Search Results

Search found 45441 results on 1818 pages for 'string to date'.

Page 496/1818 | < Previous Page | 492 493 494 495 496 497 498 499 500 501 502 503  | Next Page >

  • Converting to Byte Array after reading a BLOB from SQL in C#

    - by Soham
    Hi All, I need to read a BLOB and store it in a byte[], before going forward with Deserializing; Consider: //Reading the Database with DataAdapterInstance.Fill(DataSet); DataTable dt = DataSet.Tables[0]; foreach (DataRow row in dt.Rows) { byte[] BinDate = Byte.Parse(row["Date"].ToString()); // convert successfully to byte[] } I need help in this C# statement, as I am not able to convert an object type into a byte[]. Note, "Date" field in the table is a blob and not of type Date; Help appreciated; Soham

    Read the article

  • Converting a year from 4 digit to 2 digit and back again in C#

    - by Mike Wills
    My credit card processor requires I send a two-digit year from the credit card expiration date. Here is how I a currently processing: I put a DropDownList of the 4-digit year on the page. I validate the expiration date in a DateTime field to be sure that the expiration date being passed to the CC processor isn't expired. I send a two-digit year to the CC processor (as required). I do this via a substring of the value from the year DDL. Is there a method out there to convert a four-digit year to a two-digit year. I am not seeing anything on the DateTime object. Or should I just keep processing it as I am?

    Read the article

  • PHP and XSLTProcessor Misbehavior

    - by Aiden Bell
    Hi all, Simple question: Why is a PHP function called from an XSL Stylesheet just returning the last argument passed: foo.xsl: <xsl:template match="/"> <xsl:value-of select="php:function('date','c')" /> </xsl:template> PHP: ... $xsl = new XSLTProcessor(); $xsl->registerPHPFunctions(); $xsl->importStylesheet($fooStylesheet); echo $xsl->transformToXML($myXML); I Get the output c and if I call <xsl:value-of select="php:function('date')" /> I just get date as my output. Seems strange to me. Version info: PHP 5.3.2 libxslt Version 1.1.26 libxslt compiled against libxml Version 2.7.6 EXSLT enabled libexslt Version 1.1.26

    Read the article

  • Representing a schedule in a database

    - by David Pfeffer
    I have the interesting problem of representing complex schedule data in a database. I need to be able to represent the entirety of what the iCalendar (ics) format can represent, but in my database. I don't care about insertion efficiency but query efficiency is critical. The operation I will be doing most often is providing either a single date/time or a date/time range, and trying to determine if the defined schedule matches any part of the date/time range. Other operations can be slower. For those unfamiliar, ics allows representation of a single event or a reoccuring event based on multiple times per day, days of the week, week of a month, month, year, or some combination of those. For example, the third Thursday in November, or the 25th of December, or every two weeks starting November 2nd and continuing until September the following year. Any suggestions?

