Search Results

Search found 35385 results on 1416 pages for '02 · java ee'.

Page 489/1416 | < Previous Page | 485 486 487 488 489 490 491 492 493 494 495 496  | Next Page >

  • Injection of an EJB into a web java class under JBoss 7.1.1

    - by Dobbo
    I am trying to build a website using JBoss 7.1.1 and RESTeasy. I have managed to constructed and deploy and EAR with a both a WAR and an EJB-JAR contained within: voyager-app.ear META-INF/MANIFEST.MF META-INF/application.xml META-INF/jboss-app.xml lib/voyager-lib.jar voyager-adm.war voyager-ejb.jar voyager-web.war So far things are very simple. voyager-adm.war & voyager-lib.jar are empty (just the manifest file) but I know that I'm going to have code for them shortly. There is just one Stateful EJB - HarbourMasterBean (with just a local interface) and a few Database Entity Beans in the EJB jar file: voyager-ejb.jar META-INF/MANIFEST.MF META-INF/persistence.xml com/nutrastat/voyager/db/HarbourMasterBean.class com/nutrastat/voyager/db/HarbourMasterLocal.class com/nutrastat/voyager/db/PortEntity.class com/nutrastat/voyager/db/ShipEntity.class As far as I can tell the EJBs deploy correctly because the database units are created and the log shows that the publication of some HarbourMaster references: java:global/voyager-app/voyager-ejb/harbour-master!com.nutrastat.voyager.db.HarbourMasterLocal java:app/voyager-ejb/harbour-master!com.nutrastat.voyager.db.HarbourMasterLocal java:module/harbour-master!com.nutrastat.voyager.db.HarbourMasterLocal java:global/voyager-app/voyager-ejb/harbour-master java:app/voyager-ejb/harbour-master java:module/harbour-master The problem lies in getting the HarbourMaster EJB injected into my web bean. The reference to it is alway NULL no matter what I try. voyager-web.war META-INF/MANIFEST.MF WEB-INF/web.xml WEB-INF/classes/com/nutrastat/voyager/web/ WEB-INF/classes/com/nutrastat/voyager/web/Ships.class WEB-INF/classes/com/nutrastat/voyager/web/VoyagerApplication.class Ships.java: @Path("fleet") public class Ships { protected transient final Logger log; @EJB private HarbourMasterLocal harbourMaster; public Ships() { log = LoggerFactory.getLogger(getClass()); } @GET @Path("ships") @Produces({"text/plain"}) public String listShips() { if (log.isDebugEnabled()) log.debug("Harbour master value: " + harbourMaster); return "Harbour Master: " + harbourMaster; } } &lt;web-app xmlns="http://java.sun.com/xml/ns/javaee" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://java.sun.com/xml/ns/javaee http://java.sun.com/xml/ns/javaee/web-app_3_0.xsd" version="3.0" &gt; <display-name>Voyager Web Application</display-name> <listener> <listener-class> org.jboss.resteasy.plugins.server.servlet.ResteasyBootstrap </listener-class> </listener> <servlet> <servlet-name>Resteasy</servlet-name> <servlet-class> org.jboss.resteasy.plugins.server.servlet.HttpServletDispatcher </servlet-class> <init-param> <param-name> javax.ws.rs.Application </param-name> <param-value> com.nutrastat.voyager.web.VoyagerApplication </param-value> </init-param> </servlet> <servlet-mapping> <servlet-name>Resteasy</servlet-name> <url-pattern>/*</url-pattern> </servlet-mapping> &lt;/web-app&gt; I have been searching the web for an answer and read a number of places, both on StackOverflow and elsewhere that suggests is can be done, and that the problems lies with configuration. But they post only snippets and I'm never sure if I'm doing things correctly. Many thanks for any help you can provide. Dobbo

    Read the article

  • Watching a variable for changes without polling.

    - by milkfilk
    I'm using a framework called Processing which is basically a Java applet. It has the ability to do key events because Applet can. You can also roll your own callbacks of sorts into the parent. I'm not doing that right now and maybe that's the solution. For now, I'm looking for a more POJO solution. So I wrote some examples to illustrate my question. Please ignore using key events on the command line (console). Certainly this would be a very clean solution but it's not possible on the command line and my actual app isn't a command line app. In fact, a key event would be a good solution for me but I'm trying to understand events and polling beyond just keyboard specific problems. Both these examples flip a boolean. When the boolean flips, I want to fire something once. I could wrap the boolean in an Object so if the Object changes, I could fire an event too. I just don't want to poll with an if() statement unnecessarily. import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; /* * Example of checking a variable for changes. * Uses dumb if() and polls continuously. */ public class NotAvoidingPolling { public static void main(String[] args) { boolean typedA = false; String input = ""; System.out.println("Type 'a' please."); while (true) { InputStreamReader isr = new InputStreamReader(System.in); BufferedReader br = new BufferedReader(isr); try { input = br.readLine(); } catch (IOException ioException) { System.out.println("IO Error."); System.exit(1); } // contrived state change logic if (input.equals("a")) { typedA = true; } else { typedA = false; } // problem: this is polling. if (typedA) System.out.println("Typed 'a'."); } } } Running this outputs: Type 'a' please. a Typed 'a'. On some forums people suggested using an Observer. And although this decouples the event handler from class being observed, I still have an if() on a forever loop. import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; import java.util.Observable; import java.util.Observer; /* * Example of checking a variable for changes. * This uses an observer to decouple the handler feedback * out of the main() but still is polling. */ public class ObserverStillPolling { boolean typedA = false; public static void main(String[] args) { // this ObserverStillPolling o = new ObserverStillPolling(); final MyEvent myEvent = new MyEvent(o); final MyHandler myHandler = new MyHandler(); myEvent.addObserver(myHandler); // subscribe // watch for event forever Thread thread = new Thread(myEvent); thread.start(); System.out.println("Type 'a' please."); String input = ""; while (true) { InputStreamReader isr = new InputStreamReader(System.in); BufferedReader br = new BufferedReader(isr); try { input = br.readLine(); } catch (IOException ioException) { System.out.println("IO Error."); System.exit(1); } // contrived state change logic // but it's decoupled now because there's no handler here. if (input.equals("a")) { o.typedA = true; } } } } class MyEvent extends Observable implements Runnable { // boolean typedA; ObserverStillPolling o; public MyEvent(ObserverStillPolling o) { this.o = o; } public void run() { // watch the main forever while (true) { // event fire if (this.o.typedA) { setChanged(); // in reality, you'd pass something more useful notifyObservers("You just typed 'a'."); // reset this.o.typedA = false; } } } } class MyHandler implements Observer { public void update(Observable obj, Object arg) { // handle event if (arg instanceof String) { System.out.println("We received:" + (String) arg); } } } Running this outputs: Type 'a' please. a We received:You just typed 'a'. I'd be ok if the if() was a NOOP on the CPU. But it's really comparing every pass. I see real CPU load. This is as bad as polling. I can maybe throttle it back with a sleep or compare the elapsed time since last update but this is not event driven. It's just less polling. So how can I do this smarter? How can I watch a POJO for changes without polling? In C# there seems to be something interesting called properties. I'm not a C# guy so maybe this isn't as magical as I think. private void SendPropertyChanging(string property) { if (this.PropertyChanging != null) { this.PropertyChanging(this, new PropertyChangingEventArgs(property)); } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How do I prevent my form from freezing when it is loading an image from the web at the click of a button?

