Search Results

Search found 16413 results on 657 pages for 'array manipulation'.

Page 498/657 | < Previous Page | 494 495 496 497 498 499 500 501 502 503 504 505  | Next Page >

• Multiple records with one request in RESTful system

  - by keithjgrant

  All the examples I've seen regarding a RESTful architecture have dealt with a single record. For example, a GET request to mydomain.com/foo/53 to get foo 53 or a POST to mydomain.com/foo to create a new Foo. But what about multiple records? Being able to request a series of Foos by id or post an array of new Foos generally would be more efficient with a single API request rather than dozens of individual requests. Would you "overload" mydomain.com/foo to handle requests for both a single or multiple records? Or would you add a mydomain.com/foo-multiple to handle plural POSTs and GETs? I'm designing a system that may potentially need to get many records at once (something akin to mydomain.com/foo/53,54,66,86,87) But since I haven't seen any examples of this, I'm wondering if there's something I'm just not getting about a RESTful architecture that makes this approach "wrong".

  Read the article

• Is POSTing a Dictionary to an .NET MVC action possible?

  - by Brenton Alker

  I have a form which contains a series of fields like: <input type="text" name="User[123]" value="Alice" /> <input type="text" name="User[456]" value="Bob" /> ... Where the index of the User array (123 and 456) are ID's associated with the value. I'm trying to update these values in the controller. My thinking is that a Dictionary that maps ID to name would work, but creating the action like: public void Save(Dictionary<string, string> user) { // ... } results in the user parameter being null. So, is passing a Dictionary possible? or, is there another method to achieve this?

  Read the article

• JAX-WS returning a complex object?

  - by occhiso

  Hi, Im pretty new to Java Web Services, but I cant find a good explanation anywhere. I have 2 Java web projects within NetBeans. One as a web service and one as a client for that web service. I have also created my own class called "Person", which has what you'd expect: name, dob, etc. I would like to have a web service method called "ListPeople()" that would return an array of "Person" objects. Do I need to have that class in both projects? Should I be serializing the object first? Should I be using JAXB, if so, where do I start? Sorry for the n00b questions, but im confused. What is the normal way of accomplishing this? Thanks in advance

  Read the article

• How do I get a full Magento session in an external script? (Specifically, Catalog Rules)

  - by Laizer

  I'm running an external script that loads up a Magento session. Within that script, I'm loading products and grabbing a bunch of properties. The one issue is that getFinalPrice() does not apply the catalog rules that apply to the product. I'm doing everything I know to set the session, even a bunch of stuff that I think is superfluous. Nothing seems to get these rules applied. Here's a test script: require_once "app/Mage.php"; umask(0); $app = Mage::app("default"); $app->getTranslator()->init('frontend'); //Probably not needed Mage::getSingleton('core/session', array('name'=>'frontend')); $session = Mage::getSingleton("customer/session"); $session->start(); //Probably not needed $session->loginById(122); $product = Mage::getModel('catalog/product')->load(1429); echo $product->getFinalPrice(); Any insight is appreciated.

  Read the article

• XSLT: How to escape square brackets in Urls

  - by ilariac

  I have a set of records from Solr where field[@name='url'] can have the following format: http://url/blabla/blabla.aspx?sv=[keyword%20keyword,%201] My understanding is that the square brackets denote an array syntax and I would like to use XSLT to remove the square brackets from all Urls. The reason for this is that I am using an Open URL resolver, which does not currently handle well those characters. The best option would be to strip the square brackets from all URLs before such resources are mediated by the Open URL resolver. There are cases where I have multiple occurrences of square brackets per Url. Can you please help me with this? Thanks for your help, I.

  Read the article

• Why can't I reclaim my dynamically allocated memory using the "delete" keyword?

  - by synaptik

  I have the following class: class Patient { public: Patient(int x); ~Patient(); private: int* RP; }; Patient::Patient(int x) { RP = new int [x]; } Patient::~Patient() { delete [] RP; } I create an instance of this class on the stack as follows: void f() { Patient p(10); } Now, when f() returns, I get a "double free or corruption" error, which signals to me that something is attempted to be deleted more than once. But I don't understand why that would be so. The space for the array is created on the heap, and just because the function from inside which the space was allocated returns, I wouldn't expect the space to be reclaimed. I thought that if I allocate space on the heap (using the new keyword), then the only way to reclaim that space is to use the delete keyword. Help! :)

  Read the article

• Best way to parse command line arguments in C#

  - by Paul Stovell

  When building console applications that take parameters, you can use the arguments passed to Main(string[] args). In the past I've simply indexed/looped that array and done a few regular expressions to extract the values. However, when the commands get more complicated, the parsing can get pretty ugly. More recently, I built the world's simplest Backus-Naur Form parser in C# to parse the arguments. It does the job, but it also feels like overkill. So I'm interested in: Libraries that you use Patterns that you use Assume the commands always adhere to common standards such as answered here.

