class. The problem is that this factory somehow needs to know how to instantiate the argument class, as this class can have any number of arguments in the constructor. Preferably I would like to be able to do something like this $instance = Factory::build('OtherClass'); $instance2 = Factory::build('DifferentClass'); And let the factory retrieve the arguments from a configuration array or similar. Is there a proper solution to this problem?

    Read the article

  • Routing configuration in cakephp

    - by ShiVik
    Hello all I am trying to implement routing in cakephp. I want the urls to mapped like this... www.example.com/nodes/main - www.example.com/main www.example.com/nodes/about - www.example.com/about So for this I wrote in my config/routes.php file.. Router::connect('/:action', array('controller' => 'nodes')); Now, I got the thing going but when I click on the links, the url in browser appears like www.example.com/nodes/main www.example.com/nodes/about Is there some way where I can get the urls to appear the way they are routed? Setting in .htaccess or httpd.conf would be easy - but I don't have access to that. Regards Vikram

    Read the article

  • Rendering a variable with erb.

    - by TZer0
    I've got the following problem: I have rhtml (html minced together with ruby inside <% % and <%= % tags) stored in a database which I want to render. The information is acquired through a query. I need to be able to evaluate the information I get from the database as though as it was normal content inside the .erb-file. What I currently have: <% @mymods.each do |mod| %> <%= render_text(mod["html"])%> <% end %> Where mod["html"] is the variable containing the rhtml-code and @mymods an array of objects from the query. I have currently no idea what function I should use (render_text does, of course, not work). Help is greatly appreciated. /TZer0

    Read the article

  • Rails route, show all elements on the same page

    - by Igor Oliveira Antonio
    I need to show all my elements on the same page. In routes: namespace :nourishment do resources :diets do resources :nourishment_meals, :controller => 'meals' get 'nourishment_meals/show_all_meals' => 'meals#show_all_meals', as: "show_all_meals" end end which will generate: nourishment_diet_nourishment_meals_path GET /nourishment/diets/:diet_id/nourishment_meals(.:format) nourishment/meals#index POST /nourishment/diets/:diet_id/nourishment_meals(.:format) nourishment/meals#create new_nourishment_diet_nourishment_meal_path GET /nourishment/diets/:diet_id/nourishment_meals/new(.:format) nourishment/meals#new edit_nourishment_diet_nourishment_meal_path GET /nourishment/diets/:diet_id/nourishment_meals/:id/edit(.:format) nourishment/meals#edit nourishment_diet_nourishment_meal_path GET /nourishment/diets/:diet_id/nourishment_meals/:id(.:format) nourishment/meals#show PATCH /nourishment/diets/:diet_id/nourishment_meals/:id(.:format) nourishment/meals#update PUT /nourishment/diets/:diet_id/nourishment_meals/:id(.:format) nourishment/meals#update DELETE /nourishment/diets/:diet_id/nourishment_meals/:id(.:format) nourishment/meals#destroy [**THIS**] nourishment_diet_show_all_meals_path GET /nourishment/diets/:diet_id/nourishment_meals/show_all_meals(.:format) nourishment/meals#show_all_meals The problem, when I do this: <%= link_to "Show all meals", nourishment_diet_show_all_meals_path, :class=>"button green" %> This error raise: Problem: Document(s) not found for class NourishmentMeal with id(s) show_all. Summary: When calling NourishmentMeal.find with an id or array of ids, each parameter must match a document Can someone help me?

    Read the article

  • Can an Excel VBA UDF called from the worksheet ever be passed an instance of any Excel VBA object mo

    - by jtolle
    I'm 99% sure that the answer is "no", but I'm wondering if someone who is 100% sure can say so. Consider a VBA UDF: Public Function f(x) End Function When you call this from the worksheet, 'x' will be a number, string, boolean, error, array, or object of type 'Range'. Can it ever be, say, an instance of 'Chart', 'ListObject', or any other Excel-VBA object model class? (The question arose from me moving to Excel 2007 and playing with Tables, and wondering if I could write UDFs that accept them as parameters instead of Ranges. The answer to that seems to be no, but then I realized I didn't know for sure in general.)

    Read the article

  • Drag and Drop to explorer causing invalid FORMATETC (DV_E_FORMATETC) error

    - by JustABill
    I'm trying to use this excellent example to implement dropping virtual files into Windows Explorer. However, I'm stymied by this error. Towards the bottom, inside void System.Runtime.InteropServices.ComTypes.IDataObject.GetData(ref System.Runtime.InteropServices.ComTypes.FORMATETC formatetc, out System.Runtime.InteropServices.ComTypes.STGMEDIUM medium) on the first call to ((System.Runtime.InteropServices.ComTypes.IDataObject)this).GetDataHere(ref formatetc, ref medium); I'm getting back a DV_E_FORMATETC error. As far as I can tell, all the elements of the FORMATETC struct that are being passed in are valid: cfFormat is "Shell IDList Array" (-16141), ptd is 0, dwAspect is DVASPECT_CONTENT, lindex is -1, and tymed is TYMED_HGLOBAL. I'm kind of confused how there'd be a problem anyway, since this was generated by explorer. I know very little about COM interaction, so any help would be greatly appreciated.