    - by Vimal Basdeo
    I want to display an image from the web to a panel in another Jframe at the click of a button but whenever I click the button first the image loads and during this time the current form potentially freezes and once the image has loaded the form is displayed with the image.. How can I avoid the situation where my form freezes since it is very irritating My codes :: My current class private void btn_TrackbusActionPerformed(java.awt.event.ActionEvent evt) { try { sendMessage("Query,map,$,start,211,Arsenal,!"); System.out.println(receiveMessage()); } catch (UnknownHostException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (IOException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (Exception ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } client_trackedbus nextform=new client_trackedbus(planform,connection,packet_receive,packet_send); this.setVisible(false); this.dispose(); nextform.setVisible(true); // TODO add your handling code here: } My next class that displays the image public class client_trackedbus extends javax.swing.JFrame { client_planform planform=null; DatagramSocket connection=null; DatagramPacket packet_receive=null; DatagramPacket packet_send=null; JLabel label=null; /** Creates new form client_trackedbus */ public client_trackedbus(client_planform planform,DatagramSocket connection,DatagramPacket packet_receive,DatagramPacket packet_send) { initComponents(); this.planform=planform; this.connection=connection; this.packet_receive=packet_receive; this.packet_send=packet_send; try { displayMap("http://www.huddletogether.com/projects/lightbox2/images/image-2.jpg", jPanel1, new JLabel()); } catch (MalformedURLException ex) { Logger.getLogger(client_trackedbus.class.getName()).log(Level.SEVERE, null, ex); } } private void displayMap(String url,JPanel panel,JLabel label) throws MalformedURLException{ URL imageurl=new URL(url); Image image=(Toolkit.getDefaultToolkit().createImage(imageurl)); ImageIcon icon = new ImageIcon(image); label.setIcon(icon); panel.add(label); // System.out.println(panel.getSize().width); this.getContentPane().add(panel); } /** This method is called from within the constructor to * initialize the form. * WARNING: Do NOT modify this code. The content of this method is * always regenerated by the Form Editor. */ @SuppressWarnings("unchecked") // <editor-fold defaultstate="collapsed" desc="Generated Code"> private void initComponents() { jPanel1 = new javax.swing.JPanel(); jLabel1 = new javax.swing.JLabel(); btn_Exit = new javax.swing.JButton(); btn_Plan = new javax.swing.JButton(); setDefaultCloseOperation(javax.swing.WindowConstants.EXIT_ON_CLOSE); setTitle("Public Transport Journey Planner"); javax.swing.GroupLayout jPanel1Layout = new javax.swing.GroupLayout(jPanel1); jPanel1.setLayout(jPanel1Layout); jPanel1Layout.setHorizontalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 368, Short.MAX_VALUE) ); jPanel1Layout.setVerticalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 172, Short.MAX_VALUE) ); jLabel1.setFont(new java.awt.Font("Arial", 1, 18)); jLabel1.setText("Your tracked bus"); btn_Exit.setText("Exit"); btn_Exit.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_ExitActionPerformed(evt); } }); btn_Plan.setText("Plan journey"); btn_Plan.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_PlanActionPerformed(evt); } }); javax.swing.GroupLayout layout = new javax.swing.GroupLayout(getContentPane()); getContentPane().setLayout(layout); layout.setHorizontalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(104, 104, 104) .addComponent(jLabel1)) .addGroup(layout.createSequentialGroup() .addContainerGap() .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE)) .addGroup(layout.createSequentialGroup() .addGap(65, 65, 65) .addComponent(btn_Plan) .addGap(65, 65, 65) .addComponent(btn_Exit, javax.swing.GroupLayout.PREFERRED_SIZE, 87, javax.swing.GroupLayout.PREFERRED_SIZE))) .addContainerGap(20, Short.MAX_VALUE)) ); layout.setVerticalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(35, 35, 35) .addComponent(jLabel1) .addGap(18, 18, 18) .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(18, 18, 18) .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.BASELINE) .addComponent(btn_Exit) .addComponent(btn_Plan)) .addContainerGap(12, Short.MAX_VALUE)) ); pack(); }// </editor-fold> private void btn_ExitActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: Exitform(); } private void btn_PlanActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: this.setVisible(false); this.dispose(); this.planform.setVisible(true); } private void Exitform(){ this.setVisible(false); this.dispose(); } /** * @param args the command line arguments */ public static void main(String args[]) { java.awt.EventQueue.invokeLater(new Runnable() { public void run() { // new client_trackedbus().setVisible(true); } }); } // Variables declaration - do not modify private javax.swing.JButton btn_Exit; private javax.swing.JButton btn_Plan; private javax.swing.JLabel jLabel1; private javax.swing.JPanel jPanel1; // End of variables declaration }

    Read the article

  • maven-ear-plugin works if jboss version is 4.2, but not 5. Why ?

    - by NSINGH
    I am using maven to configure maven-ear-plugin. I am getting following exception when I say jboss version is 5 (See below code, under tag). It works if I replace version to 4.2 <build> <finalName>tactical</finalName> <plugins> <plugin> <artifactId>maven-ear-plugin</artifactId> <configuration> <version>5</version> <defaultJavaBundleDir>lib</defaultJavaBundleDir> <jboss> <version>5</version> <loader-repository>seam.jboss.org:loader=tactical</loader-repository> </jboss> <modules> <ejbModule> <groupId>${project.groupId}</groupId> <artifactId>tactical-jar</artifactId> </ejbModule> </modules> </configuration> </plugin> </plugins> </build> Why it works fine for jboss 4.2 but not for 5. What ?? I get the following exception: [INFO] Failed to initialize JBoss configuration Embedded error: Invalid JBoss configuration, version[5] is not supported. [INFO] ------------------------------------------------------------------------ [INFO] Trace org.apache.maven.lifecycle.LifecycleExecutionException: Failed to initialize JBoss configuration at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoals(DefaultLifecycleExecutor.java:583) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoalWithLifecycle(DefaultLifecycleExecutor.java:49 9) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoal(DefaultLifecycleExecutor.java:478) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoalAndHandleFailures(DefaultLifecycleExecutor.jav a:330) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeTaskSegments(DefaultLifecycleExecutor.java:291) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.execute(DefaultLifecycleExecutor.java:142) at org.apache.maven.DefaultMaven.doExecute(DefaultMaven.java:336) at org.apache.maven.DefaultMaven.execute(DefaultMaven.java:129) at org.apache.maven.cli.MavenCli.main(MavenCli.java:287) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at org.codehaus.classworlds.Launcher.launchEnhanced(Launcher.java:315) at org.codehaus.classworlds.Launcher.launch(Launcher.java:255) at org.codehaus.classworlds.Launcher.mainWithExitCode(Launcher.java:430) at org.codehaus.classworlds.Launcher.main(Launcher.java:375) Caused by: org.apache.maven.plugin.MojoExecutionException: Failed to initialize JBoss configuration at org.apache.maven.plugin.ear.AbstractEarMojo.execute(AbstractEarMojo.java:159) at org.apache.maven.plugin.ear.GenerateApplicationXmlMojo.execute(GenerateApplicationXmlMojo.java:96) at org.apache.maven.plugin.DefaultPluginManager.executeMojo(DefaultPluginManager.java:451) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoals(DefaultLifecycleExecutor.java:558) ... 16 more Caused by: org.apache.maven.plugin.ear.EarPluginException: Invalid JBoss configuration, version[5] is not supported. at org.apache.maven.plugin.ear.JbossConfiguration.(JbossConfiguration.java:95) at org.apache.maven.plugin.ear.AbstractEarMojo.initializeJbossConfiguration(AbstractEarMojo.java:296) at org.apache.maven.plugin.ear.AbstractEarMojo.execute(AbstractEarMojo.java:155) ... 19 more [INFO] ------------------------------------------------------------------------ [INFO] Total time: 2 seconds Any idea. Thanks

    Read the article

  • Error showing is NullPointerException [duplicate]

    - by user3659612
    This question already has an answer here: How to check a string against null in java? 11 answers I was trying to code a wifi scanner which does 20 scans but it shows NullPointerException at if(bssid[j].equals(null)){ My code is slightly huge package com.example.scanner; import java.io.File; import java.io.FileNotFoundException; import java.io.FileOutputStream; import java.io.IOException; import java.io.OutputStreamWriter; import java.text.SimpleDateFormat; import java.util.Date; import java.util.List; import android.annotation.SuppressLint; import android.content.BroadcastReceiver; import android.content.Context; import android.content.Intent; import android.content.IntentFilter; import android.net.wifi.ScanResult; import android.net.wifi.WifiInfo; import android.net.wifi.WifiManager; import android.os.Bundle; import android.os.Environment; import android.support.v7.app.ActionBarActivity; import android.view.Menu; import android.view.View; import android.widget.ArrayAdapter; import android.widget.Button; import android.widget.ListView; import android.widget.Toast; public class MainActivity extends ActionBarActivity { WifiManager wifi; WifiScanReceiver wifireciever; WifiInfo info; Button scan, save; List<ScanResult> wifilist; ListView list; String wifis[]; String name; String[] ssid = new String[100]; String[] bssid = new String[100]; int[] lvl = new int[100]; int[] count = new int[100]; @Override protected void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.fragment_main); list=(ListView)findViewById(R.id.listView1); scan=(Button)findViewById(R.id.button1); save=(Button)findViewById(R.id.button2); scan.setOnClickListener(new View.OnClickListener() { @Override public void onClick(View v) { // TODO Auto-generated method stub wifi=(WifiManager)getSystemService(Context.WIFI_SERVICE); if (wifi.isWifiEnabled()==false){ wifi.setWifiEnabled(true); } wifireciever = new WifiScanReceiver(); for (int i=0;i<20;i++){ registerReceiver(wifireciever, new IntentFilter(WifiManager.SCAN_RESULTS_AVAILABLE_ACTION)); wifi.startScan(); if (i==19){ Toast.makeText(getBaseContext(), "Scan Finish", Toast.LENGTH_LONG).show(); } } } }); save.setOnClickListener(new View.OnClickListener() { @Override public void onClick(View v) { // TODO Auto-generated method stub savedata(); } }); } protected void savedata() { // TODO Auto-generated method stub try { File sdcard = Environment.getExternalStorageDirectory(); File directory = new File(sdcard.getAbsolutePath() + "/WIFI_RESULT"); directory.mkdirs(); name = new SimpleDateFormat("yyyy-MM-dd HH mm ss").format(new Date()); File file = new File(directory,name + "wifi_data.txt"); FileOutputStream fou = new FileOutputStream(file); OutputStreamWriter osw = new OutputStreamWriter(fou); try { for (int i =0; i < list.getCount(); i++){ osw.append(list.getItemAtPosition(i).toString()); } osw.flush(); osw.close(); Toast.makeText(getBaseContext(), "Saved", Toast.LENGTH_LONG).show(); } catch (IOException e){ e.printStackTrace(); } } catch (FileNotFoundException e){ e.printStackTrace(); } } class WifiScanReceiver extends BroadcastReceiver { @SuppressLint("UseValueOf") public void onReceive(Context c, Intent intent) { int a =0; wifi.startScan(); List<ScanResult> wifilist = wifi.getScanResults(); if (a<wifilist.size()){ a=wifilist.size(); } for(int j=0;j<wifilist.size();j++){ if(bssid[j].equals(null)){ ssid[j] = wifilist.get(j).SSID.toString(); bssid[j] = wifilist.get(j).BSSID.toString(); lvl[j] = wifilist.get(j).level; count[j]++; } else if (bssid[j].equals(wifilist.get(j).BSSID.toString())){ lvl[j] = lvl[j] + wifilist.get(j).level; count[j]++; } } wifis = new String[a]; for (int i =0; i<a; i++){ wifis[i] = ("\n" + ssid[i] + "\n AP Address" + bssid[i] + "\n Signal Strength:" + lvl[i]/count[i]).toString(); } list.setAdapter(new ArrayAdapter<String>(getApplicationContext(), android.R.layout.simple_list_item_1,wifis)); } } protected void onDestroy() { unregisterReceiver(wifireciever); super.onPause(); } protected void onResume() { registerReceiver(wifireciever, new IntentFilter(WifiManager.SCAN_RESULTS_AVAILABLE_ACTION)); super.onResume(); } @Override public boolean onCreateOptionsMenu(Menu menu) { // Inflate the menu; this adds items to the action bar if it is present. getMenuInflater().inflate(R.menu.main, menu); return true; } } NullPointerException at that point mean my array bssid isn't initialize. So I just want to know how to initialize it in main activity so that I can use that string bssid anywhere.