  Read the article

• CodePlex Daily Summary for Tuesday, July 10, 2012

  CodePlex Daily Summary for Tuesday, July 10, 2012Popular ReleasesjListSelect - jQuery plug-in for a fully customizable select input: 1.0: This is the initial release. Documentation is available using the Documentation tab above and inside the JavaScript code.Push Framework: Push Framework 1.5: This version brings many bug fixes and enhancements to its predecessor.DbDiff: Database Diff and Database Scripting: 1.1.3.3: Sql 2005, Sql 2012 fixes Removed dbdiff recommended default exe because it was a wrong build.re-linq: 1.13.158: This is build 1.13.158 of re-linq. Find the complete release notes for the build here: Release NotesMishra Reader: Mishra Reader beta 3: Per-feed browsing Tons of bug fixes Note: This release requires .NET 4.5 RC. You'll be prompted to install it if you don't already have it. The RC will be upgradeable to the RTM once it's available.MVVM Light Toolkit: MVVM Light Toolkit V4 RTM: The issue with the installer is fixed, sorry for the problems folks This version supports Silverlight 3, Silverlight 4, Silverlight 5, WPF 3.5 SP1, WPF4, Windows Phone 7.0 and 7.5, WinRT (Windows 8). Support for Visual Studio 2010 and Visual Studio 2012 RC.BlackJumboDog: Ver5.6.7: 2012.07.08 Ver5.6.7 (1) ????????????????「?????　Request.Receve()」?????????? (2) Web???????????FlMML customized: FlMML customized ??: FlMML customized ????。 ??、ＰＣＭ??????????、??????。ecBlog: ecBlog 0.2: ecBlog alpha realaseTaskScheduler ASP.NET: Release 3 - 1.2.0.0: Release 3 - Version 1.2.0.0 That version was altered only the library: In TaskScheduler was added new properties: UseBackgroundThreads Enables the use of separate threads for each task. StoreThreadsInPool Manager enables to store in the Pool threads that are performing the tasks. OnStopSchedulerAutoCancelThreads Scheduler allows aborting threads when it is stopped. false if the scheduler is not aborted the threads that are running. AutoDeletedExecutedTasks Allows Manager Delete Task afte...DotNetNuke Persian Packages: ??? ?? ???? ????? ???? 6.2.0: *????? ???? ??? ?? ???? 6.2.0 ? ??????? ???? ????? ???? ??? ????? *????? ????? ????? ??? ??? ???? ??? ??????? ??????? - ???? *?????? ???? ??? ?????? ?? ???? ???? ????? ? ?? ??? ?? ???? ???? ?? *????? ????? ????? ????? ????? / ??????? ???? ?? ???? ??? ??? - ???? *???? ???? ???? ????? ? ??????? ??? ??? ??? ?? ???? *????? ????? ???????? ??? ? ??????? ?? ?? ?????? ????? ????????? ????? ?????? - ???? *????? ????? ?????? ????? ?? ???? ?? ?? ?? ???????? ????? ????? ????????? ????? ?????? *???? ?...Cypher Bot: Cypher Bot 4.1: Cypher Bot is the most advanced encryption tool on the planet.... and now it actually works. That's right we fixed the bugs! For a full program summary go to the Home Page or visit www.iRareMedia.com So what's new? We've pretty much fixed all the bugs, but here's a run down if you wanna know exactly what's different: Fixed Installation / Setup Error, where an error message would display: "No Internet Connection, Try Again Later" Fixed File Encryption / Decryption error where the file exten...Coding4Fun Kinect Service: Coding4Fun Kinect Service v1.5: Requires Kinect for Windows SDK v1.5 Minor bug fixes + Kinect for Windows SDK v1.5 Aligning version with the Kinect for Windows SDK requiredtedplay: tedplay 1.1: tedplay 1.1 source and Win32 binary is out now. Changes are: SID card support Commodore 64 PSID music format support optimized FIR filter global hotkeys for skipping tracks (Windows only) module properties window (Windows only) mutable noise channel via GUI button (Windows only) disable SID card from the menu (Windows only) bugfixes PSID tunes are played on the C64 clock frequency but in a Commodore plus/4 virtual machine. The purpose is not to have yet another SID player, but t...xUnit.net Contrib: xunitcontrib-resharper 0.6 (RS 7.0, 6.1.1): xunitcontrib release 0.6 (ReSharper runner) This release provides a test runner plugin for Resharper 7.0 (EAP build 82) and 6.1, targetting all versions of xUnit.net. (See the xUnit.net project to download xUnit.net itself.) Copies of the plugin that support previous verions of ReSharper can be downloaded from this release. The plan is to support the latest revisions of the last two paid-for major versions of ReSharper (namely 7.0 and 6.1) Also note that all builds work against ALL VERSIONS...Umbraco CMS: Umbraco 4.8.0 Beta: Whats newuComponents in the core Multi-Node Tree Picker, Multiple Textstring, Slider and XPath Lists Easier