    Read the article

  • creating a Menu from SQLite values in Java

    - by shanahobo86
    I am trying to create a ListMenu using data from an SQLite database to define the name of each MenuItem. So in a class called menu.java I have defined the array String classes [] = {}; which should hold each menu item name. In a DBAdapter class I created a function so the user can insert info to a table (This all works fine btw). public long insertContact(String name, String code, String location, String comments, int days, int start, int end, String type) { ContentValues initialValues = new ContentValues(); initialValues.put(KEY_NAME, name); initialValues.put(KEY_CODE, code); initialValues.put(KEY_LOCATION, location); initialValues.put(KEY_COMMENTS, comments); initialValues.put(KEY_DAYS, days); initialValues.put(KEY_START, start); initialValues.put(KEY_END, end); initialValues.put(KEY_TYPE, type); return db.insert(DATABASE_TABLE, null, initialValues); } It would be the Strings inserted into KEY_NAME that I need to populate that String array with. Does anyone know if this is possible? Thanks so much for the help guys. If I implement that function by Sam/Mango the program crashes, am I using it incorrectly or is the error due to the unknown size of the array? DBAdapter db = new DBAdapter(this); String classes [] = db.getClasses(); edit: I should mention that if I manually define the array: String classes [] = {"test1", "test2", "test3", etc}; It works fine. The error is a NullPointerException Here's the logcat (sorry about the formatting). I hadn't initialized with db = helper.getReadableDatabase(); in the getClasses() function but unfortunately it didn't fix the problem. 11-11 22:53:39.117: D/dalvikvm(17856): Late-enabling CheckJNI 11-11 22:53:39.297: D/TextLayoutCache(17856): Using debug level: 0 - Debug Enabled: 0 11-11 22:53:39.337: D/libEGL(17856): loaded /system/lib/egl/libGLES_android.so 11-11 22:53:39.337: D/libEGL(17856): loaded /system/lib/egl/libEGL_adreno200.so 11-11 22:53:39.357: D/libEGL(17856): loaded /system/lib/egl/libGLESv1_CM_adreno200.so 11-11 22:53:39.357: D/libEGL(17856): loaded /system/lib/egl/libGLESv2_adreno200.so 11-11 22:53:39.387: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:39.407: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5c66d000 size:36593664 offset:32825344 fd:65 11-11 22:53:39.417: E/(17856): Can't open file for reading 11-11 22:53:39.417: E/(17856): Can't open file for reading 11-11 22:53:39.417: D/OpenGLRenderer(17856): Enabling debug mode 0 11-11 22:53:39.477: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5ecd3000 size:40361984 offset:36593664 fd:68 11-11 22:53:40.507: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61451000 size:7254016 offset:3485696 fd:71 11-11 22:53:41.077: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:41.077: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61c4c000 size:7725056 offset:7254016 fd:74 11-11 22:53:41.097: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x623aa000 size:8196096 offset:7725056 fd:80 11-11 22:53:41.937: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x62b7b000 size:8667136 offset:8196096 fd:83 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x61c4c000 size:7725056 offset:7254016 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x623aa000 size:8196096 offset:7725056 11-11 22:53:41.977: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x62b7b000 size:8667136 offset:8196096 11-11 22:53:42.167: I/Adreno200-EGLSUB(17856): <ConfigWindowMatch:2078>: Format RGBA_8888. 11-11 22:53:42.177: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x61c5d000 size:17084416 offset:13316096 fd:74 11-11 22:53:42.317: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x63853000 size:20852736 offset:17084416 fd:80 11-11 22:53:42.357: D/OpenGLRenderer(17856): Flushing caches (mode 0) 11-11 22:53:42.357: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x5c66d000 size:36593664 offset:32825344 11-11 22:53:42.357: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x5ecd3000 size:40361984 offset:36593664 11-11 22:53:42.367: D/memalloc(17856): /dev/pmem: Unmapping buffer base:0x61451000 size:7254016 offset:3485696 11-11 22:53:42.757: D/memalloc(17856): /dev/pmem: Mapped buffer base:0x5c56d000 size:24621056 offset:20852736 fd:65 11-11 22:53:44.247: D/AndroidRuntime(17856): Shutting down VM 11-11 22:53:44.247: W/dalvikvm(17856): threadid=1: thread exiting with uncaught exception (group=0x40ac3210) 11-11 22:53:44.257: E/AndroidRuntime(17856): FATAL EXCEPTION: main 11-11 22:53:44.257: E/AndroidRuntime(17856): java.lang.RuntimeException: Unable to instantiate activity ComponentInfo{niall.shannon.timetable/niall.shannon.timetable.menu}: java.lang.NullPointerException 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1891) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:1992) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.access$600(ActivityThread.java:127) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:1158) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.os.Handler.dispatchMessage(Handler.java:99) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.os.Looper.loop(Looper.java:137) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.main(ActivityThread.java:4441) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.reflect.Method.invokeNative(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.reflect.Method.invoke(Method.java:511) 11-11 22:53:44.257: E/AndroidRuntime(17856): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:823) 11-11 22:53:44.257: E/AndroidRuntime(17856): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:590) 11-11 22:53:44.257: E/AndroidRuntime(17856): at dalvik.system.NativeStart.main(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): Caused by: java.lang.NullPointerException 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.content.ContextWrapper.openOrCreateDatabase(ContextWrapper.java:221) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.database.sqlite.SQLiteOpenHelper.getWritableDatabase(SQLiteOpenHelper.java:157) 11-11 22:53:44.257: E/AndroidRuntime(17856): at niall.shannon.timetable.DBAdapter.getClasses(DBAdapter.java:151) 11-11 22:53:44.257: E/AndroidRuntime(17856): at niall.shannon.timetable.menu.<init>(menu.java:15) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.Class.newInstanceImpl(Native Method) 11-11 22:53:44.257: E/AndroidRuntime(17856): at java.lang.Class.newInstance(Class.java:1319) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.Instrumentation.newActivity(Instrumentation.java:1023) 11-11 22:53:44.257: E/AndroidRuntime(17856): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1882) 11-11 22:53:44.257: E/AndroidRuntime(17856): ... 11 more 11-11 22:53:46.527: I/Process(17856): Sending signal. PID: 17856 SIG: 9