    Read the article

  • JMaghreb 2012 Trip Report

    - by arungupta
    JMaghreb is the inaugural Java conference organized by Morocco JUG. It is the biggest Java conference in Maghreb (5 countries in North West Africa). Oracle was the exclusive platinum sponsor with several others. The registrations had to be closed at 1412 for the free conference and several folks were already on the waiting list. Rabat with 531 registrations and Casablanca with 426 were the top cities. Some statistics ... 850+ attendees over 2 days, 500+ every day 30 sessions were delivered by 18 speakers from 10 different countries 10 sessions in French and 20 in English 6 of the speakers spoke at JavaOne 2012 8 will be at Devoxx Attendees from 5 different countries and 57 cities in Morocco 40.9% qualified them as professional and rest as students Topics ranged from HTML5, Java EE 7, ADF, JavaFX, MySQL, JCP, Vaadin, Android, Community, JCP Java EE 6 hands-on lab was sold out within 7 minutes and JavaFX in 12 minutes I gave the keynote along with Simon Ritter which was basically a recap of the Strategy and Technical keynotes presented at JavaOne 2012. An informal survey during the keynote showed the following numbers: 25% using NetBeans, 90% on Eclipse, 3 on JDeveloper, 1 on IntelliJ About 10 subscribers to free online Java magazine. This digital magazine is a comprehensive source of information for everything Java - subscribe for free!! About 10-15% using Java SE 7. Download JDK 7 and get started today! Even JDK 8 builds have been available for a while now. My second talk explained the core concepts of WebSocket and how JSR 356 is providing a standard API to build WebSocket-driven applications in Java EE 7. TOTD #183 explains how you can easily get started with WebSocket in GlassFish 4. The complete slide deck is available: Next day started with a community keynote by Sonya Barry. Some of us live the life of JCP, JSR, EG, EC, RI, etc every day, but not every body is. To address that, Sonya prepared an excellent introductory presentation providing an explanation of these terms and how java.net infrastructure supports Java development. The registration for the lab showed there is a definite demand for these technologies in this part of the world. I delivered the Java EE 6 hands-on lab to a packed room of about 120 attendees. Most of the attendees were able to progress and follow the lab instructions. Some of the attendees did not have a laptop but were taking extensive notes on paper notepads. Several attendees were already using Java EE 6 in their projects and typically they are the ones asking deep dive questions. Also gave out three copies of my recently released Java EE 6 Pocket Guide and new GlassFish t-shirts. Definitely feels happy to coach ~120 more Java developers learn standards-based enterprise Java programming. I also participated in a JCP BoF along with Werner, Sonya, and Badr. Adotp-a-JSR, java.net infrastructure, how to file a JSR, what is an RI, and other similar topics were discussed in a candid manner. You can follow @JMaghrebConf or check out their facebook page. java.net published a timely conversation with Badr El Houari - the fearless leader of the Morocco JUG team. Did you know that Morocco JUG stood for JCP EC elections (ADD LINK) ? Even though they did not get elected but did fairly well. Now some sample tweets from #JMaghreb ... #JMaghreb is over. Impressive for a first edition! Thanks @badrelhouari and all the @MoroccoJUG team ! Since you @speakjava : System.out.println("Thank you so much dear Tech Evangelist ! The JavaFX was pretty amazing !!! "); #JMaghreb @YounesVendetta @arungupta @JMaghrebConf Right ! hope he will be back to morocco again and again .. :) @Alji_ @arungupta @JMaghrebConf That dude is a genius ;) Put it on your wall :p @arungupta rocking Java EE 6 at @JMaghrebConf #Java #JavaEE #JMaghreb http://t.co/isl0Iq5p @sonyabarry you are an awesome speaker ;-) #JMaghreb rich more than 550 attendees in day one. Expecting more tomorrow! ongratulations @badrelhouari the organisation was great! The talks were pretty interesting, and the turnout was surprising at #JMaghreb! #JMaghreb is truly awesome... The speakers are unbelievable ! #JavaFX... Just amazing #JMaghreb Charmed by the talk about #javaFX ( nodes architecture, MVC, Lazy loading, binding... ) gotta start using it intead of SWT. #JMaghreb JavaFX is killing JFreeChart. It supports Charts a lot of kind of them ... #JMaghreb The british man is back #JMaghreb I do like him!! #JMaghreb @arungupta rocking @JMaghrebConf. pic.twitter.com/CNohA3PE @arungupta Great talk about the future of Java EE (JEE 7 & JEE 8) Thank you. #JMaghreb JEE7 more mooore power , leeess less code !! #JMaghreb They are simplifying the existing API for Java Message Service 2.0 #JMaghreb good to know , the more the code is simplified the better ! The Glassdoor guy #arungupta is doing it RIGHT ! #JMaghreb Great presentation of The Future of the Java Platform: Java EE 7, Java SE 8 & Beyond #jMaghreb @arungupta is a great Guy apparently #JMaghreb On a personal front, the hotel (Soiftel Jardin des Roses) was pretty nice and the location was perfect. There was a 1.8 mile loop dirt trail right next to it so I managed to squeeze some runs before my upcoming marathon. Also enjoyed some great Moroccan cuisine - Couscous, Tajine, mint tea, and moroccan salad. Visit to Kasbah of the Udayas, Hassan II (one of the tallest mosque in the world), and eating in a restaurant in a kasbah are some of the exciting local experiences. Now some pictures from the event (and around the city) ... And the complete album: Many thanks to Badr, Faisal, and rest of the team for organizing a great conference. They are already thinking about how to improve the content, logisitics, and flow for the next year. I'm certainly looking forward to JMaghreb 2.0 :-)

    Read the article

  • NetBeans Podcast 69

    - by TinuA
    Podcast Guests: Terrence Barr, Simon Ritter, Jaroslav Tulach (It's an all-Oracle lineup!) Download mp3: 47 Minutes – 39.5 mb Subscribe on iTunes NetBeans Community News with Geertjan and Tinu If you missed the first two Java Virtual Developer Day events in early May, there's still one more LIVE training left on May 28th. Sign up here to participate live in the APAC time zone or watch later ON DEMAND. Video: Get started with Vaadin development using NetBeans IDE NetBeans IDE was at JavaCro 2014 and at Hippo Get-together 2014 Another great lineup is in the works for NetBeans Day at JavaOne 2014. More details coming soon! NetBeans' Facebook page is almost at 40,000 Likes! Help us crack that milestone in the next few weeks! Other great ways to stay updated about NetBeans? Twitter and Google+. 09:28 / Terrence Barr - What to Know about Java Embedded Terrence Barr, a Senior Technologist and Principal Product Manager for Embedded and Mobile technologies at Oracle, discusses new features of the Java SE Embedded and Java ME Embedded platforms, and sheds some light on the differences between them and what they have to offer to developers. Learn more about Java SE Embedded Tutorial: Using Oracle Java SE Embedded Support in NetBeans IDE Learn more about Java ME Embedded Video: NetBeans IDE Support for Java ME 8 Video: Installing and Using Java ME SDK 8.0 Plugins in NetBeans IDE Follow Terrence Barr to keep up with news in the Embedded space: Blog and Twitter 26:02 / Simon Ritter - A Massive Serving of Raspberry Pi Oracle's Raspberry Pi virtual course is back by popular demand! Simon Ritter, the head of Oracle's Java Technology Evangelism team, chats about the second run of the free Java Embedded course (starting May 30th), what participants can expect to learn, NetBeans' support for Java ME development, and other Java trainings coming to a desktop, laptop or user group near you. Sign up for the Oracle MOOC: Develop Java Embedded Applications Using Raspberry Pi Find out when Simon Ritter and the Java Evangelism team are coming to a Java event or JUG in your area--follow them on Twitter: Simon Ritter Angela Caicedo Steven Chin Jim Weaver 36:58 / Jaroslav Tulach - A Perfect Translation Jaroslav Tulach returns to the NetBeans podcast with tales about the Japanese translation of the Practical API Design book, which he contends surpasses all previous translations, including the English edition! Order "Practical API Design" (Japanese Version)  Find out why the Japanese translation is the best edition yet *Have ideas for NetBeans Podcast topics? Send them to ">nbpodcast at netbeans dot org. *Subscribe to the official NetBeans page on Facebook! Check us out as well on Twitter, YouTube, and Google+.

