Search Results

Search found 16413 results on 657 pages for 'array manipulation'.

Page 498/657 | < Previous Page | 494 495 496 497 498 499 500 501 502 503 504 505  | Next Page >

• [OpenGL] I'm having an issue to use GLshort for representing Vertex, and Normal.

  - by Xylopia

  As my project gets close to optimization stage, I notice that reducing Vertex Metadata could vastly improve the performance of 3D rendering. Eventually, I've dearly searched around and have found following advices from stackoverflow. Using GL_SHORT instead of GL_FLOAT in an OpenGL ES vertex array How do you represent a normal or texture coordinate using GLshorts? Advice on speeding up OpenGL ES 1.1 on the iPhone Simple experiments show that switching from "FLOAT" to "SHORT" for vertex and normal isn't tough, but what troubles me is when you're to scale back verticies to their original size (with glScalef), normals are multiplied by the reciprocal of the scale. Then how do you use "short" for both vertex and normal at the same time? I've been trying this and that for about a full day, but I could only go for "float vertex w/ byte normal" or "short vertex w/ float normal" so far. Your help would be truly appreciated.

  Read the article

• Create spring beans, based on a comma-separated list of classes

  - by Jeroen

  Is there a way in Spring to create a collection, or array, of beans, based on a comma-separated list of classes. For example: package mypackage; public class Bla { private Set<MyBean> beans; public void setBeans(Set<MyBean> beans) { this.beans = beans; } } With the application context: <bean id="bla" class="mypackage.Bla"> <property name="beans"> <set> <bean class="mypackage.Bean1, mypackage.Bean2" /> </set> </property> </bean> Preferably the beans are all initialized and wired from the context, leaving the code as simplistic as possible, is this possible?

  Read the article

• What is the scope of JS variables in anonymous functions

  - by smorhaim

  Why does this code returns $products empty? If I test for $products inside the function it does show data... but once it finishes I can't seem to get the data. var $products = new Array(); connection.query($sql, function(err, rows, fields) { if (err) throw err; for(i=0; i< rows.length; i++) { $products[rows[i].source_identifier] = "xyz"; } }); connection.end(); console.log($products); // Shows empty.

  Read the article

• Marshal a list of objects from VB6 to C#

  - by Andrew

  I have a development which requires the passing of objects between a VB6 application and a C# class library. The objects are defined in the C# class library and are used as parameters for methods exposed by other classes in the same library. The objects all contain simple string/numeric properties and so marshaling has been relatively painless. We now have a requirement to pass an object which contains a list of other objects. If I was coding this in VB6 I might have a class containing a collection as a member variable. In C# I might have a class with a List member variable. Is it possible to construct a C# class in such a way that the VB6 application could populate this inner list and marshal it successfully? I don't have a lot of experience here but I would guess Id have to use an array of Object types.

  Read the article

• F#: Define an abstract class that inherits an infterface, but does not implement it

  - by akaphenom

  I owuld like to define an abstract class that inerhits from UserControl and my own Interface IUriProvider, but doesn't implement it. The goal is to be able to define pages (for silverlight) that implement UserControl but also provide their own Uri's (and then stick them in a list / array and deal with them as a set: type IUriProvider = interface abstract member uriString: String ; abstract member Uri : unit -> System.Uri ; end type UriUserControl() as this = inherit IUriProvider with abstract member uriString: String ; inherit UserControl() Also the Uri in the definition - I would like to implement as a property getter - and am having issues with that as well. this does not compile type IUriProvider = interface abstract member uriString: String with get; end Thank you...

  Read the article

• Difference between mutableArrayValueForKey and calling insertObject:inEmployeesAtIndex: directly

  - by jasonbogd

  I have a question regarding using KVO-compliant methods to insert/remove objects from an array. I'm working through Aaron Hillegass' Cocoa Programming for Mac OS X and I saw the following line of code (in the insertObject:inEmployeesAtIndex: method: [[undoManager prepareWithInvocationTarget:self] removeObjectFromEmployeesAtIndex:index]; Correct me if I'm wrong, but I always thought it was better to call mutableArrayValueForKey: and then removeObjectAtIndex:...so I tried changing the above line to this: [[undoManager prepareWithInvocationTarget:[self mutableArrayValueForKey:@"employees"]] removeObjectAtIndex:index]; And it didn't work. Can someone explain the difference and why the first line works but the second line doesn't?