    Read the article

  • How to combine elements of a list

    - by Addie
    I'm working in c#. I have a sorted List of structures. The structure has a DateTime object which stores month and year and an integer which stores a value. The list is sorted by date. I need to traverse the list and combine it so that I only have one instance of the structure per date. For example: My initial list would look like this: { (Apr10, 3), (Apr10, 2), (Apr10, -3), (May10, 1), (May10, 1), (May10, -3), (Jun10, 3) } The resulting list should look like this: { (Apr10, 2), (May10, -1), (Jun10, 3) } I'm looking for a simple / efficient solution. The struct is: class CurrentTrade { public DateTime date; public int dwBuy; } The list is: private List<CurrentTrade> FillList

    Read the article

  • Android ksoap nested soap objects in request gives error in response

    - by Smalesy
    I'm trying to do the following soap request on Android using KSOAP. It contains a list of nested soap objects. However, I must be doing something wrong as I get an error back. The request I am trying to generate is as follows: <?xml version="1.0" encoding="utf-8"?> <soap12:Envelope xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:soap12="http://www.w3.org/2003/05/soap-envelope"> <soap12:Body> <SetAttendanceMarks xmlns="http://hostname.net/"> <strSessionToken>string</strSessionToken> <LessonMarks> <Count>int</Count> <LessonMarks> <LessonMark> <StudentId>int</StudentId> <EventInstanceId>int</EventInstanceId> <Mark>string</Mark> </LessonMark> <LessonMark> <StudentId>int</StudentId> <EventInstanceId>int</EventInstanceId> <Mark>string</Mark> </LessonMark> </LessonMarks> </LessonMarks> </SetAttendanceMarks> </soap12:Body> </soap12:Envelope> My code is as follows: public boolean setAttendanceMarks(List<Mark> list) throws Exception { boolean result = false; String methodName = "SetAttendanceMarks"; String soapAction = getHost() + "SetAttendanceMarks"; SoapObject lessMarksN = new SoapObject(getHost(), "LessonMarks"); for (Mark m : list) { PropertyInfo smProp =new PropertyInfo(); smProp.setName("LessonMark"); smProp.setValue(m); smProp.setType(Mark.class); lessMarksN.addProperty(smProp); } PropertyInfo cProp =new PropertyInfo(); cProp.setName("Count"); cProp.setValue(list.size()); cProp.setType(Integer.class); SoapObject lessMarks = new SoapObject(getHost(), "LessonMarks"); lessMarks.addProperty(cProp); lessMarks.addSoapObject(lessMarksN); PropertyInfo sProp =new PropertyInfo(); sProp.setName("strSessionToken"); sProp.setValue(mSession); sProp.setType(String.class); SoapObject request = new SoapObject(getHost(), methodName); request.addProperty(sProp); request.addSoapObject(lessMarks); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope(SoapEnvelope.VER12); envelope.dotNet = true; envelope.setOutputSoapObject(request); HttpTransportSE androidHttpTransport = new HttpTransportSE(getURL()); androidHttpTransport.debug = true; androidHttpTransport.call(soapAction, envelope); String a = androidHttpTransport.requestDump; String b = androidHttpTransport.responseDump; SoapObject resultsRequestSOAP = (SoapObject) envelope.bodyIn; SoapObject res = (SoapObject) resultsRequestSOAP.getProperty(0); String resultStr = res.getPropertyAsString("Result"); if (resultStr.contentEquals("OK")) { result = true; } return result; } The error I get is as follows: <?xml version="1.0" encoding="utf-8"?><soap:Envelope xmlns:soap="http://www.w3.org/2003/05/soap-envelope" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <soap:Body> <soap:Fault> <soap:Code> <soap:Value>soap:Sender</soap:Value> </soap:Code> <soap:Reason> <soap:Text xml:lang="en">Server was unable to read request. ---&gt; There is an error in XML document (1, 383). ---&gt; The specified type was not recognized: name='LessonMarks', namespace='http://gsdregapp.net/', at &lt;LessonMarks xmlns='http://gsdregapp.net/'&gt;.</soap:Text> </soap:Reason> <soap:Detail /> </soap:Fault> </soap:Body> </soap:Envelope> Can anybody tell me what I am doing wrong? I will be most grateful for any assistance!