    Read the article

  • Ubuntu turns off instead of suspend / sleeping

    - by Marcos
    I'm using Ubuntu 11.10 on my notebook as the main OS. How ever, I've been facing a serious problem: Every time I try to suspend it, or it just stays idle for a while, the computer shuts down, instead of suspending. It actually seems to be suspended, but when I press the button the awake it, it turns on, the open works are all lost. How can i fix this? P.s: On windows 7 the suspend / sleep resumes just fine. Here is a complete list of hardware: 00:00.0 Host bridge [0600]: Intel Corporation 2nd Generation Core Processor Family DRAM Controller [8086:0104] (rev 09) 00:02.0 VGA compatible controller [0300]: Intel Corporation 2nd Generation Core Processor Family Integrated Graphics Controller [8086:0116] (rev 09) 00:16.0 Communication controller [0780]: Intel Corporation 6 Series/C200 Series Chipset Family MEI Controller #1 [8086:1c3a] (rev 04) 00:1a.0 USB Controller [0c03]: Intel Corporation 6 Series/C200 Series Chipset Family USB Enhanced Host Controller #2 [8086:1c2d] (rev 04) 00:1b.0 Audio device [0403]: Intel Corporation 6 Series/C200 Series Chipset Family High Definition Audio Controller [8086:1c20] (rev 04) 00:1c.0 PCI bridge [0604]: Intel Corporation 6 Series/C200 Series Chipset Family PCI Express Root Port 1 [8086:1c10] (rev b4) 00:1c.1 PCI bridge [0604]: Intel Corporation 6 Series/C200 Series Chipset Family PCI Express Root Port 2 [8086:1c12] (rev b4) 00:1c.2 PCI bridge [0604]: Intel Corporation 6 Series/C200 Series Chipset Family PCI Express Root Port 3 [8086:1c14] (rev b4) 00:1d.0 USB Controller [0c03]: Intel Corporation 6 Series/C200 Series Chipset Family USB Enhanced Host Controller #1 [8086:1c26] (rev 04) 00:1f.0 ISA bridge [0601]: Intel Corporation HM65 Express Chipset Family LPC Controller [8086:1c49] (rev 04) 00:1f.2 SATA controller [0106]: Intel Corporation 6 Series/C200 Series Chipset Family 6 port SATA AHCI Controller [8086:1c03] (rev 04) 00:1f.3 SMBus [0c05]: Intel Corporation 6 Series/C200 Series Chipset Family SMBus Controller [8086:1c22] (rev 04) 01:00.0 Network controller [0280]: Realtek Semiconductor Co., Ltd. RTL8188CE 802.11b/g/n WiFi Adapter [10ec:8176] (rev 01) 02:00.0 System peripheral [0880]: JMicron Technology Corp. SD/MMC Host Controller [197b:2382] (rev 80) 02:00.2 SD Host controller [0805]: JMicron Technology Corp. Standard SD Host Controller [197b:2381] (rev 80) 02:00.3 System peripheral [0880]: JMicron Technology Corp. MS Host Controller [197b:2383] (rev 80) 02:00.5 Ethernet controller [0200]: JMicron Technology Corp. JMC250 PCI Express Gigabit Ethernet Controller [197b:0250] (rev 03) I've updated the kernel to 3.2 still and hibernate or suspend is still not working. SWAP is 1/4 of my RAM.

    Read the article

  • The Developer's Conference Florianópolis, Brazil

    - by Tori Wieldt
    by guest blogger Yara Senger With over 2900 developers in person and another 2000 online, The Developer's Conference (TDC) in Florianópolis, Brazil, reminds us that Java is BIG in Brazil. The conference included 20 different tracks, and Java was the most popular track. Java was also a big part of the talks in the IoT, Cloud and BigData tracks. Here's my overview (in Brazilian Portguese): Several JUGs were involved in TDC Florianópolis, serving as track leads, speakers and all-around heros, including SouJava SouJava Campinas GUJava Santa Catarina JUG Vale JUG Maringá Java Bahia GOJava (Goinia) JUG Rio do Sul RS Jug (Rio Grande do Sul) and I thank them for their support and commitment. It is a vibrant and fun community! We saw that the IoT space is maturing rapidly. There are already some related to embedded in the region.  Java Evangelist Bruno Borges and Marco Antonio Maciel gave a view popular talk "Java: Tweet for Beer!" They demonstrated how to make a beer tap controlled by Java and connected to the Internet, using a visual application JavaFX with Java SE 8, running on a Rasperry Pi. Of course, they had to test the application quite throughly.   We Brazilians are training the next generation of Java developers. TDC4Kids was as big success. We made a tour with the kids in all booths and almost everybody talked about Java. Java in government managment (Betha), Java on the 2048  (Oracle), Java on the popcorn machine and Java training (Globalcode & V.Office) and of course: Java & Minecraft! OTN's Pablo Ciccarello was there to support the community.  He did several video interviews with JUG leaders and speakers (mine included). You can watch more videos on his TDC Florianópolis playlist.  Thank you, Oracle and OTN for all your support. We interacted with thousands of Java developers at The Developer's Conference Florianópolis. If you want to join us, we are planning two more conferences this year: The Developer's Conference São Paulo, July  The Developer's Conference Porto Alegre, October 

    Read the article

  • The Internet Key Wave MW833UP is not recognized in Ubuntu

    - by gio900
    I can't use my Onda MW833UP... :( Any advice? Here is something that someone else may understand: ~$: lsb_release -a No LSB modules are available. Distributor ID: Ubuntu Description: Ubuntu 11.10 Release: 11.10 Codename: oneiric ~$: lsusb Bus 001 Device 005: ID 1ee8:0012 ~$: dmesg [ 22.709475] cdc_acm 1-1:1.0: ttyACM0: USB ACM device [ 22.714856] usbcore: registered new interface driver cdc_acm [ 22.714866] cdc_acm: USB Abstract Control Model driver for USB modems and ISDN adapters [ 23.520490] ieee80211 phy0: wl_ops_bss_info_changed: arp filtering: enabled true, count 1 (implement) [ 24.244530] usbcore: registered new interface driver usbserial [ 24.244575] USB Serial support registered for generic [ 24.244673] usbcore: registered new interface driver usbserial_generic [ 24.244681] usbserial: USB Serial Driver core [ 24.265879] USB Serial support registered for GSM modem (1-port) [ 24.285680] usbcore: registered new interface driver option [ 24.285691] option: v0.7.2:USB Driver for GSM modems [ 24.425878] EXT4-fs (sda9): re-mounted. Opts: errors=remount-ro,commit=600 [ 24.736540] EXT4-fs (sda8): re-mounted. Opts: commit=600 [ 35.705796] Easy slow down manager: checking for SABI support. [ 35.706002] Easy slow down manager: SABI is supported (f5189) [ 36.060099] usbcore: deregistering interface driver uvcvideo [ 139.508061] CE: hpet increased min_delta_ns to 20113 nsec [ 6798.378917] usb 1-1: USB disconnect, device number 5 [ 6809.108232] usb 1-1: new high speed USB device number 6 using ehci_hcd [ 6809.242692] scsi5 : usb-storage 1-1:1.0 [ 6810.241257] scsi 5:0:0:0: CD-ROM Onda Datacard CD-ROM 0001 PQ: 0 ANSI: 0 [ 6810.241841] scsi 5:0:0:1: Direct-Access Onda Storage 0001 PQ: 0 ANSI: 0 [ 6810.271410] sr0: scsi3-mmc drive: 0x/0x caddy [ 6810.272099] sr 5:0:0:0: Attached scsi CD-ROM sr0 [ 6810.272852] sr 5:0:0:0: Attached scsi generic sg1 type 5 [ 6810.279954] sd 5:0:0:1: [sdb] Attached SCSI removable disk [ 6810.281210] sd 5:0:0:1: Attached scsi generic sg2 type 0 [ 6810.380591] sr0: CDROM (ioctl) error, command: Xpwrite, Read disk info 51 00 00 00 00 00 00 00 02 00 [ 6810.380617] sr: Sense Key : Hardware Error [current] [ 6810.380625] sr: Add. Sense: No additional sense information [ 6810.613937] sr0: CDROM (ioctl) error, command: Xpwrite, Read disk info 51 00 00 00 00 00 00 00 02 00 [ 6810.613972] sr: Sense Key : Hardware Error [current] [ 6810.613984] sr: Add. Sense: No additional sense information [ 6810.673716] usb 1-1: USB disconnect, device number 6 [ 6815.572142] usb 1-1: new high speed USB device number 7 using ehci_hcd [ 6815.706828] cdc_acm 1-1:1.0: ttyACM0: USB ACM device The last 3 lines are where I inserted the Internet key, then reconnected it. usb-device T: Bus=01 Lev=01 Prnt=01 Port=00 Cnt=01 Dev#= 7 Spd=480 MxCh= 0 D: Ver= 2.00 Cls=ef(misc ) Sub=02 Prot=01 MxPS=64 #Cfgs= 1 P: Vendor=1ee8 ProdID=0012 Rev=00.01 S: Manufacturer=Onda S: Product=MW833UP S: SerialNumber=9230B35D870F9CB7AE684EACC5C12BE5EC33B26E C: #Ifs= 2 Cfg#= 1 Atr=a0 MxPwr=500mA I: If#= 0 Alt= 0 #EPs= 1 Cls=02(commc) Sub=02 Prot=01 Driver=cdc_acm I: If#= 1 Alt= 0 #EPs= 2 Cls=0a(data ) Sub=00 Prot=00 Driver=cdc_acm Then there is /dev/ttyACM0. When the key is connected to the USB port, everything that will meant...

    Read the article

  • android View not attached to window manager...