Lucene searching built in IFile providers for easier file handling Updated 3rd party libraries Applications / Trees moved out of the database SQL Azure support added Various bug fixes Getting Started A great place to start is with our Getting Started Guide: Getting Started Guide: http://umbraco.codeplex.com/Project/Download/FileDownload.aspx?DownloadId=197051 Make sure to...CODE Framework: 4.0.20704.0: See CODE Framework (.NET) Change Log for changes in this version.xUnit.net - Unit testing framework for C# and .NET (a successor to NUnit): xUnit.net 1.9.1: xUnit.net release 1.9.1Build #1600 Important note for Resharper users: Resharper support has been moved to the xUnit.net Contrib project. Important note for TestDriven.net users: If you are having issues running xUnit.net tests in TestDriven.net, especially on 64-bit Windows, we strongly recommend you upgrade to TD.NET version 3.0 or later. Important note for VS2012 users: The VS2012 runner is in the Visual Studio Gallery now, and should be installed via Tools | Extension Manager from insi...MVC Controls Toolkit: Mvc Controls Toolkit 2.2.0: Added Modified all Mv4 related features to conform with the Mvc4 RC Now all items controls accept any IEnumerable<T>(before just List<T> were accepted by most of controls) retrievalManager class that retrieves automatically data from a data source whenever it catchs events triggered by filtering, sorting, and paging controls move method to the updatesManager to move one child objects from a father to another. The move operation can be undone like the insert, update and delete operatio...IronPython: 2.7.3: On behalf of the IronPython team, I'm happy to announce the final release of IronPython 2.7.3. This release includes everything from IronPython 54498, 62475, and 74478 as well. Like all IronPython 2.7-series releases, .NET 4 is required to install it. Installing this release will replace any existing IronPython 2.7-series installation. The incompatibility with IronRuby has been resolved, and they can once again be installed side-by-side. The biggest improvements in IronPython 2.7.3 are: the...New ProjectsAuction Helper: Auction HelperBizTalk 0MQ Adapter: The BizTalk 0MQ Adapter allows BizTalk to send and receive messages using the ZeroMq cross platform messaging framework.fluentstatement: FluentStatement is a library for .NET usable to create Expressions Trees through its fluent interface. These ET can contain Lambda Expressions and Statements.Freemansoft: ??????????????????gppsoftware: gppsoftwarejAutoFitText - jQuery plug-in to auto-fit text similar to iOS applications: This is a jQuery plug-in that automatically fits text in a specific container using font size manipulation and/or string truncation. The end result is simjDelayedAction - jQuery plug-in to allow a delayed reaction to an event: This is a jQuery plug-in that allows the creation of an event (or multiple event) handler with a delay that can be extended or canceled before reacting.jInMemoryImageLoader - jQuery plug-in to asynchronously load an image: This is a jQuery plug-in that allows the asynchronous, in-memory loading of an image file with a callback for when it has succeeded or failed to load.jListSelect - jQuery plug-in for a fully customizable select input: A jQuery plug-in that allows you to create a fully customizable select input.jNumericalInput - jQuery plug-in to limit a text input to only numeric values: A simple jQuery plug-in that, when applied to an input of type text, only allows the input to have a numeric value (positive or negative).jVerticalAlignMiddle - jQuery plug-in to vertically align elements: A simple jQuery plug-in that vertically centers one element within its parent container.lhhp.net: this project is for testLiteCode: Your having enough of crackers, reverse engineers ? With LiteCode you can host your code remotely at a server where no cracker can touch itNetEx .net tool set: NetEx .net tool setOpenFlashChart: OpenFlashChart ??????Flash Chart??。 Project RPG: Developers learn how to design a game from the ground up.saka-pon.net: saka-pon.net.School System: Its all about school managementSeeForYourself: SeeForYourSelfSharepoint JQuery Editor Web Part: Enables quick JQuery development by executing your code immediately while in desing mode.Simplex: Simplex ???????????????J2EE???????????????。 Stuff.NET: This library provides several useful classes and methods to deal with frequently appearing challenges. e.g.: pathfinding, forms/controls, dynamic compiling, ...