    Read the article

  • Ubercart role aissgnment issue

    - by minnur
    Hi There! I have an issue with expiration date in emails. For example, I have a subscription which expires on 1st FEB 2010 and I am purchasing new subscription (renewing my role). When order is complete Ubercart CA (Condition actions) sends an email about role renewal and new expiration date ([role-expiration-short]). But the message contains wrong expiration date I've noticed that on each order email contains N-1 expiration, where N - current purchase. This is email message: [order-first-name] [order-last-name], Thanks to your order, [order-link], at [store-name] you have renewed the role, [role-name]. It is now set to expire on [role-expiration-short] <- ISSUE IS HERE. Thanks again, [store-name] [site-slogan] Any ideas? Thanks!

    Read the article

  • Insert Data from to a table

    - by Lee_McIntosh
    I have a table that lists number of comments from a particular site like the following: Date Site Comments Total --------------------------------------------------------------- 2010-04-01 00:00:00.000 1 5 5 2010-04-01 00:00:00.000 2 8 13 2010-04-01 00:00:00.000 4 2 7 2010-04-01 00:00:00.000 7 13 13 2010-04-01 00:00:00.000 9 1 2 I have another table that lists ALL sites for example from 1 to 10 Site ----- 1 2 ... 9 10 Using the following code i can find out which sites are missing entries for the previous month: SELECT s.site from tbl_Sites s EXCEPT SELECT c.site from tbl_Comments c WHERE c.[Date] = DATEADD(mm, DATEDIFF(mm, 0, GetDate()) -1,0) Producing: site ----- 3 5 6 8 10 I would like to be able to insert the missing sites that is listed from my query into the comments table with some default values, i.e '0's Date Site Comments Total --------------------------------------------------------------- 2010-04-01 00:00:00.000 3 0 0 2010-04-01 00:00:00.000 5 0 0 2010-04-01 00:00:00.000 6 0 0 2010-04-01 00:00:00.000 8 0 0 2010-04-01 00:00:00.000 10 0 0 the question is, how did i update/insert the table/values? cheers, Lee

    Read the article

  • NVP request - CreateRecurringPaymentsProfile

    - by jiwanje.mp
    Im facing problem with Trail period and first month payemnt. My requirement is users can signup with trial period which allow new users to have a 30 day free trial. This means they will not be charged the monthly price until after the first 30 days the regular amount will be charged to user. but the next billing date should be one month later the profile start date. but next billing data and profile start date shows same when i query by GetRecurringPaymentProfile? Please help me how can i send the Recurring bill payment for this functionality. Thanks in advance, jiwan

    Read the article

  • Valid Dates in AppEngine forms (Beginner)

    - by codingJoe
    In AppEngine, I have a form that prompts a user for a date. The problem is that when the clicks enter there is an error: "Enter a Valid Date" How do I make my Form accept (for example) %d-%b-%Y as the date format? Is there a more elegant way to accomplish this? # Model and Forms class Task(db.Model): name=db.StringProperty() due=db.DateProperty() class TaskForm(djangoforms.ModelForm): class Meta: model = Task # my get function has the following. # using "now" for example. Could just as well be next Friday. tmStart = datetime.now() form = TaskForm(initial={'due': tmStart.strftime("%d-%b-%Y")}) template_values = {'form': form }