  Read the article

• Memory leak with preg_replace

  - by Silvio Donnini

  I'm using the preg_replace function to replace accents in a string, I'm working with UTF-8. I have incurred in what seems to be a memory leak, but I can't isolate the root cause, my code is rather simple: preg_replace( array_keys($aToNoAccents), array_values($aToNoAccents), $sText ); where $aToNoAccents is an associative array with entries like '~[A]~u' => 'A', '~[C]~u' => 'C',. My script prints this error for the above line: Fatal error: Allowed memory size of 1073741824 bytes exhausted (tried to allocate 3039 bytes) Obviously it's not a matter of increasing the allowed memory for PHP, (a 1Gb footprint is way off the scale of my application). Also, that line is executed thousands of times without problems but, just for some cases which are difficult to reproduce, it yields the error. Is anyone aware of memory problems with preg_replace and UTF-8 strings? Am I to use special care in passing actual parameters to such function? I'm using PHP 5.2.6-3 with Suhosin-Patch thanks Silvio

  Read the article

• Building resultset using collection object

  - by Bhaskara Krishna Mohan Potam

  Hi, I had an issue in building the resultset using java. Here it goes... I am storing a collection object which is organized as row wise taken from a resultset object and putting the collection object(which is stored as vector/array list) in cache and trying to retrieve the same collection object. Here i need to build back the resultset again using the collection object. Now my doubt is building the resultset in this way possible or not? Please let me know asap. Thanks in advance, Bhaskar

  Read the article

• Replacing backslash with another symbol in PHP

  - by Skyfe

  Hi there, Been struggling with replacing a backslash by another symbol such as '.-.' just to indicate the position of backslashes as I could not send a string such as 'C\xampp\etc.' through url as GET variable so I thought I'd first replace the backslashes in that string by another symbol, then send through url, and then replace them back to backslashes in the PHP file that handles it. Though would there be a better way to send such strings through url? Because when I try a script such as: $tmp_name = preg_replace("\", ".-.", $_FILES['uploadfile']['tmp_name']); It turns out into a php error as \ is also used as delimiter.. Could anyone help me out on this? Thanks in advanced! Btw, if I'd be able to send a full array through url, this whole problem would be solved, but I don't think it's possible?

  Read the article

• Animation issue caused by C# parameters passed by reference rather than value, but where?

  - by Jordan Roher

  I'm having trouble with sprite animation in XNA that appears to be caused by a struct passed as a reference value. But I'm not using the ref keyword anywhere. I am, admittedly, a C# noob, so there may be some shallow bonehead error in here, but I can't see it. I'm creating 10 ants or bees and animating them as they move across the screen. I have an array of animation structs, and each time I create an ant or bee, I send it the animation array value it requires (just [0] or [1] at this time). Deep inside the animation struct is a timer that is used to change frames. The ant/bee class stores the animation struct as a private variable. What I'm seeing is that each ant or bee uses the same animation struct, the one I thought I was passing in and copying by value. So during Update(), when I advance the animation timer for each ant/bee, the next ant/bee has its animation timer advanced by that small amount. If there's 1 ant on screen, it animates properly. 2 ants, it runs twice as fast, and so on. Obviously, not what I want. Here's an abridged version of the code. How is BerryPicking's ActorAnimationGroupData[] getting shared between the BerryCreatures? class BerryPicking { private ActorAnimationGroupData[] animations; private BerryCreature[] creatures; private Dictionary<string, Texture2D> creatureTextures; private const int maxCreatures = 5; public BerryPickingExample() { this.creatures = new BerryCreature[maxCreatures]; this.creatureTextures = new Dictionary<string, Texture2D>(); } public void LoadContent() { // Returns data from an XML file Reader reader = new Reader(); animations = reader.LoadAnimations(); CreateCreatures(); } // This is called from another function I'm not including because it's not relevant to the problem. // In it, I remove any creature that passes outside the viewport by setting its creatures[] spot to null. // Hence the if(creatures[i] == null) test is used to recreate "dead" creatures. Inelegant, I know. private void CreateCreatures() { for (int i = 0; i < creatures.Length; i++) { if (creatures[i] == null) { // In reality, the name selection is randomized creatures[i] = new BerryCreature("ant"); // Load content and texture (which I create elsewhere) creatures[i].LoadContent( FindAnimation(creatures[i].Name), creatureTextures[creatures[i].Name]); } } } private ActorAnimationGroupData FindAnimation(string animationName) { int yourAnimation = -1; for (int i = 0; i < animations.Length; i++) { if (animations[i].name == animationName) { yourAnimation = i; break; } } return animations[yourAnimation]; } public void Update(GameTime gameTime) { for (int i = 0; i < creatures.Length; i++) { creatures[i].Update(gameTime); } } } class Reader { public ActorAnimationGroupData[] LoadAnimations() { ActorAnimationGroupData[] animationGroup; XmlReader file = new XmlTextReader(filename); // Do loading... // Then later file.Close(); return animationGroup; } } class BerryCreature { private ActorAnimation animation; private string name; public BerryCreature(string name) { this.name = name; } public void LoadContent(ActorAnimationGroupData animationData, Texture2D sprite) { animation = new ActorAnimation(animationData); animation.LoadContent(sprite); } public void Update(GameTime gameTime) { animation.Update(gameTime); } } class ActorAnimation { private ActorAnimationGroupData animation; public ActorAnimation(ActorAnimationGroupData animation) { this.animation = animation; } public void LoadContent(Texture2D sprite) { this.sprite = sprite; } public void Update(GameTime gameTime) { animation.Update(gameTime); } } struct ActorAnimationGroupData { // There are lots of other members of this struct, but the timer is the only one I'm worried about. // TimerData is another struct private TimerData timer; public ActorAnimationGroupData() { timer = new TimerData(2); } public void Update(GameTime gameTime) { timer.Update(gameTime); } } struct TimerData { public float currentTime; public float maxTime; public TimerData(float maxTime) { this.currentTime = 0; this.maxTime = maxTime; } public void Update(GameTime gameTime) { currentTime += (float)gameTime.ElapsedGameTime.TotalSeconds; if (currentTime >= maxTime) { currentTime = maxTime; } } }