    Read the article

  • How do I include 2 tables in one LocalStorage item?

    - by Noor
    I've got a table that you can edit, and I've got a simple code saving that list when you're done with editing it. (the tables have the contenteditable on) The problem I've stumbled upon is that if I double click on enter, the table gets divided into two separate tables with the same ID. This causes the code I'm using to set the localStorage to only store one of the tables (I assume the first).. I've thought of different solutions and I wonder if someone could point out the pro's and con's (if the solutions even works that is). Make a loop that checks the page after tables and stores them into an array of localStorage-items.. I'd have to dynamically create a localStorage item for each table. Take the whole div that the tables are in, and store that in the localStorage, when a user revisits the page, the page checks after the items in storage and displays the whole divs. Any suggestions you have that can beat this :).. (but no cache, it has to be with the localStorage!) Thanks

    Read the article

  • Zend Framework PartialLoop - questions

    - by Ian Warner
    Hi Ok dealing with Partial Loops I want to do several things Perhaps pass in extra variables - seen it done like this echo $this-partialLoop('Loop.phtml', array('data' = $data, 'var1' = foo)); But this does not seem to work - I can not extra the data using $this-var $this-data-var or $data-var not sure how to access the data in the loop Sutotals for columns - need a way of resetting variables or passing in a default value - linked to the above I suppose ie $subtotal += rowTotal; In the view that calls the partial I would like to get access to the subtotal values generated so I can display these in another table below. Any help appreciated the docs on partialLoop seems incomplete. Ian

    Read the article

  • property not updating in object when page is posted

    - by Jared
    Hi I have set a property in a constructor like so function __construct() { $this->count = count(@$_SESSION['filearray']); //count how many files in array } and using it in condition statements if($this->count > 10) //then do something but it appears the count isn't being updated when I use another method of injecting values into this 'filearray' until I refresh the page. am I doing something wrong? I thought that my constructor would detect a change had been made in the session and whenever I call $this-count I would get the current count value but it seems to be 1 step behind until I refresh the page. If this is all vague I can include my form page that has all the method calls, but this is the jist of my question, why is my property not updating and how do I fix it :) TIA

    Read the article

  • Setting post tags in wordpress via XMLRPC API when submitting a post?

    - by aviv
    Hi, I am trying to use WordPress API via XMLRPC to submit new posts. But i can't set the post tags (nor the categories). echo "Adding $term to blog via XMLRPC ..."; $client = new IXR_Client("http://$blog.wordpress.com/xmlrpc.php"); $content = array('title'=>$term, 'description'=>"All about $term", 'category'=>'barvaz,moshe', 'tags'=>'tag1,tag2'); $client->query('metaWeblog.newPost', 0, $username, $password, $content, true); $rv = $client->getResponse(); print_r($rv); Any idea?

    Read the article

  • WordPress Problem with enqueing a script

    - by casben79
    I am trying to enqueue a script from the functions.php file for a custom theme. here is the code I am using: wp_enqueue_script('innerfade','correct/path/to/innerfade.js', array('jquery'), '', false); I also tried to hardcode from the the functions file like so: ?> <script type='text/javascript' src="correct/path/to/innerfade.js"></script> <?php and both are outputting the following: correct/path/to/innerfade.js'?ver=2.9.2 so It doesnt seem to be a wp_enqueue_script problem What I cannot seem to figure is where the hell is the comma after the .js is coming from, it is causing a dead link hence not loading the script, anyone have any ideas??

    Read the article

  • Make object available within php functions without passing them or making them global

    - by Matt
    Hey all, This requirement is just for simplicity for developers and beautiful code. I'm building a template system and I really would just like an object variable to simply be there in all functions. Here's some code: Librarian.php: $class = "slideshow"; $function = "basic"; $args = array(...); $librarian = $this; // I WOULD LIKE THIS TO BE PRESENT IN CALLED FUNCTION ... return call_user_func($class.'::'.$function, $args); ... Slideshow.php: public static function basic($args) { echo $librarian; // "Librarian Object" } Thanks! Matt Mueller

    Read the article

  • Curl automatically display the result?

    - by Emily
    I'm using php 5.3.2 and when i execute a curl it display the result directly without adding a print or echo function. Here is my code: <?php $pvars = array('query' => 'ice age', 'orderby' => 'popularity'); $timeout = 30; $myurl = "http://www.website.com"; $curl = curl_init(); curl_setopt($curl, CURLOPT_URL, $myurl); curl_setopt($curl, CURLOPT_TIMEOUT, $timeout); curl_setopt($curl, CURLOPT_POST, 1); curl_setopt($curl, CURLOPT_POSTFIELDS, $pvars); $xml = curl_exec($curl); curl_close ($curl); ?> What's wrong with my code and why it displays the result?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 481 482 483 484 485 486 487 488 489 490 491 492  | Next Page >