    Read the article

  • MVC 3 Remote Validation jQuery error on submit

    - by Richard Reddy
    I seem to have a weird issue with remote validation on my project. I am doing a simple validation check on an email field to ensure that it is unique. I've noticed that unless I put the cursor into the textbox and then remove it to trigger the validation at least once before submitting my form I will get a javascript error. e[h] is not a function jquery.min.js line 3 If I try to resubmit the form after the above error is returned everything works as expected. It's almost like the form tried to submit before waiting for the validation to return or something. Am I required to silently fire off a remote validation request on submit before submitting my form? Below is a snapshot of the code I'm using: (I've also tried GET instead of POST but I get the same result). As mentioned above, the code works fine but the form returns a jquery error unless the validation is triggered at least once. Model: public class RegisterModel { [Required] [Remote("DoesUserNameExist", "Account", HttpMethod = "POST", ErrorMessage = "User name taken.")] [Display(Name = "User name")] public string UserName { get; set; } [Required] [Display(Name = "Firstname")] public string Firstname { get; set; } [Display(Name = "Surname")] public string Surname { get; set; } [Required] [Remote("DoesEmailExist", "Account", HttpMethod = "POST", ErrorMessage = "Email taken.", AdditionalFields = "UserName")] [Display(Name = "Email address")] public string Email { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Password")] public string Password { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Confirm password")] public string ConfirmPassword { get; set; } [Display(Name = "Approved?")] public bool IsApproved { get; set; } } public class UserRoleModel { [Display(Name = "Assign Roles")] public IEnumerable<RoleViewModel> AllRoles { get; set; } public RegisterModel RegisterUser { get; set; } } Controller: // POST: /Account/DoesEmailExist // passing in username so that I can ignore the same email address for the same user on edit page [HttpPost] public JsonResult DoesEmailExist([Bind(Prefix = "RegisterUser.Email")]string Email, [Bind(Prefix = "RegisterUser.UserName")]string UserName) { var user = Membership.GetUserNameByEmail(Email); if (!String.IsNullOrEmpty(UserName)) { if (user == UserName) return Json(true); } return Json(user == null); } View: <script src="//ajax.googleapis.com/ajax/libs/jquery/1.7.1/jquery.min.js" type="text/javascript"></script> <script src="//ajax.googleapis.com/ajax/libs/jqueryui/1.8.17/jquery-ui.min.js" type="text/javascript"></script> <script type="text/javascript" src="/Content/web/js/jquery.unobtrusive-ajax.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.unobtrusive.min.js"></script> ...... @using (Html.BeginForm()) { @Html.AntiForgeryToken() <div class="titleh"> <h3>Edit a user account</h3> </div> <div class="body"> @Html.HiddenFor(model => model.RegisterUser.UserName) @Html.Partial("_CreateOrEdit", Model) <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(model => model.RegisterUser.IsApproved)</span> @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, true, new { @class = "uniform" }) Active @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, false, new { @class = "uniform" }) Disabled <div class="clear"></div> </div> <div class="button-box"> <input type="submit" name="submit" value="Save" class="st-button"/> @Html.ActionLink("Back to List", "Index", null, new { @class = "st-clear" }) </div> </div> } CreateEdit Partial View @model Project.Domain.Entities.UserRoleModel <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Firstname)</span> @Html.TextBoxFor(m => m.RegisterUser.Firstname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Firstname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Surname)</span> @Html.TextBoxFor(m => m.RegisterUser.Surname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Surname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Email)</span> @Html.TextBoxFor(m => m.RegisterUser.Email, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Email) <div class="clear"></div> </div> Thanks, Rich

    Read the article

  • ASP MVC 2: Regular expression attribute working on clientside but not on serverside

    - by wh0emPah
    [Required(ErrorMessage = "Date is required")] [RegularExpression(@"^(((0[1-9]|[12]\d|3[01])\/(0[13578]|1[02])\/((1[6-9]|[2-9]\d)\d{2}))|((0[1-9]|[12]\d|30)\/(0[13456789]|1[012])\/((1[6-9]|[2-9]\d)\d{2}))|((0[1-9]|1\d|2[0-8])\/02\/((1[6-9]|[2-9]\d)\d{2}))|(29\/02\/((1[6-9]|[2-9]\d)(0[48]|[2468][048]|[13579][26])|((16|[2468][048]|[3579][26])00))))$", ErrorMessage="Date is not valid must be like (dd/mm/jjjj)")] public DateTime Startdate{ get; set;} The client-side validation works perfectly. So it seems that JavaScript can successfully understand my regular expression. But when I do a postback, and the modelstate.Isvalid() gets called. My date isn't valid anymore. So I'm guessing that when .NET performs the matching with the regEx it doesn't match. My question: Why does this regular expression match on the client side but not on the server side?