  Read the article

• Difference between mutableArrayValueForKey and calling insertObject:inEmployeesAtIndex: directly

  - by jasonbogd

  I have a question regarding using KVO-compliant methods to insert/remove objects from an array. I'm working through Aaron Hillegass' Cocoa Programming for Mac OS X and I saw the following line of code (in the insertObject:inEmployeesAtIndex: method: [[undoManager prepareWithInvocationTarget:self] removeObjectFromEmployeesAtIndex:index]; Correct me if I'm wrong, but I always thought it was better to call mutableArrayValueForKey: and then removeObjectAtIndex:...so I tried changing the above line to this: [[undoManager prepareWithInvocationTarget:[self mutableArrayValueForKey:@"employees"]] removeObjectAtIndex:index]; And it didn't work. Can someone explain the difference and why the first line works but the second line doesn't?

  Read the article

• Can't get my head around background workers in .NET

  - by Connel

  I have wrote an application that syncs two folders together. The problem with the program is that it stops responding whilst copying files. A quick search of stack-overflow told me I need to use something called a background worker. I have read a few pages on the net about this but find it really hard to understand as I'm pretty new to programming. Below is the code for my application - how can I simply put all of the File.Copy(....) commands into their own background worker (if that's even how it works)? Below is the code for the button click event that runs the sub procedure and the sub procedure I wish to use a background worker on all the File.Copy lines. Button event: protected virtual void OnBtnSyncClicked (object sender, System.EventArgs e) { //sets running boolean to true booRunning=true; //sets progress bar to 0 prgProgressBar.Fraction = 0; //resets values used by progressbar dblCurrentStatus = 0; dblFolderSize = 0; //tests if user has entered the same folder for both target and destination if (fchDestination.CurrentFolder == fchTarget.CurrentFolder) { //creates message box MessageDialog msdSame = new MessageDialog(this, DialogFlags.Modal, MessageType.Error, ButtonsType.Close, "You cannot sync two folders that are the same"); //sets message box title msdSame.Title="Error"; //sets respone type ResponseType response = (ResponseType) msdSame.Run(); //if user clicks on close button or closes window then close message box if (response == ResponseType.Close || response == ResponseType.DeleteEvent) { msdSame.Destroy(); } return; } //tests if user has entered a target folder that is an extension of the destination folder // or if user has entered a desatination folder that is an extension of the target folder if (fchTarget.CurrentFolder.StartsWith(fchDestination.CurrentFolder) || fchDestination.CurrentFolder.StartsWith(fchTarget.CurrentFolder)) { //creates message box MessageDialog msdContains = new MessageDialog(this, DialogFlags.Modal, MessageType.Error, ButtonsType.Close, "You cannot sync a folder with one of its parent folders"); //sets message box title msdContains.Title="Error"; //sets respone type and runs message box ResponseType response = (ResponseType) msdContains.Run(); //if user clicks on close button or closes window then close message box if (response == ResponseType.Close || response == ResponseType.DeleteEvent) { msdContains.Destroy(); } return; } //gets folder size of target folder FileSizeOfTarget(fchTarget.CurrentFolder); //gets folder size of destination folder FileSizeOfDestination(fchDestination.CurrentFolder); //runs SyncTarget procedure SyncTarget(fchTarget.CurrentFolder); //runs SyncDestination procedure SyncDestination(fchDestination.CurrentFolder); //informs user process is complete prgProgressBar.Text = "Finished"; //sets running bool to false booRunning = false; } Sync sub-procedure: protected void SyncTarget (string strCurrentDirectory) { //string array of all the directories in directory string[] staAllDirectories = Directory.GetDirectories(strCurrentDirectory); //string array of all the files in directory string[] staAllFiles = Directory.GetFiles(strCurrentDirectory); //loop over each file in directory foreach (string strFile in staAllFiles) { //string of just the file's name and not its path string strFileName = System.IO.Path.GetFileName(strFile); //string containing directory in target folder string strDirectoryInsideTarget = System.IO.Path.GetDirectoryName(strFile).Substring(fchTarget.CurrentFolder.Length); //inform user as to what file is being copied prgProgressBar.Text="Syncing " + strFile; //tests if file does not exist in destination folder if (!File.Exists(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName)) { //if file does not exist copy it to destination folder, the true below means overwrite if file already exists File.Copy (strFile, fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName, true); } //tests if file does exist in destination folder if (File.Exists(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName)) { //long (number) that contains date of last write time of target file long lngTargetFileDate = File.GetLastWriteTime(strFile).ToFileTime(); //long (number) that contains date of last write time of destination file long lngDestinationFileDate = File.GetLastWriteTime(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName).ToFileTime(); //tests if target file is newer than destination file if (lngTargetFileDate > lngDestinationFileDate) { //if it is newer then copy file from target folder to destination folder File.Copy (strFile, fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName, true); } } //gets current file size FileInfo FileSize = new FileInfo(strFile); //sets file's filesize to dblCurrentStatus and adds it to current total of files dblCurrentStatus = dblCurrentStatus + FileSize.Length; double dblPercentage = dblCurrentStatus/dblFolderSize; prgProgressBar.Fraction = dblPercentage; } //loop over each folder in target folder foreach (string strDirectory in staAllDirectories) { //string containing directories inside target folder but not any higher directories string strDirectoryInsideTarget = strDirectory.Substring(fchTarget.CurrentFolder.Length); //tests if directory does not exist inside destination folder if (!Directory.Exists(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget)) { //it directory does not exisit create it Directory.CreateDirectory(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget); } //run sync on all files in directory SyncTarget(strDirectory); } } Any help will be greatly appreciated as after this the program will pretty much be finished :D

  Read the article

• Compatibility issues with <a> and calling a function(); across different web browsers

  - by Matthew

  Hi, I am new to javascript. I wrote the following function rollDice() to produce 5 random numbers and display them. I use an anchor with click event to call the function. Problem is, in Chrome it won't display, works fine in IE, in firefox the 5 values display and then the original page w/anchor appears! I am suspicious that my script tag is too general but I am really lost. Also if there is a display function that doesn't clear the screen first that would be great. diceArray = new Array(5) function rollDice() { var i; for(i=0; i<5; i++) { diceArray[i]=Math.round(Math.random() * 6) % 6 + 1; document.write(diceArray[i]); } } when I click should display 5 rand variables

  Read the article

• Kohana input & validation libraries - overlap?

  - by keithjgrant

  I'm familiarizing myself with Kohana. I've been reading up on the Input library, which automatically pre-filters GET and POST data for me, and the Validation libary, which helps with form validation. Should I use both together? The examples given in the Validation library documentation use the unfiltered $_POST array instead of $this->input->post(). Seems to me it would be more secure to chain the two, but the two sets of documentation seem to make no mention of each other, so I don't know if this would be redundant or not.

  Read the article

• rails update whole index of a model with one click

  - by mattherick

  hello! i have a store model, this will handle my leaflet and my shoppingcart for my shop. now i d´like to show all items added from an user to his leaflet in the index of store. in the store an user can change the quantity of the choosen items. and now i want to save that the changes of the different quantities in the database with one click on a button "update store". so how could i implement an update over the whole index with one click? i´d like to do this with ajax and most dynamically. somebody has an idea? i render all items into a form so far, but now i have the problem, when i submit this form only the last quantity and item id are included in the params. further i pushed every quantity into an array and i want to submit this also as a param. but i could not. please give me some tips, will be very fine :) mattherick

  Read the article

• Looking for PCA snippet/source code in C++

  - by jihchuan

  Hi, I'm currently developing a software to compare 2 images. I start with extract the image's RGB values, form a matrix of array and then attempt to compress the values using PCA, and then match/recognize it with a pre-set data to find its similarity. But I can't proceed with the PCA part. (I'm using C++, C also can) If there any library/source code/snippet for it please let me know, or if there're any recommendation on my case also very welcomed!! I'd appreciate your helps!! Thanks! JC, [email protected]