    - by Daniel Benedykt
    Hi I am having some of the following exceptions: java.lang.IllegalArgumentException: View not attached to window manager at android.view.WindowManagerImpl.findViewLocked(WindowManagerImpl.java:355) at android.view.WindowManagerImpl.updateViewLayout(WindowManagerImpl.java:191) at android.view.Window$LocalWindowManager.updateViewLayout(Window.java:428) at android.app.Dialog.onWindowAttributesChanged(Dialog.java:596) at android.view.Window.setDefaultWindowFormat(Window.java:1013) at com.android.internal.policy.impl.PhoneWindow.access$700(PhoneWindow.java:86) at com.android.internal.policy.impl.PhoneWindow$DecorView.drawableChanged(PhoneWindow.java:1951) at com.android.internal.policy.impl.PhoneWindow$DecorView.fitSystemWindows(PhoneWindow.java:1889) at android.view.ViewRoot.performTraversals(ViewRoot.java:727) at android.view.ViewRoot.handleMessage(ViewRoot.java:1633) at android.os.Handler.dispatchMessage(Handler.java:99) at android.os.Looper.loop(Looper.java:123) at android.app.ActivityThread.main(ActivityThread.java:4338) at java.lang.reflect.Method.invokeNative(Native Method) at java.lang.reflect.Method.invoke(Method.java:521) at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:860) at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:618) at dalvik.system.NativeStart.main(Native Method) I have google it and see that it has something to do with popups and turning the screen, but there is no reference to my code. The questions are: 1) is there a way to find out exactly when this issue is happening? 2) other than turning the screen, is there another event or action that triggers this error? 3) how do I prevent this to happen? Thanks

    Read the article

  • OpenLDAP and SSL

    - by Stormshadow
    I am having trouble trying to connect to a secure OpenLDAP server which I have set up. On running my LDAP client code java -Djavax.net.debug=ssl LDAPConnector I get the following exception trace (java version 1.6.0_17) trigger seeding of SecureRandom done seeding SecureRandom %% No cached client session *** ClientHello, TLSv1 RandomCookie: GMT: 1256110124 bytes = { 224, 19, 193, 148, 45, 205, 108, 37, 101, 247, 112, 24, 157, 39, 111, 177, 43, 53, 206, 224, 68, 165, 55, 185, 54, 203, 43, 91 } Session ID: {} Cipher Suites: [SSL_RSA_WITH_RC4_128_MD5, SSL_RSA_WITH_RC4_128_SHA, TLS_RSA_WITH_AES_128_CBC_SHA, TLS_DHE_RSA_WITH_AES_128_CBC_SHA, TLS_DHE_DSS_WITH_AES_128_CBC_SHA, SSL_RSA_W ITH_3DES_EDE_CBC_SHA, SSL_DHE_RSA_WITH_3DES_EDE_CBC_SHA, SSL_DHE_DSS_WITH_3DES_EDE_CBC_SHA, SSL_RSA_WITH_DES_CBC_SHA, SSL_DHE_RSA_WITH_DES_CBC_SHA, SSL_DHE_DSS_WITH_DES_CBC_SH A, SSL_RSA_EXPORT_WITH_RC4_40_MD5, SSL_RSA_EXPORT_WITH_DES40_CBC_SHA, SSL_DHE_RSA_EXPORT_WITH_DES40_CBC_SHA, SSL_DHE_DSS_EXPORT_WITH_DES40_CBC_SHA] Compression Methods: { 0 } *** Thread-0, WRITE: TLSv1 Handshake, length = 73 Thread-0, WRITE: SSLv2 client hello message, length = 98 Thread-0, received EOFException: error Thread-0, handling exception: javax.net.ssl.SSLHandshakeException: Remote host closed connection during handshake Thread-0, SEND TLSv1 ALERT: fatal, description = handshake_failure Thread-0, WRITE: TLSv1 Alert, length = 2 Thread-0, called closeSocket() main, handling exception: javax.net.ssl.SSLHandshakeException: Remote host closed connection during handshake javax.naming.CommunicationException: simple bind failed: ldap.natraj.com:636 [Root exception is javax.net.ssl.SSLHandshakeException: Remote host closed connection during hands hake] at com.sun.jndi.ldap.LdapClient.authenticate(Unknown Source) at com.sun.jndi.ldap.LdapCtx.connect(Unknown Source) at com.sun.jndi.ldap.LdapCtx.<init>(Unknown Source) at com.sun.jndi.ldap.LdapCtxFactory.getUsingURL(Unknown Source) at com.sun.jndi.ldap.LdapCtxFactory.getUsingURLs(Unknown Source) at com.sun.jndi.ldap.LdapCtxFactory.getLdapCtxInstance(Unknown Source) at com.sun.jndi.ldap.LdapCtxFactory.getInitialContext(Unknown Source) at javax.naming.spi.NamingManager.getInitialContext(Unknown Source) at javax.naming.InitialContext.getDefaultInitCtx(Unknown Source) at javax.naming.InitialContext.init(Unknown Source) at javax.naming.InitialContext.<init>(Unknown Source) at javax.naming.directory.InitialDirContext.<init>(Unknown Source) at LDAPConnector.CallSecureLDAPServer(LDAPConnector.java:43) at LDAPConnector.main(LDAPConnector.java:237) Caused by: javax.net.ssl.SSLHandshakeException: Remote host closed connection during handshake at com.sun.net.ssl.internal.ssl.SSLSocketImpl.readRecord(Unknown Source) at com.sun.net.ssl.internal.ssl.SSLSocketImpl.performInitialHandshake(Unknown Source) at com.sun.net.ssl.internal.ssl.SSLSocketImpl.readDataRecord(Unknown Source) at com.sun.net.ssl.internal.ssl.AppInputStream.read(Unknown Source) at java.io.BufferedInputStream.fill(Unknown Source) at java.io.BufferedInputStream.read1(Unknown Source) at java.io.BufferedInputStream.read(Unknown Source) at com.sun.jndi.ldap.Connection.run(Unknown Source) at java.lang.Thread.run(Unknown Source) Caused by: java.io.EOFException: SSL peer shut down incorrectly at com.sun.net.ssl.internal.ssl.InputRecord.read(Unknown Source) ... 9 more I am able to connect to the same secure LDAP server however if I use another version of java (1.6.0_14) I have created and installed the server certificates in the cacerts of both the JRE's as mentioned in this guide -- OpenLDAP with SSL When I run ldapsearch -x on the server I get # extended LDIF # # LDAPv3 # base <dc=localdomain> (default) with scope subtree # filter: (objectclass=*) # requesting: ALL # # localdomain dn: dc=localdomain objectClass: top objectClass: dcObject objectClass: organization o: localdomain dc: localdomain # admin, localdomain dn: cn=admin,dc=localdomain objectClass: simpleSecurityObject objectClass: organizationalRole cn: admin description: LDAP administrator # search result search: 2 result: 0 Success # numResponses: 3 # numEntries: 2 On running openssl s_client -connect ldap.natraj.com:636 -showcerts , I obtain the self signed certificate. My slapd.conf file is as follows ####################################################################### # Global Directives: # Features to permit #allow bind_v2 # Schema and objectClass definitions include /etc/ldap/schema/core.schema include /etc/ldap/schema/cosine.schema include /etc/ldap/schema/nis.schema include /etc/ldap/schema/inetorgperson.schema # Where the pid file is put. The init.d script # will not stop the server if you change this. pidfile /var/run/slapd/slapd.pid # List of arguments that were passed to the server argsfile /var/run/slapd/slapd.args # Read slapd.conf(5) for possible values loglevel none # Where the dynamically loaded modules are stored modulepath /usr/lib/ldap moduleload back_hdb # The maximum number of entries that is returned for a search operation sizelimit 500 # The tool-threads parameter sets the actual amount of cpu's that is used # for indexing. tool-threads 1 ####################################################################### # Specific Backend Directives for hdb: # Backend specific directives apply to this backend until another # 'backend' directive occurs backend hdb ####################################################################### # Specific Backend Directives for 'other': # Backend specific directives apply to this backend until another # 'backend' directive occurs #backend <other> ####################################################################### # Specific Directives for database #1, of type hdb: # Database specific directives apply to this databasse until another # 'database' directive occurs database hdb # The base of your directory in database #1 suffix "dc=localdomain" # rootdn directive for specifying a superuser on the database. This is needed # for syncrepl. rootdn "cn=admin,dc=localdomain" # Where the database file are physically stored for database #1 directory "/var/lib/ldap" # The dbconfig settings are used to generate a DB_CONFIG file the first # time slapd starts. They do NOT override existing an existing DB_CONFIG # file. You should therefore change these settings in DB_CONFIG directly # or remove DB_CONFIG and restart slapd for changes to take effect. # For the Debian package we use 2MB as default but be sure to update this # value if you have plenty of RAM dbconfig set_cachesize 0 2097152 0 # Sven Hartge reported that he had to set this value incredibly high # to get slapd running at all. See http://bugs.debian.org/303057 for more # information. # Number of objects that can be locked at the same time. dbconfig set_lk_max_objects 1500 # Number of locks (both requested and granted) dbconfig set_lk_max_locks 1500 # Number of lockers dbconfig set_lk_max_lockers 1500 # Indexing options for database #1 index objectClass eq # Save the time that the entry gets modified, for database #1 lastmod on # Checkpoint the BerkeleyDB database periodically in case of system # failure and to speed slapd shutdown. checkpoint 512 30 # Where to store the replica logs for database #1 # replogfile /var/lib/ldap/replog # The userPassword by default can be changed # by the entry owning it if they are authenticated. # Others should not be able to see it, except the # admin entry below # These access lines apply to database #1 only access to attrs=userPassword,shadowLastChange by dn="cn=admin,dc=localdomain" write by anonymous auth by self write by * none # Ensure read access to the base for things like # supportedSASLMechanisms. Without this you may # have problems with SASL not knowing what # mechanisms are available and the like. # Note that this is covered by the 'access to *' # ACL below too but if you change that as people # are wont to do you'll still need this if you # want SASL (and possible other things) to work # happily. access to dn.base="" by * read # The admin dn has full write access, everyone else # can read everything. access to * by dn="cn=admin,dc=localdomain" write by * read # For Netscape Roaming support, each user gets a roaming # profile for which they have write access to #access to dn=".*,ou=Roaming,o=morsnet" # by dn="cn=admin,dc=localdomain" write # by dnattr=owner write ####################################################################### # Specific Directives for database #2, of type 'other' (can be hdb too): # Database specific directives apply to this databasse until another # 'database' directive occurs #database <other> # The base of your directory for database #2 #suffix "dc=debian,dc=org" ####################################################################### # SSL: # Uncomment the following lines to enable SSL and use the default # snakeoil certificates. #TLSCertificateFile /etc/ssl/certs/ssl-cert-snakeoil.pem #TLSCertificateKeyFile /etc/ssl/private/ssl-cert-snakeoil.key TLSCipherSuite TLS_RSA_AES_256_CBC_SHA TLSCACertificateFile /etc/ldap/ssl/server.pem TLSCertificateFile /etc/ldap/ssl/server.pem TLSCertificateKeyFile /etc/ldap/ssl/server.pem My ldap.conf file is # # LDAP Defaults # # See ldap.conf(5) for details # This file should be world readable but not world writable. HOST ldap.natraj.com PORT 636 BASE dc=localdomain URI ldaps://ldap.natraj.com TLS_CACERT /etc/ldap/ssl/server.pem TLS_REQCERT allow #SIZELIMIT 12 #TIMELIMIT 15 #DEREF never