    Read the article

  • Rules Engine vs Expert System

    - by User1
    What is the difference between a rules engine and an expert system? Example1: Let's say that I have a program that determines the expiration date of a new driver's license. It takes inputs like visa expiration date, passport number, birthday, etc. It determines the expiration date of the driver's license from this input. It can even give an error if the input did not have enough valid identifications to allow a new driver's license. Example2: Let's say I am making an online version of the game Monopoly. I want the ability to change the rules of the game (say $400 for passing go or no one can buy properties until they land on the same property twice, etc). I have a module in the code to handle these rules. Are these both rules engines or are they expert systems? They both seem so similar. Is it just a synonym?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Handling dynamic data from javascript or rails

    - by 99miles
    I have page consisting of a calendar view ( http://code.google.com/p/calendardateselect/ ) as well as divs, each of which contain information about a person. In each div I want to have a link to a new controller and action, and pass the id for the person and the date selected in the calendar. I can think of a one way, but I'm thinking there's likely a better solution: 1) Do something like: =link_to_function "Week", "weekClicked(#{person.id})" Then in the weekClicked() javascript method I get the selected date from the calendar, such as: $('e_date').selected_date; then with javascript I could make a post request as mentioned here: http://stackoverflow.com/questions/133925/javascript-post-request-like-a-form-submit 2) Or, is there a way that I could make each link a button in it's own form and maybe have a hidden field that gets the selected date from the calendar as or before the form is submitted? I tried this too, but couldn't figure it out. This definitely seems like it's more on the right track than #1. Thanks.

    Read the article

  • getting error in perl :can't modify non-lvalue subroutine call

    - by dexter
    i have index.pl and subs.pl when i run the program user inserts date of birth and then it is passed to getage() subroutine in subs.pl . subs.pl has many subroutines. getage() than implicitly calls another subroutine called validate() which validates the date entered by user. when i run the index.pl user enters the date as: 03-04-2005 following error comes :can't modify non-lvalue subroutine call at subs.pl line 85, < line 1 and at 85th line of subs.pl i have list(my $val,my @value) = validate($dob); why such error comes any solutions

    Read the article

  • Select in PL-SQL Errors: INTO After Select

    - by levi
    I've the following query in a test script window declare -- Local variables here p_StartDate date := to_date('10/15/2012'); p_EndDate date := to_date('10/16/2012'); p_ClientID integer := 000192; begin -- Test statements here select d.r "R", e.amount "Amount", e.inv_da "InvoiceData", e.product "ProductId", d.system_time "Date", d.action_code "Status", e.term_rrn "IRRN", d.commiount "Commission", 0 "CardStatus" from docs d inner join ext_inv e on d.id = e.or_document inner join term t on t.id = d.term_id where d.system_time >= p_StartDate and d.system_time <= p_EndDate and e.need_r = 1 and t.term_gr_id = p_ClientID; end Here is the error: ORA-06550: line 9, column 3: PLS-00428: an INTO clause is expected in this SELECT statement I've been using T-SQL for a long time and I'm new to pl-sql What's wrong here?

    Read the article

  • Binding jQuery UI plugin after $.load

    - by TomWilsonFL
    I have a function that attaches the jQuery UI DatePicker (with my options) to a passed jQuery object: function bindDatepicker($obj) { if ($obj == null) $obj = $("input.date"); $obj.datepicker( { appendText: '(yyyy-mm-dd)', autoSize: true, changeMonth: true, changeYear: true, closeText: 'Done', dateFormat: 'yy-mm-dd', defaultDate: '+1m', minDate: +1, numberOfMonths: 2 } ); } I call this at the beginning of every page to bind it to input elements: $(function() { bindDatepicker($("input.date")); }); This works fine. My problem comes in when I load form elements using $.load(). I cannot attach the DatePicker to any of the loaded elements. For example: $("#id").load("urlToLoad", function() { bindDatepicker($("input.date")); }); Loads the form elements into a div just fine, but will not attach the DatePicker. Why is this? I am stumped. :( Thanks, Tom