  Read the article

• How can I use a variable as a module name in Perl?

  - by mjn12

  I know it is possible to use a variable as a variable name for package variables in Perl. I would like to use the contents of a variable as a module name. For instance: package Foo; our @names =("blah1", "blah2"); 1; And in another file I want to be able be able to set the contents of a scalar to "foo" and then access the names array in Foo through that scalar. my $packageName = "Foo"; Essentially I want to do something along the lines of: @{$packageName}::names; #This obviously doesn't work. I know I can use my $names = eval '$'. $packageName . "::names" But only if Foo::names is a scalar. Is there another way to do this without the eval statement?

  Read the article

• Memory in Eclipse

  - by user247866

  I'm getting the java.lang.OutOfMemoryError exception in Eclipse. I know that Eclipse by default uses heap size of 256M. I'm trying to increase it but nothing happens. For example: eclipse -vmargs -Xmx16g -XX:PermSize=2g -XX:MaxPermSize=2g I also tried different settings, using only the -Xmx option, using different cases of g, G, m, M, different memory sizes, but nothing helps. Does not matter which params I specify, the heap exception is thrown at the same time, so I assume there's something I'm doing wrong that Eclipse ignores the -Xmx parameter. I'm using a 32GB RAM machine and trying to execute something very simple such as: double[][] a = new double[15000][15000]; It only works when I reduce the array size to something around 10000 on 10000. I'm working on Linux and using the top command I can see how much memory the Java process is consuming; it's less than 2%. Thanks!

  Read the article

• Best way to parse command line arguments in C#

  - by Paul Stovell

  When building console applications that take parameters, you can use the arguments passed to Main(string[] args). In the past I've simply indexed/looped that array and done a few regular expressions to extract the values. However, when the commands get more complicated, the parsing can get pretty ugly. More recently, I built the world's simplest Backus-Naur Form parser in C# to parse the arguments. It does the job, but it also feels like overkill. So I'm interested in: Libraries that you use Patterns that you use Assume the commands always adhere to common standards such as answered here.

  Read the article

• Multiple key/value pairs in HTTP POST where key is the same name

  - by randombits

  I'm working on an API that accepts data from remote clients, some of which where the key in an HTTP POST almost functions as an array. In english what this means is say I have a resource on my server called "class". A class in this sense, is the type a student sits in and a teacher educates in. When the user submits an HTTP POST to create a new class for their application, a lot of the key value pairs look like: student_name: Bob Smith student_name: Jane Smith student_name: Chris Smith What's the best way to handle this on both the client side (let's say the client is cURL or ActiveResource, whatever..) and what's a decent way of handling this on the server-side if my server is a Ruby on Rails app? Need a way to allow for multiple keys with the same name and without any namespace clashing or loss of data.