  Read the article

• CodePlex Daily Summary for Sunday, January 30, 2011

  CodePlex Daily Summary for Sunday, January 30, 2011Popular ReleasesWPF Application Framework (WAF): WPF Application Framework (WAF) 2.0.0.3: Version: 2.0.0.3 (Milestone 3): This release contains the source code of the WPF Application Framework (WAF) and the sample applications. Requirements .NET Framework 4.0 (The package contains a solution file for Visual Studio 2010) The unit test projects require Visual Studio 2010 Professional Remark The sample applications are using Microsoft’s IoC container MEF. However, the WPF Application Framework (WAF) doesn’t force you to use the same IoC container in your application. You can use ...Rawr: Rawr 4.0.17 Beta: Rawr is now web-based. The link to use Rawr4 is: http://elitistjerks.com/rawr.phpThis is the Cataclysm Beta Release. More details can be found at the following link http://rawr.codeplex.com/Thread/View.aspx?ThreadId=237262 and on the Version Notes page: http://rawr.codeplex.com/wikipage?title=VersionNotes As of the 4.0.16 release, you can now also begin using the new Downloadable WPF version of Rawr!This is a pre-alpha release of the WPF version, there are likely to be a lot of issues. If you...VivoSocial: VivoSocial 7.4.2: Version 7.4.2 of VivoSocial has been released. If you experienced any issues with the previous version, please update your modules to the 7.4.2 release and see if they persist. If you have any questions about this release, please post them in our Support forums. If you are experiencing a bug or would like to request a new feature, please submit it to our issue tracker. Web Controls * Updated Business Objects and added a new SQL Data Provider File. Groups * Fixed a security issue whe...PHP Manager for IIS: PHP Manager 1.1.1 for IIS 7: This is a minor release of PHP Manager for IIS 7. It contains all the functionality available in 56962 plus several bug fixes (see change list for more details). Also, this release includes Russian language support. SHA1 codes for the downloads are: PHPManagerForIIS-1.1.0-x86.msi - 6570B4A8AC8B5B776171C2BA0572C190F0900DE2 PHPManagerForIIS-1.1.0-x64.msi - 12EDE004EFEE57282EF11A8BAD1DC1ADFD66A654VFPX: VFP2C32 2.0.0.8 Release Candidate: This release includes several bugfixes, new functions and finally a CHM help file for the complete library.EnhSim: EnhSim 2.3.3 ALPHA: 2.3.3 ALPHAThis release supports WoW patch 4.06 at level 85 To use this release, you must have the Microsoft Visual C++ 2010 Redistributable Package installed. This can be downloaded from http://www.microsoft.com/downloads/en/details.aspx?FamilyID=A7B7A05E-6DE6-4D3A-A423-37BF0912DB84 To use the GUI you must have the .NET 4.0 Framework installed. This can be downloaded from http://www.microsoft.com/downloads/en/details.aspx?FamilyID=9cfb2d51-5ff4-4491-b0e5-b386f32c0992 - Added back in a p...DB>doc for Microsoft SQL Server: 1.0.0.0: Initial release Supported output HTML WikiPlex markup Raw XML Supported objects Tables Primary Keys Foreign Keys ViewsmojoPortal: 2.3.6.1: see release notes on mojoportal.com http://www.mojoportal.com/mojoportal-2361-released.aspx Note that we have separate deployment packages for .NET 3.5 and .NET 4.0 The deployment package downloads on this page are pre-compiled and ready for production deployment, they contain no C# source code. To download the source code see the Source Code Tab I recommend getting the latest source code using TortoiseHG, you can get the source code corresponding to this release here.Office Web.UI: Alpha preview: This is the first alpha release. Very exciting moment... This download is just the demo application : "Contoso backoffice Web App". No source included for the moment, just the app, for testing purposes and for feedbacks !! This package includes a set of official MS Office icons (143 png 16x16 and 132 png 32x32) to really make a great app ! Please rate and give feedback ThanksParallel Programming with Microsoft Visual C++: Drop 6 - Chapters 4 and 5: This is Drop 6. It includes: Drafts of the Preface, Introduction, Chapters 2-7, Appendix B & C and the glossary Sample code for chapters 2-7 and Appendix A & B. The new material we'd like feedback on is: Chapter 4 - Parallel Aggregation Chapter 5 - Futures The source code requires Visual Studio 2010 in order to run. There is a known bug in the A-Dash sample when the user attempts to cancel a parallel calculation. We are working to fix this.Catel - WPF and Silverlight MVVM library: 1.1: (+) Styles can now be changed dynamically, see Examples application for a how-to (+) ViewModelBase class now have a constructor that allows services injection (+) ViewModelBase services can now be configured by IoC (via Microsoft.Unity) (+) All ViewModelBase services now have a unit test implementation (+) Added IProcessService to run processes from a viewmodel with directly using the process class (which makes it easier to unit test view models) (*) If the HasErrors property of DataObjec...NodeXL: Network Overview, Discovery and Exploration for Excel: NodeXL Excel Template, version 1.0.1.160: The NodeXL Excel template displays a network graph using edge and vertex lists stored in an Excel 2007 or Excel 2010 workbook. What's NewThis release improves NodeXL's Twitter and Pajek features. See the Complete NodeXL