    Read the article

  • Android Jelly bean database is locked (code 5)

    - by mtraxdroid
    Im getting a database is locked (code 5) in my ListActivity the code works in the other versions of the Emulator but fails in the 4.1 version of the emulator E/SQLiteLog( 2132): (5) database is locked E/SQLiteDatabase( 2132): Failed to open database '/data/data/id.online.mydroid/databases/geo.db'. E/SQLiteDatabase( 2132): android.database.sqlite.SQLiteDatabaseLockedException: database is locked (code 5): , while compiling: PRAGMA al_mode E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnection.nativePrepareStatement(Native Method) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnection.acquirePreparedStatement(SQLiteConnection.java:882) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnection.executeForString(SQLiteConnection.java:627) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnection.setJournalMode(SQLiteConnection.java:313) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnection.setWalModeFromConfiguration(SQLiteConnection.java:287) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnection.open(SQLiteConnection.java:215) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnection.open(SQLiteConnection.java:193) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnectionPool.openConnectionLocked(SQLiteConnectionPool.java:463) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnectionPool.open(SQLiteConnectionPool.java:185) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteConnectionPool.open(SQLiteConnectionPool.java:177) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteDatabase.openInner(SQLiteDatabase.java:804) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteDatabase.open(SQLiteDatabase.java:789) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteDatabase.openDatabase(SQLiteDatabase.java:694) E/SQLiteDatabase( 2132): at android.app.ContextImpl.openOrCreateDatabase(ContextImpl.java:804) E/SQLiteDatabase( 2132): at android.content.ContextWrapper.openOrCreateDatabase(ContextWrapper.java:221) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteOpenHelper.getDatabaseLocked(SQLiteOpenHelper.java:224) E/SQLiteDatabase( 2132): at android.database.sqlite.SQLiteOpenHelper.getReadableDatabase(SQLiteOpenHelper.java:188) E/SQLiteDatabase( 2132): at id.online.mydroid.myDB.openForRead(myDB.java:158) E/SQLiteDatabase( 2132): at id.online.mydroid.mydroid.refreshCount(mydroid.java:207) E/SQLiteDatabase( 2132): at id.online.mydroid.mydroid.onResume(mydroid.java:525) Blockquote

    Read the article

  • Android 2.2 and "Bad address family" on Socket Connect

    - by Josh
    I have a fairly simple game that works perfectly on every version now up through 2.1, but with the new 2.2 (Froyo) release I am unable to create a socket. I am using the mina package for nio, and get this exception: W/System.err( 263): java.net.SocketException: Bad address family W/System.err( 263): at org.apache.harmony.luni.platform.OSNetworkSystem.connectStreamWithTimeoutSocketImpl(Native Method) W/System.err( 263): at org.apache.harmony.luni.platform.OSNetworkSystem.connect(OSNetworkSystem.java:115) W/System.err( 263): at org.apache.harmony.nio.internal.SocketChannelImpl.connect(SocketChannelImpl.java:272) W/System.err( 263): at org.apache.harmony.nio.internal.PipeImpl$SinkChannelImpl.finishConnect(PipeImpl.java:164) W/System.err( 263): at org.apache.harmony.nio.internal.PipeImpl.(PipeImpl.java:48) W/System.err( 263): at org.apache.harmony.nio.internal.SelectorProviderImpl.openPipe(SelectorProviderImpl.java:51) W/System.err( 263): at org.apache.harmony.nio.internal.SelectorImpl.(SelectorImpl.java:141) W/System.err( 263): at org.apache.harmony.nio.internal.SelectorProviderImpl.openSelector(SelectorProviderImpl.java:58) W/System.err( 263): at java.nio.channels.Selector.open(Selector.java:48) W/System.err( 263): at org.apache.mina.transport.socket.nio.SocketConnector.startupWorker(SocketConnector.java:248) W/System.err( 263): at org.apache.mina.transport.socket.nio.SocketConnector.connect(SocketConnector.java:210) W/System.err( 263): at org.apache.mina.transport.socket.nio.SocketConnector.connect(SocketConnector.java:137) W/System.err( 263): at org.apache.mina.common.support.BaseIoConnector.connect(BaseIoConnector.java:40) Later in the log, usually immediately following I get this: W/System.err( 263): java.lang.NullPointerException W/System.err( 263): at org.apache.harmony.nio.internal.SelectorImpl.wakeup(SelectorImpl.java:418) W/System.err( 263): at org.apache.mina.transport.socket.nio.SocketConnector.connect(SocketConnector.java:222) W/System.err( 263): at org.apache.mina.transport.socket.nio.SocketConnector.connect(SocketConnector.java:137) W/System.err( 263): at org.apache.mina.common.support.BaseIoConnector.connect(BaseIoConnector.java:40) I have done all the googling and looking around I can think of and found nothing. The closest I have come seems to be an old JDK bug with ipv6 support on XP and Vista machines (I'm running Vista). Recommendations included disabling ipv6 (that did not work) and disabling ipv4 and leaving ipv6 (will not work for me as my router and ISP don't support it and so could not test anyway). Any thoughts, suggestions, things I have not tried? Thanks, Josh

    Read the article

  • (Enterprise GlassFish v3 build 11) Communication link problem (MySQL DB)

    - by user312853
    I get a communication link failure while application tries to establish a connection with DB. [#|2010-04-08T20:09:57.825+0300|SEVERE|glassfish3.0|javax.enterprise.system.std.com.sun.enterprise.v3.services.impl|_ThreadID=24;_ThreadName=Thread-1;|Cannot connect to database server = com.mysql.jdbc.exceptions.jdbc4.CommunicationsException: Communications link failure The last packet sent successfully to the server was 0 milliseconds ago. The driver has not received any packets from the server.|#] Precisely at this string: Statement s = conn.createStatement(); where conn is defined as follows: private static java.sql.Connection conn; For this app I have set a connection pool with default parameters and currently it (app) uses both JPA and direct JDBC queries. Recreation of connection pool gave nothing, connection pool ping gave next message: Ping Connection Pool for pool is Failed. Ping failed Exce ption - Connection could not be allocated because: Communications lin k failure%%%EOL%%%%%%EOL%%%The last packet sent successfully to the s erver was 0 milliseconds ago. The driver has not received any packets from the server. Please check the server.log for more details.%%%EOL %%%Ping failed Exception - Connection could not be allocated because: Communications link failure and flushing the connection pool gave: com.sun.enterprise.admin.cli.CommandException: remote failure: Failed to flush connection pool ... However I can connect to the database from a terminal. Besides I have the same app working on my local machine with identical connection pool settings. Any one has an idea on whats going on or how to solve the trouble?

    Read the article

  • JSF 2.0: Validate equality of 2 InputSecret Fields (confirm password) without writing Code?

    - by yournamehere
    I'm developing a pure JavaEE6 application with JSF 2.0 and Glassfish. My JSF implementation is Primefaces (beside Mojarra provided by Glassfish). I want to verify if the values of 2 password fields in a JSF form are equal. With Seam, there is the neat component <s:validateEquality for="pw1"/>. I want do to the same without Seam, just using JSF (or maybe a component of a JSF library). Until now i only saw examples which validate the form with a custom validator. But i would like to compare the fields without writing Java code or Javascript code. Is that possible? This what it looks like with Seam: ... <h:inputSecret id="passwort" value="#{personHome.instance.password}" redisplay="true" required="true"> <f:validateLength minimum="8"/> <a:support event="onblur" reRender="passwortField" bypassUpdates="true" ajaxSingle="true" /> </h:inputSecret> ... <h:inputSecret id="passwort2" required="true" redisplay="true"> <!-- find the JSF2.0-equivalent to this tag: --> <s:validateEquality for="passwort"/> <a:support event="onblur" reRender="passwort2Field" bypassUpdates="true" ajaxSingle="true" /> </h:inputSecret> ... Any help is appreciated. Thanks!