    Read the article

  • MySQL - Finding time overlaps

    - by Jude
    Hi, I have 2 tables in the database with the following attributes: Booking ======= booking_id booking_start booking_end resource_booked =============== booking_id resource_id The second table is an associative entity between "Booking" and "Resource" (i.e., 1 booking can contain many resources). Attributes booking_start and booking_end are timestamps with date and time in it. May I know how I might be able to find out for each resource_id (resource_booked) if the date/time overlaps or clashes with other bookings of similar resource_id? I was doodling the answer on paper, pictorially, to see if it might help me visualize how I could solve this and I got this: Joining the 2 tables (Booking, Booked_resource) into one table with the 4 attributes needed. Follow the answer suggested here : http://stackoverflow.com/questions/689458/find-overlapping-date-time-rows-within-one-table I did step 1 but step 2 is leaving me baffled! I would really appreciate any help on this! Thanks!

    Read the article

  • pass an ID with hyperlik but cant get this ID value from a fk in one table when i click in insert

    - by susan
    Something strange happened in my codes, actually I have a hyperlink that pass ID value in a query string to second page.in second page i have 2 sql datasource that both these sql datasources should get this id value and pass it to a filter parameter to show sth in datalist. so in another word I have a first page that has an hyperlink read ID value from a datasource and pass it to second page.its like below: <asp:HyperLink ID="HyperLink1" runat="server" NavigateUrl='<%# "~/forumpage.aspx?ID="+Eval("ID")%>'><%#Eval("title")%> </asp:HyperLink> then in second page i have one sql datasource with a query like this ...where ID=@id and get this id in query string from db.it work great . but i have problem with second sql datasource in second page it has a query sth like below:...forms.question_id=@id then in sql reference both to query string as ID that get by first page in hyperlink. but when i click in insert button show me error with fk. error:Error:The INSERT statement conflicted with the FOREIGN KEY constraint "FK_forumreply_forumquestions". The conflict occurred in database "forum", table "dbo.forumquestions", column 'ID'. The statement has been terminated. my tables (question(ID,user_id(fk),Cat_id(fk),title,bodytext) (reply(ID,userr_id(fk),questionn_id(fk),titlereply,bodytestreply); When by hand in cb i gave a number in questionn_id like 1 it show me successful but when it want read from a filter by datasource this field face with problem. plzzzz help i really need skip from this part.and cause i am new i guess I cant understand the logic way clearly. <asp:SqlDataSource ID="sdsreply" runat="server" ConnectionString="<%$ ConnectionStrings:forumConnectionString %>" SelectCommand="SELECT forumreply.ID, forumreply.userr_id, forumreply.questionn_id, forumreply.bodytextreply, forumreply.datetimereply, forumquestions.ID AS Expr1, forumusers.ID AS Expr2, forumusers.username FROM forumquestions INNER JOIN forumreply ON forumquestions.ID = forumreply.questionn_id INNER JOIN forumusers ON forumquestions.user_id = forumusers.ID AND forumreply.userr_id = forumusers.ID where forumreply.questionn_id=@questionn_id"> <SelectParameters> <asp:QueryStringParameter Name="questionn_id" QueryStringField="ID" /> </SelectParameters> </asp:SqlDataSource> it is cb for second page in insert button: { if (Session["userid"] != null) { lblreply.Text = Session["userid"].ToString(); } else { Session["userid"]=null; } if (HttpContext.Current.User.Identity.IsAuthenticated) { lblshow.Text = string.Empty; string d = HttpContext.Current.User.Identity.Name; lblshow.Text =d + "???? ??? ?????." ; foreach (DataListItem item in DataList2.Items) { Label questionn_idLabel = (Label)item.FindControl("questionn_idLabel"); Label userr_idLabel = (Label)item.FindControl("userr_idLabel"); lbltest.Text = string.Empty; lbltest.Text = questionn_idLabel.Text; lblreply.Text = string.Empty; lblreply.Text = userr_idLabel.Text; } } else { lblshow.Text = "??? ??? ??? ??? ?? ?? ?????? ???? ???? ???? ????? ??? ??? ? ??? ????? ???????."; } } { if(HttpContext.Current.User.Identity.IsAuthenticated) { if (Page.IsValid) { SqlConnection con = new SqlConnection(ConfigurationManager.ConnectionStrings["forumConnectionString"].ConnectionString); try { con.Open(); SqlCommand cmd = new SqlCommand("insert into forumreply (userr_id,questionn_id,bodytextreply,datetimereply)values(@userr_id,@questionn_id,@bodytextreply,@datetimereply)", con); cmd.Parameters.AddWithValue("userr_id",lblreply.Text); cmd.Parameters.AddWithValue("questionn_id",lbltest.Text); cmd.Parameters.AddWithValue("bodytextreply",txtbody.Text); cmd.Parameters.AddWithValue("datetimereply",DateTime.Now ); cmd.ExecuteNonQuery(); } catch (Exception exp) { Response.Write("<b>Error:</b>"); Response.Write(exp.Message); } finally { con.Close(); } lblmsg.Text = "???? ??? ?? ?????? ??? ?????.thx"; lblshow.Visible = false; //lbltxt.Text = txtbody.Text; txtbody.Text = string.Empty; } } else { lblmsg.Text = string.Empty; Session["rem"] = Request.UrlReferrer.AbsoluteUri; Response.Redirect("~/login.aspx"); } }