Release History for details. Installation StepsFollow these steps to install and use the template: Download the Zip file. Unzip it into any folder. Use WinZip or a similar program, or just right-click the Zip file in Windows Explorer and select "Extract All." Close Ex...Kooboo CMS: Kooboo CMS 3.0 CTP: Files in this downloadkooboo_CMS.zip: The kooboo application files Content_DBProvider.zip: Additional content database implementation of MSSQL, RavenDB and SQLCE. Default is XML based database. To use them, copy the related dlls into web root bin folder and remove old content provider dlls. Content provider has the name like "Kooboo.CMS.Content.Persistence.SQLServer.dll" View_Engines.zip: Supports of Razor, webform and NVelocity view engine. Copy the dlls into web root bin folder to enable...UOB & ME: UOB ME 2.6: UOB ME 2.6????: ???? V1.0: ???? V1.0 ??Password Generator: 2.2: Parallel password generation Password strength calculation ( Same method used by Microsoft here : https://www.microsoft.com/protect/fraud/passwords/checker.aspx ) Minor code refactoringVisual Studio 2010 Architecture Tooling Guidance: Spanish - Architecture Guidance: Francisco Fagas http://geeks.ms/blogs/ffagas, Microsoft Most Valuable Professional (MVP), localized the Visual Studio 2010 Quick Reference Guidance for the Spanish communities, based on http://vsarchitectureguide.codeplex.com/releases/view/47828. Release Notes The guidance is available in a xps-only (default) or complete package. The complete package contains the files in xps, pdf and Office 2007 formats. 2011-01-24 Publish version 1.0 of the Spanish localized bits.ASP.NET MVC Project Awesome, jQuery Ajax helpers (controls): 1.6.2: A rich set of helpers (controls) that you can use to build highly responsive and interactive Ajax-enabled Web applications. These helpers include Autocomplete, AjaxDropdown, Lookup, Confirm Dialog, Popup Form, Popup and Pager the html generation has been optimized, the html page size is much smaller nowFacebook Graph Toolkit: Facebook Graph Toolkit 0.6: new Facebook Graph objects: Application, Page, Post, Comment Improved Intellisense documentation new Graph Api connections: albums, photos, posts, feed, home, friends JSON Toolkit upgraded to version 0.9 (beta release) with bug fixes and new features bug fixed: error when handling empty JSON arrays bug fixed: error when handling JSON array with square or large brackets in the message bug fixed: error when handling JSON obejcts with double quotation in the message bug fixed: erro...Microsoft All-In-One Code Framework: Visual Studio 2008 Code Samples 2011-01-23: Code samples for Visual Studio 2008New ProjectsAnaida - WebSocket Client/Adapter: Anaida is a WebSocket Client Library/Adapter. With 3 versions for Java, Silverlight and C#CutPasteAssign: Visual Studio extension to assist in the common refactoring of assigning parameters to local variables.Drori Photos: Photos of Drori the photographerD-Solution: App de D-SolutionEnigma Home Inventory: Most consumers do not have an itemized list of proof of ownership. Enigma Home Inventory may take the hassle out of arguing with the insurance companies. This project is aimed to be for a simple inventory program for end users who are not computer savvy.FastKnow: is a CMS & wikiFileSignatures: FileSignatures aims to create a class library that can identify the file format based on file contents. The project is written in C# 3.0, and can be used in .NET 3.5 and 4.0 projects.Genrsis: The aim of the Genrsis project is to be a suite of products that you can use to build things, starting with a workflow-based project management tool. Built in C#, it should be a one-stop place to get well-integrated products to get you up and running.MVC Demos: MVC 2 and MVC 3 examples with ajax and json.MVC Templates for DevExpress: Scaffolding templates for use in ASP.NET MVC 2 with DevExpress MVC Extensions for ASP.NET MVCPixel Replacer: The Pixel Replacer is a simple library for replacing pixel colors with a new color, by setting a filter rule.ReviewPal - The Code Review Companion for .Net.: ReviewPal, the Code Review Companion for .Net. This is an Add-In / Extension for Visual Studio 2008 & Visual Studio 2010. The aim of the Add-In / Extension is to do a source code review within the Visual Studio IDE where code makes more sense and most readable.SMVector3: Vector3 class implemented as float array or with SIMD instructions with the same interface so it is transparant whether you decide to use one version or another. You can also chance version during the life cycle of the projects.uRibbon - Office 2007 Ribbon control for VB.NET: Office 2007 ribbon control, with Orb and graphic transitions. After searching for many day looking for an Office 2007-like ribbon bar, I finally gave up and decided to write my own. It's in decent shape as-is. But anyone interested in helping me to continue the devlopment??vtcheck: This will read a target binary and check to see if it is detected by VirusTotal.Web Scheduled Task Framework: A simple set of classes intended to allow the standalone scheduling of tasks (arbitrary code to execute) on a .net website without requiring access to the operating system.WP7 codeproject app: A Windows Phone 7 app for browsing codeproject.com.zhongjh: ?????????，???????。???????????: ???????????