    Read the article

  • Java SortedMap to Scala TreeMap

    - by Dave
    I'm having trouble converting a java SortedMap into a scala TreeMap. The SortedMap comes from deserialization and needs to be converted into a scala structure before being used. Some background, for the curious, is that the serialized structure is written through XStream and on desializing I register a converter that says anything that can be assigned to SortedMap[Comparable[_],_] should be given to me. So my convert method gets called and is given an Object that I can safely cast because I know it's of type SortedMap[Comparable[_],_]. That's where it gets interesting. Here's some sample code that might help explain it. // a conversion from comparable to ordering scala> implicit def comparable2ordering[A <: Comparable[A]](x: A): Ordering[A] = new Ordering[A] { | def compare(x: A, y: A) = x.compareTo(y) | } comparable2ordering: [A <: java.lang.Comparable[A]](x: A)Ordering[A] // jm is how I see the map in the converter. Just as an object. I know the key // is of type Comparable[_] scala> val jm : Object = new java.util.TreeMap[Comparable[_], String]() jm: java.lang.Object = {} // It's safe to cast as the converter only gets called for SortedMap[Comparable[_],_] scala> val b = jm.asInstanceOf[java.util.SortedMap[Comparable[_],_]] b: java.util.SortedMap[java.lang.Comparable[_], _] = {} // Now I want to convert this to a tree map scala> collection.immutable.TreeMap() ++ (for(k <- b.keySet) yield { (k, b.get(k)) }) <console>:15: error: diverging implicit expansion for type Ordering[A] starting with method Tuple9 in object Ordering collection.immutable.TreeMap() ++ (for(k <- b.keySet) yield { (k, b.get(k)) })

    Read the article

  • Place the business logic in Java Beans?

    - by Lirik
    I was reading this page and I found the following statement: MVC in Java Server Pages Now that we have a convenient architucture to separate the view, how can we leverage that? Java Server Pages (JSP) becomes more interesting because the HTML content can be separated from the Java business objects. JSP can also make use of Java Beans. The business logic could be placed inside Java Beans. If the design is architected correctly, a Web Designer could work with HTML on the JSP site without interfering with the Java developer. Interestingly in my textbook I pulled the following quote: In the MVC architecture... the original request is always handled by a servlet. The servlet invokes the business logic and data access code and creates beans to represent the results (that’s the model). Then, the servlet decides which Java Server Page is appropriate to present those particular results and forwards the request there (the JSP is the view). The servlet decides what business logic code applies and which JSP should present the results (the servlet is the controller). The two statements seem slightly contradicting. What is the best way to use beans: should we place business logic in them or should we only place results in them? Are there ways in which beans are inadequate for representing a model?

    Read the article

  • shift reduce&& reduce reduce errors in build parser for python garmmer

    - by user366580
    i wanna build buttom up parser by java cup i write code in java cup , it is for python language so i used grammer was written in this site : but not all grammer , i choice partial set ,just while , identifer also i smiplified them when i did compile for the java cup that i write by write this command in command prompt window : java java_cup.Main -parser CalcParser -symbols CalcSymbol < javacupfile.cup i get conflict errors ,they are of type reduce-shift conflict and reduce-reduce conflict you can see to print screen of the errors in these links image 1 click here to see imge1 the grammer was in EBNF form in as refernce site and i convert it to BNF form maybe i make mistake in converting so i get such errors the origanl grammmer was // grammer in EBNF form identifier ::= (letter|"_") (letter | digit | "_")* letter ::= lowercase | uppercase lowercase ::= "a"..."z" uppercase ::= "A"..."Z" digit ::= "0"..."9 compound_stmt ::= if_stmt | while_stmt for_stmt ::= "for" target_list "in" expression_list ":" suite ["else" ":" suite] while_stmt ::= "while" expression ":" suite ["else" ":" suite] suite ::= stmt_list NEWLINE stmt_list ::= simple_stmt (";" simple_stmt)* [";"] simple_stmt ::= expression_stmt expression_stmt ::= expression_list expression_list ::= expression ( "," expression )* [","] expression ::= conditional_expression conditional_expression ::= or_test ["if" or_test "else" expression] or_test ::= and_test | or_test "or" and_test and_test ::= not_test | and_test "and" not_test not_test ::= comparison | "not" not_test comparison ::= or_expr ( comp_operator or_expr )* comp_operator ::= "<" | ">" | "==" | ">=" | "<=" | "<>" | "!=" | "is" ["not"] | ["not"] "in" or_expr ::= xor_expr | or_expr "|" xor_expr xor_expr ::= and_expr | xor_expr "^" and_expr and_expr ::= "&" | and_expr the grammer after converting to BNF form identifier ::=letterletter| letterdigit| letter"_"| "_"letter | "_"digit | "_""_" letter ::= lowercase | uppercase lowercase ::= "a"..."z" uppercase ::= "A"..."Z" digit ::= "0"..."9 while_stmt ::= "while" expression ":" suite "else" ":" suite |"while" expression ":" suite suite ::= stmt_list NEWLINE stmt_list ::= simple_stmt ";" simple_stmt stmt_list|";" simple_stmt ::= expression_stmt expression_stmt ::= expression_list expression_list ::= expression "," expression expression_list| "," expression ::= conditional_expression conditional_expression ::= or_test "if" or_test "else" expression |or_test or_test ::= and_test | or_test "or" and_test and_test ::= not_test | and_test "and" not_test not_test ::= comparison | "not" not_test comparison ::= or_expr comp_operator or_expr comp_operator ::= "<" | ">" | "==" | ">=" | "<=" | "<>" | "!=" | "is" ["not"] | ["not"] "in" or_expr ::= xor_expr | or_expr "|" xor_expr xor_expr ::= and_expr | xor_expr "^" and_expr and_expr ::= "&" | and_expr and the java cup file that i compile and get those errors is import java.io.*; terminal COMA; terminal ELSE; terminal WHILE; terminal NEWLINE; terminal SEMCOLON; terminal CAMMA; terminal IF; terminal OR; terminal AND; terminal NOT; terminal LESS; terminal GREATER; terminal EQUAL; terminal GREATERorE; terminal LESSorE; terminal NEQUAL; terminal OROP; terminal XOROP; terminal ANDOP; terminal Integer DIGIT; terminal java.lang.String LOWERCASE; terminal java.lang.String UPPERCASE; non terminal java.lang.String IDENTIFIER; non terminal java.lang.String LETTER; non terminal COMPOUND_STMT; non terminal WHILE_STMT; non terminal EXPRESSION; non terminal SUITE ; non terminal STMT_LIST; non terminal SIMPLE_STMT; non terminal EXPRESSION_STMT; non terminal EXPRESSION_LIST; non terminal CONDITITONAL_EXPRESSION; non terminal OR_TEST; non terminal AND_TEST; non terminal NOT_TEST; non terminal COMPARISON; non terminal COMP_OPERATOR; non terminal OR_EXPR; non terminal XOR_EXPR; non terminal AND_EXPR; IDENTIFIER ::=LETTER{: System.out.printf("lowercase"); :}| {: System.out.printf("uppercase"); :} LETTER{: System.out.printf("lowercase"); :}| {: System.out.printf("uppercase"); :}| LETTER{: System.out.printf("lowercase"); :}| {: System.out.printf("uppercase"); :} DIGIT; LETTER ::= LOWERCASE | UPPERCASE; COMPOUND_STMT ::=WHILE_STMT; WHILE_STMT ::= WHILE{: System.out.printf( "while"); :} EXPRESSION COMA {: System.out.printf(":"); :} SUITE ELSE {: System.out.printf("else" ); :} COMA{: System.out.printf( ":" ); :} SUITE |WHILE{: System.out.printf( "while" ); :} EXPRESSION COMA{: System.out.printf( ":" ); :} SUITE; SUITE ::= STMT_LIST NEWLINE{: System.out.printf( "newline" ); :}; STMT_LIST ::= SIMPLE_STMT SEMCOLON{: System.out.printf( ";" ); :} SIMPLE_STMT STMT_LIST|SEMCOLON{: System.out.printf( ";" ); :}; SIMPLE_STMT ::=EXPRESSION_STMT; EXPRESSION_STMT ::=EXPRESSION_LIST; EXPRESSION_LIST ::= EXPRESSION CAMMA{: System.out.printf( "," ); :} EXPRESSION EXPRESSION_LIST| CAMMA{: System.out.printf( "," ); :}; EXPRESSION ::= CONDITITONAL_EXPRESSION; CONDITITONAL_EXPRESSION ::= OR_TEST IF{: System.out.printf( "if"); :} OR_TEST ELSE{: System.out.printf("else"); :} EXPRESSION |OR_TEST; OR_TEST ::= AND_TEST | OR_TEST OR{: System.out.printf( "or"); :} AND_TEST; AND_TEST ::= NOT_TEST | AND_TEST AND{: System.out.printf( "and"); :} NOT_TEST; NOT_TEST ::= COMPARISON | NOT{: System.out.printf("not"); :} NOT_TEST; COMPARISON ::= OR_EXPR COMP_OPERATOR OR_EXPR ; COMP_OPERATOR ::= LESS{: System.out.printf( "<"); :} | GREATER{: System.out.printf(">"); :} | EQUAL{: System.out.printf("=="); :} | GREATERorE{: System.out.printf(">="); :} | LESSorE{: System.out.printf("<="); :} | NEQUAL{: System.out.printf("!="); :}; OR_EXPR ::= XOR_EXPR | OR_EXPR OROP{: System.out.printf("|"); :} XOR_EXPR; XOR_EXPR ::= AND_EXPR | XOR_EXPR XOROP {: System.out.printf("^"); :}XOR_EXPR; AND_EXPR ::= ANDOP{: System.out.printf("&"); :} | AND_EXPR; can any one told me how can solve this errors to build parser correcrtly??