    Read the article

  • How to calculate real-time stats?

    - by Diego Jancic
    I have a site with millions of users (well, actually it doesn't have any yet, but let's imagine), and I want to calculate some stats like "log-ins in the past hour". The problem is similar to the one described here: http://highscalability.com/blog/2008/4/19/how-to-build-a-real-time-analytics-system.html The simplest approach would be to do a select like this: select count(distinct user_id) from logs where date>='20120601 1200' and date <='20120601 1300' (of course other conditions could apply for the stats, like log-ins per country) Of course this would be really slow, mainly if it has millions (or even thousands) of rows, and I want to query this every time a page is displayed. How would you summarize the data? What should go to the (mem)cache? EDIT: I'm looking for a way to de-normalize the data, or to keep the cache up-to-date. For example I could increment an in-memory variable every time someone logs in, but that would help to know the total amount of logins, not the "logins in the last hour". Hope it's more clear now.

    Read the article

  • Type mismatch in expression in Delphi 7 on SQL append

    - by Demonick
    I have a code, that checks the current date when a form is loaded, performs a simple calculation, and appends a SQL in Delphi. It works on Windows 7 with Delphi 7, and on another computer with Xp, but doesn't on 3 other computers with Xp. When the form is loaded it shows a "Type mismatch in expression", and points to the line after the append. What could be the problem? procedure TfmJaunumi.FormCreate(Sender: TObject); var d1, d2: TDate; begin d1:= Date; d2:= Date-30; With qrJaunumi do begin Open; SQL.Append('WHERE Sanem_datums BETWEEN' + #39 + DateToStr(d1) + #39 + 'AND' + #39 + DateToStr(d2) + #39); Active := True; end; end;

    Read the article

  • Search object array for matching possible multiple values using different comparison operators

    - by Sparkles
    I have a function to search an array of objects for a matching value using the eq operator, like so: sub find { my ( $self, %params ) = @_; my @entries = @{ $self->{_entries} }; if ( $params{filename} ) { @entries = grep { $_->filename eq $params{filename} } @entries; } if ( $params{date} ) { @entries = grep { $_->date eq $params{date} } @entries; } if ( $params{title} ) { @entries = grep { $_->title eq $params{title} } @entries; } .... I wanted to also be able to pass in a qr quoted variable to use in the comparison instead but the only way I can think of separating the comparisons is using an if/else block, like so: if (lc ref($params{whatever}) eq 'regexp') { #use =~ } else { #use eq } Is there a shorter way of doing it? Because of reasons beyond my control I'm using Perl 5.8.8 so I can't use the smart match operator. TIA

    Read the article

  • Datetimepicker in windows 7

    - by maramasamy
    I am using Microsoft Date and Time Picker control(SP4) in my application.My application runs fine in xp and vista machines as date and time picker refers to mscomct2.ocx which is present in system32 for xp and vista,but for windows 7 i dont have this dll in my system .In windows we need admin rights to register that control. So is there any alternative/similar control available.......It would be helpful if you could let me know why thats not available in windows P.S : My Application is a .Net application and the reason why i have used Microsoft Date and Time Picker control(SP4) instead of .Net provided control is to display year 9999.

    Read the article

< Previous Page | 492 493 494 495 496 497 498 499 500 501 502 503  | Next Page >