  Read the article

• Marshal a list of objects from VB6 to C#

  - by Andrew

  I have a development which requires the passing of objects between a VB6 application and a C# class library. The objects are defined in the C# class library and are used as parameters for methods exposed by other classes in the same library. The objects all contain simple string/numeric properties and so marshaling has been relatively painless. We now have a requirement to pass an object which contains a list of other objects. If I was coding this in VB6 I might have a class containing a collection as a member variable. In C# I might have a class with a List member variable. Is it possible to construct a C# class in such a way that the VB6 application could populate this inner list and marshal it successfully? I don't have a lot of experience here but I would guess Id have to use an array of Object types.

  Read the article

• Scala wont pattern match with java.lang.String and Case Class

  - by Stefan

  Hello fellow Scala Programmers I have been working with Scala for some month now, however I have a problem with some properly basic stuff, I am hoping you will help my out with it. case class PersonClass(name: String, age: Int) object CaseTester { def main(args:Array[String]) { val string = "hej" string match { case e:String => println(string) case PersonClass => println(string) } } } When I am doing like this I get error: pattern type is incompatible with expected type; found : object PersonClass required: java.lang.String case PersonClass = println(string) And if I then change the second line in the pattern matching to the following: case e:PersonClass => println(string) I then get the error: error: scrutinee is incompatible with pattern type; found : PersonClass required: java.lang.String case e:PersonClass = println(string) However if I change the string definition to the following it compiles fine in both cases. val string:AnyRef = "hej"

  Read the article

• Sending POST variables through a PHP proxy for AJAX?

  - by b. e. hollenbeck

  I've decided that using a PHP proxy for AJAX calls for a project is the best way to go - but I have a question regarding passing POST data through the proxy. As in - how to do it. Should I need to create a single variable in the javascript using alternate characters, then have the PHP proxy parse and modify the variable to reassemble a valid HTTP request? Or is there some means of passing along the $_POST array in new request to the external server by pulling the data out of the headers and re-sending it?

  Read the article

• Building resultset using collection object

  - by Bhaskara Krishna Mohan Potam

  Hi, I had an issue in building the resultset using java. Here it goes... I am storing a collection object which is organized as row wise taken from a resultset object and putting the collection object(which is stored as vector/array list) in cache and trying to retrieve the same collection object. Here i need to build back the resultset again using the collection object. Now my doubt is building the resultset in this way possible or not? Please let me know asap. Thanks in advance, Bhaskar

  Read the article

• Equality Comparison with Multiple Instances/IEqualityComparer problems in LINQ

  - by Stacey

  This is similar to my last question; but from a different angle. http://stackoverflow.com/questions/2792393/see-if-item-exists-once-in-enumerable-linq Given the following set of items, and lists containing them... Item 1 Item 2 Item 3 Item 4 Item 5 class Item { string Name { get; set; } } List<Item> available = new List<Item>() { Item 1 Item 1 Item 2 Item 3 Item 5 } List<Item> selected = new List<Item>() { Item 1 Item 2 Item 3 } I need to make a third List that has everything from "available", except what is in "selected". However 'Item 1' is in 'available' twice, but only in 'selected' once. Since they are instances of the same item, I am having trouble figuring out the appropriate logic to accomodate this. The final array should look like... List<Item> selectable = new List<Item>() { Item 1 Item5 }

  Read the article

• Replacing backslash with another symbol in PHP

  - by Skyfe

  Hi there, Been struggling with replacing a backslash by another symbol such as '.-.' just to indicate the position of backslashes as I could not send a string such as 'C\xampp\etc.' through url as GET variable so I thought I'd first replace the backslashes in that string by another symbol, then send through url, and then replace them back to backslashes in the PHP file that handles it. Though would there be a better way to send such strings through url? Because when I try a script such as: $tmp_name = preg_replace("\", ".-.", $_FILES['uploadfile']['tmp_name']); It turns out into a php error as \ is also used as delimiter.. Could anyone help me out on this? Thanks in advanced! Btw, if I'd be able to send a full array through url, this whole problem would be solved, but I don't think it's possible?

  Read the article

• Why does my program crash when given negative values?