    Read the article

  • JavaEE : "Access to default session denied" when sending mail using smtp.gmail.com

    - by Harry Pham
    I am trying to write email authentication feature for my website and I encounter some issues. I got java.lang.SecurityException: Access to default session denied, when I try to do Session.getDefaultInstance. Here are my codes: private static final String SMTP_HOST_NAME = "smtp.gmail.com"; private static final String SMTP_PORT = "465"; private static final String emailSubjectTxt = "Email Confirmation"; private static final String emailFromAddress = "[email protected]"; private static final String SSL_FACTORY = "javax.net.ssl.SSLSocketFactory"; ... String sendTo = "[email protected]"; boolean debug = true; Properties props = new Properties(); props.put("mail.smtp.host", SMTP_HOST_NAME); props.put("mail.smtp.auth", "true"); props.put("mail.debug", "true"); props.put("mail.smtp.port", SMTP_PORT); props.put("mail.smtp.socketFactory.port", SMTP_PORT); props.put("mail.smtp.socketFactory.class", SSL_FACTORY); props.put("mail.smtp.socketFactory.fallback", "false"); //It dies at the next line Session session = Session.getDefaultInstance(props, new javax.mail.Authenticator() { @Override protected PasswordAuthentication getPasswordAuthentication() { return new PasswordAuthentication("myUserName", "myPassword"); } }); session.setDebug(debug); //Set the FROM address Message msg = new MimeMessage(session); InternetAddress addressFrom = new InternetAddress(emailFromAddress); msg.setFrom(addressFrom); //Set the TO address InternetAddress[] addressTo = new InternetAddress[1]; addressTo[0] = new InternetAddress(sendTo); msg.setRecipients(Message.RecipientType.TO, addressTo); //Construct the content of the email confirmation String message = "Test Content" // Setting the Subject and Content Type msg.setSubject(emailSubjectTxt); msg.setContent(message, "text/plain"); Transport.send(msg);

    Read the article

  • Elegantly handling constraint violations in EJB/JPA environment?

    - by hallidave
    I'm working with EJB and JPA on a Glassfish v3 app server. I have an Entity class where I'm forcing one of the fields to be unique with a @Column annotation. @Entity public class MyEntity implements Serializable { private String uniqueName; public MyEntity() { } @Column(unique = true, nullable = false) public String getUniqueName() { return uniqueName; } public void setUniqueName(String uniqueName) { this.uniqueName = uniqueName; } } When I try to persist an object with this field set to a non-unique value I get an exception (as expected) when the transaction managed by the EJB container commits. I have two problems I'd like to solve: 1) The exception I get is the unhelpful "javax.ejb.EJBException: Transaction aborted". If I recursively call getCause() enough times, I eventually reach the more useful "java.sql.SQLIntegrityConstraintViolationException", but this exception is part of the EclipseLink implementation and I'm not really comfortable relying on it's existence. Is there a better way to get detailed error information with JPA? 2) The EJB container insists on logging this error even though I catch it and handle it. Is there a better way to handle this error which will stop Glassfish from cluttering up my logs with useless exception information? Thanks.

    Read the article

  • How to properly close a UDT server in Netty 4

    - by Steffen
    I'm trying to close my UDT server (Netty 4.0.5.Final) with shutDownGracefully() and reopen it on the same port. Unfortunately, I always get the socket exception below although it waits until the future has completed. I also added the socket option SO_REUSEADDR. What is the proper way to do this? Exception in thread "main" com.barchart.udt.ExceptionUDT: UDT Error : 5011 : another socket is already listening on the same UDP port : listen0:listen [id: 0x323d3939] at com.barchart.udt.SocketUDT.listen0(Native Method) at com.barchart.udt.SocketUDT.listen(SocketUDT.java:1136) at com.barchart.udt.net.NetServerSocketUDT.bind(NetServerSocketUDT.java:66) at io.netty.channel.udt.nio.NioUdtAcceptorChannel.doBind(NioUdtAcceptorChannel.java:71) at io.netty.channel.AbstractChannel$AbstractUnsafe.bind(AbstractChannel.java:471) at io.netty.channel.DefaultChannelPipeline$HeadHandler.bind(DefaultChannelPipeline.java:1006) at io.netty.channel.DefaultChannelHandlerContext.invokeBind(DefaultChannelHandlerContext.java:504) at io.netty.channel.DefaultChannelHandlerContext.bind(DefaultChannelHandlerContext.java:487) at io.netty.channel.ChannelDuplexHandler.bind(ChannelDuplexHandler.java:38) at io.netty.handler.logging.LoggingHandler.bind(LoggingHandler.java:254) at io.netty.channel.DefaultChannelHandlerContext.invokeBind(DefaultChannelHandlerContext.java:504) at io.netty.channel.DefaultChannelHandlerContext.bind(DefaultChannelHandlerContext.java:487) at io.netty.channel.DefaultChannelPipeline.bind(DefaultChannelPipeline.java:848) at io.netty.channel.AbstractChannel.bind(AbstractChannel.java:193) at io.netty.bootstrap.AbstractBootstrap$2.run(AbstractBootstrap.java:321) at io.netty.util.concurrent.SingleThreadEventExecutor.runAllTasks(SingleThreadEventExecutor.java:354) at io.netty.channel.nio.NioEventLoop.run(NioEventLoop.java:366) at io.netty.util.concurrent.SingleThreadEventExecutor$2.run(SingleThreadEventExecutor.java:101) at java.lang.Thread.run(Thread.java:724) A small test program demonstration the problem: public class MsgEchoServer { public static class MsgEchoServerHandler extends ChannelInboundHandlerAdapter { } public void run() throws Exception { final ThreadFactory acceptFactory = new UtilThreadFactory("accept"); final ThreadFactory connectFactory = new UtilThreadFactory("connect"); final NioEventLoopGroup acceptGroup = new NioEventLoopGroup(1, acceptFactory, NioUdtProvider.MESSAGE_PROVIDER); final NioEventLoopGroup connectGroup = new NioEventLoopGroup(1, connectFactory, NioUdtProvider.MESSAGE_PROVIDER); try { final ServerBootstrap boot = new ServerBootstrap(); boot.group(acceptGroup, connectGroup) .channelFactory(NioUdtProvider.MESSAGE_ACCEPTOR) .option(ChannelOption.SO_BACKLOG, 10) .option(ChannelOption.SO_REUSEADDR, true) .handler(new LoggingHandler(LogLevel.INFO)) .childHandler(new ChannelInitializer<UdtChannel>() { @Override public void initChannel(final UdtChannel ch) throws Exception { ch.pipeline().addLast(new MsgEchoServerHandler()); } }); final ChannelFuture future = boot.bind(1234).sync(); } finally { acceptGroup.shutdownGracefully().syncUninterruptibly(); connectGroup.shutdownGracefully().syncUninterruptibly(); } new MsgEchoServer().run(); } public static void main(final String[] args) throws Exception { new MsgEchoServer().run(); } }

    Read the article

  • Passing an object as parameter from Andriod to web service using ksoap

    - by user3718626
    I have an object called User which implements KvmSerializable. Would like to pass this object to the webservice. PropertyInfo pi = new PropertyInfo(); pi.setName("obj"); pi.setValue(user); pi.setType(user.getClass()); request.addProperty(pi); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope(SoapEnvelope.VER11); envelope.setOutputSoapObject(request); envelope.addMapping(NAMESPACE, "User",User.class); HttpTransportSE androidHttpTransport = new HttpTransportSE(URL); I get the following error.... SoapFault - faultcode: 'soapenv:Server' faultstring: 'Unknow type {http://users.com}User' faultactor: 'null' detail: org.kxml2.kdom.Node@53263024 at org.ksoap2.serialization.SoapSerializationEnvelope.parseBody(SoapSerializationEnvelope.java:141) at org.ksoap2.SoapEnvelope.parse(SoapEnvelope.java:140) at org.ksoap2.transport.Transport.parseResponse(Transport.java:118) at org.ksoap2.transport.HttpTransportSE.call(HttpTransportSE.java:272) at org.ksoap2.transport.HttpTransportSE.call(HttpTransportSE.java:118) at org.ksoap2.transport.HttpTransportSE.call(HttpTransportSE.java:113) at com.compete.WebServiceCallTask.getQuestion(WebServiceCallTask.java:114) at com.compete.WebServiceCallTask.doInBackground(WebServiceCallTask.java:53) at com.compete.WebServiceCallTask.doInBackground(WebServiceCallTask.java:1) at android.os.AsyncTask$2.call(AsyncTask.java:287) at java.util.concurrent.FutureTask.run(FutureTask.java:234) at android.os.AsyncTask$SerialExecutor$1.run(AsyncTask.java:230) at java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1080) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:573) at java.lang.Thread.run(Thread.java:856) Appreciate if any one can point me to an sample code or can direct me what is the issue. Thanks.

    Read the article

< Previous Page | 485 486 487 488 489 490 491 492 493 494 495 496  | Next Page >