  - by Wayfarer

  Alright, I am very confused, so I hope you friends can help me out. I'm working on a project using Cocos2D, the most recent version (.99 RC 1). I make some player objects and some buttons to change the object's life. But the weird thing is, the code crashes when I try to change their life by -5. Or any negative value for that matter, besides -1. NSMutableArray *lifeButtons = [[NSMutableArray alloc] init]; CCTexture2D *buttonTexture = [[CCTextureCache sharedTextureCache] addImage:@"Button.png"]; LifeChangeButtons *button = nil; //top left button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(50 , size.height - 30); [button buttonText:-5]; [lifeButtons addObject:button]; //top right button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(size.width - 50 , size.height - 30); [button buttonText:1]; [lifeButtons addObject:button]; //bottom left button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(50 , 30); [button buttonText:5]; [lifeButtons addObject:button]; //bottom right button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(size.width - 50 , 30); [button buttonText:-1]; [lifeButtons addObject:button]; for (LifeChangeButtons *theButton in lifeButtons) { [self addChild:theButton]; } This is the code that makes the buttons. It simply makes 4 buttons, puts them in each corner of the screen (size is the screen) and adds their life change ability, 1,-1,5, or -5. It adds them to the array and then goes through the array at the end and adds all of them to the screen. This works fine. Here is my code for the button class: (header file) // // LifeChangeButtons.h // Coco2dTest2 // // Created by Ethan Mick on 3/14/10. // Copyright 2010 Wayfarer. All rights reserved. // #import "cocos2d.h" @interface LifeChangeButtons : CCSprite <CCTargetedTouchDelegate> { NSNumber *lifeChange; } @property (nonatomic, readonly) CGRect rect; @property (nonatomic, retain) NSNumber *lifeChange; + (id)lifeButton:(CCTexture2D *)texture; - (void)buttonText:(int)number; @end Implementation file: // // LifeChangeButtons.m // Coco2dTest2 // // Created by Ethan Mick on 3/14/10. // Copyright 2010 Wayfarer. All rights reserved. // #import "LifeChangeButtons.h" #import "cocos2d.h" #import "CustomCCNode.h" @implementation LifeChangeButtons @synthesize lifeChange; //Create the button +(id)lifeButton:(CCTexture2D *)texture { return [[[self alloc] initWithTexture:texture] autorelease]; } - (id)initWithTexture:(CCTexture2D *)atexture { if ((self = [super initWithTexture:atexture])) { //NSLog(@"wtf"); } return self; } //Set the text on the button - (void)buttonText:(int)number { lifeChange = [NSNumber numberWithInt:number]; NSString *text = [[NSString alloc] initWithFormat:@"%d", number]; CCLabel *label = [CCLabel labelWithString:text fontName:@"Times New Roman" fontSize:20]; label.position = CGPointMake(35, 20); [self addChild:label]; } - (CGRect)rect { CGSize s = [self.texture contentSize]; return CGRectMake(-s.width / 2, -s.height / 2, s.width, s.height); } - (BOOL)containsTouchLocation:(UITouch *)touch { return CGRectContainsPoint(self.rect, [self convertTouchToNodeSpaceAR:touch]); } - (void)onEnter { [[CCTouchDispatcher sharedDispatcher] addTargetedDelegate:self priority:0 swallowsTouches:YES]; [super onEnter]; } - (void)onExit { [[CCTouchDispatcher sharedDispatcher] removeDelegate:self]; [super onExit]; } - (BOOL)ccTouchBegan:(UITouch *)touch withEvent:(UIEvent *)event { CGPoint touchPoint = [touch locationInView:[touch view]]; touchPoint = [[CCDirector sharedDirector] convertToGL:touchPoint]; if ( ![self containsTouchLocation:touch] ) return NO; NSLog(@"Button touch event was called returning yes. "); //this is where we change the life to each selected player NSLog(@"Test1"); NSMutableArray *tempArray = [[[UIApplication sharedApplication] delegate] selectedPlayerObjects]; NSLog(@"Test2"); for (CustomCCNode *aPlayer in tempArray) { NSLog(@"we change the life by %d.", [lifeChange intValue]); [aPlayer changeLife:[lifeChange intValue]]; } NSLog(@"Test3"); return YES; } - (void)ccTouchMoved:(UITouch *)touch withEvent:(UIEvent *)event { CGPoint touchPoint = [touch locationInView:[touch view]]; touchPoint = [[CCDirector sharedDirector] convertToGL:touchPoint]; NSLog(@"You moved in a button!"); } - (void)ccTouchEnded:(UITouch *)touch withEvent:(UIEvent *)event { NSLog(@"You touched up in a button"); } @end Now, This function: - (BOOL)ccTouchBegan:(UITouch *)touch withEvent:(UIEvent *)event Is where all the shit goes down. It works for all of the buttons except the -5 one. And then, it gets to: NSLog(@"we change the life by %d.", [lifeChange integerValue]); And it crashes at that statement. It only crashes when given anything less than -1. -1 works, but nothing smaller does. Here is the code in the CustomCCNode Class, "changeLife" that is being called. - (void)changeLife:(int)lifeChange { NSLog(@"change life in Custom Class was called"); NSLog(@"wtf is lifechange: %d", lifeChange); life += lifeChange; lifeString = [[NSString alloc] initWithFormat:@"%d",life]; [text setString:lifeString]; } Straight forward, but when the NSnumber is -5, it doesn't even get called, it crashes at the NSlog statement. So... what's up with that?

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Powershell GUI: Adding multiple instances of .tooltipseperate to menu

  - by obious

  So, I'm having a problem whereby for some reason I can only add one instance of a .tooltipseperator to a drop down menu. E.g. I have to create a new .tooltipseperator if I want to add another to a different menu list. I have this: $seperator = new-object System.Windows.Forms.Toolstripseparator $seperator1 = new-object System.Windows.Forms.Toolstripseparator which correlates to this: [Void]$packages_menu_bar.DropDownItems.Add($seperator1) [Void]$packages_menu_bar.DropDownItems.Add($Remove_from_AD) [Void]$process.DropDownItems.Add($Kill_process) [Void]$process.DropDownItems.Add($seperator) My question is this: how can I add the same instance on a .tooltipseperater to different menu items? Some sort of array? Thanks

  Read the article

• [OpenGL] I'm having an issue to use GLshort for representing Vertex, and Normal.

  - by Xylopia

  As my project gets close to optimization stage, I notice that reducing Vertex Metadata could vastly improve the performance of 3D rendering. Eventually, I've dearly searched around and have found following advices from stackoverflow. Using GL_SHORT instead of GL_FLOAT in an OpenGL ES vertex array How do you represent a normal or texture coordinate using GLshorts? Advice on speeding up OpenGL ES 1.1 on the iPhone Simple experiments show that switching from "FLOAT" to "SHORT" for vertex and normal isn't tough, but what troubles me is when you're to scale back verticies to their original size (with glScalef), normals are multiplied by the reciprocal of the scale. Then how do you use "short" for both vertex and normal at the same time? I've been trying this and that for about a full day, but I could only go for "float vertex w/ byte normal" or "short vertex w/ float normal" so far. Your help would be truly appreciated.

  Read the article

< Previous Page | 494 495 496 497 498 499 500 501 502 503 504 505  | Next Page >