  Read the article

• Using UIImageView for a flipbook anim on iphone

  - by Joey

  I'm using UIImageView to run a flipbook anim like this: mIntroAnimFrame = [[UIImageView alloc] initWithFrame:CGRectMake( 0, 0, 480, 320); mIntroAnimFrame.image = [UIImage imageNamed:@"frame0000.tif"]; Basically, when determine it is time, I flip the image by just calling: mIntroAnimFrame.image = [UIImage imageNamed:@"frame0000.tif"]; again with the right frame. Should I be doing this differently? Are repeated calls to set the image this way possibly bogging down main memory, or does each call essentially free the previous UIImage because nothing else references it? I suspect the latter is true. Also, is there an easy way to preload the images? The anim seems to slow down at times. Should I simply load all the images into a dummy UIImage array so they are preloaded, then refer to it when I want to show it with mIntroAnimFrame.image = mPreloadedArray[i]; ?

  Read the article

• Can't get my head around background workers in .NET

  - by Connel

  I have wrote an application that syncs two folders together. The problem with the program is that it stops responding whilst copying files. A quick search of stack-overflow told me I need to use something called a background worker. I have read a few pages on the net about this but find it really hard to understand as I'm pretty new to programming. Below is the code for my application - how can I simply put all of the File.Copy(....) commands into their own background worker (if that's even how it works)? Below is the code for the button click event that runs the sub procedure and the sub procedure I wish to use a background worker on all the File.Copy lines. Button event: protected virtual void OnBtnSyncClicked (object sender, System.EventArgs e) { //sets running boolean to true booRunning=true; //sets progress bar to 0 prgProgressBar.Fraction = 0; //resets values used by progressbar dblCurrentStatus = 0; dblFolderSize = 0; //tests if user has entered the same folder for both target and destination if (fchDestination.CurrentFolder == fchTarget.CurrentFolder) { //creates message box MessageDialog msdSame = new MessageDialog(this, DialogFlags.Modal, MessageType.Error, ButtonsType.Close, "You cannot sync two folders that are the same"); //sets message box title msdSame.Title="Error"; //sets respone type ResponseType response = (ResponseType) msdSame.Run(); //if user clicks on close button or closes window then close message box if (response == ResponseType.Close || response == ResponseType.DeleteEvent) { msdSame.Destroy(); } return; } //tests if user has entered a target folder that is an extension of the destination folder // or if user has entered a desatination folder that is an extension of the target folder if (fchTarget.CurrentFolder.StartsWith(fchDestination.CurrentFolder) || fchDestination.CurrentFolder.StartsWith(fchTarget.CurrentFolder)) { //creates message box MessageDialog msdContains = new MessageDialog(this, DialogFlags.Modal, MessageType.Error, ButtonsType.Close, "You cannot sync a folder with one of its parent folders"); //sets message box title msdContains.Title="Error"; //sets respone type and runs message box ResponseType response = (ResponseType) msdContains.Run(); //if user clicks on close button or closes window then close message box if (response == ResponseType.Close || response == ResponseType.DeleteEvent) { msdContains.Destroy(); } return; } //gets folder size of target folder FileSizeOfTarget(fchTarget.CurrentFolder); //gets folder size of destination folder FileSizeOfDestination(fchDestination.CurrentFolder); //runs SyncTarget procedure SyncTarget(fchTarget.CurrentFolder); //runs SyncDestination procedure SyncDestination(fchDestination.CurrentFolder); //informs user process is complete prgProgressBar.Text = "Finished"; //sets running bool to false booRunning = false; } Sync sub-procedure: protected void SyncTarget (string strCurrentDirectory) { //string array of all the directories in directory string[] staAllDirectories = Directory.GetDirectories(strCurrentDirectory); //string array of all the files in directory string[] staAllFiles = Directory.GetFiles(strCurrentDirectory); //loop over each file in directory foreach (string strFile in staAllFiles) { //string of just the file's name and not its path string strFileName = System.IO.Path.GetFileName(strFile); //string containing directory in target folder string strDirectoryInsideTarget = System.IO.Path.GetDirectoryName(strFile).Substring(fchTarget.CurrentFolder.Length); //inform user as to what file is being copied prgProgressBar.Text="Syncing " + strFile; //tests if file does not exist in destination folder if (!File.Exists(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName)) { //if file does not exist copy it to destination folder, the true below means overwrite if file already exists File.Copy (strFile, fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName, true); } //tests if file does exist in destination folder if (File.Exists(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName)) { //long (number) that contains date of last write time of target file long lngTargetFileDate = File.GetLastWriteTime(strFile).ToFileTime(); //long (number) that contains date of last write time of destination file long lngDestinationFileDate = File.GetLastWriteTime(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName).ToFileTime(); //tests if target file is newer than destination file if (lngTargetFileDate > lngDestinationFileDate) { //if it is newer then copy file from target folder to destination folder File.Copy (strFile, fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName, true); } } //gets current file size FileInfo FileSize = new FileInfo(strFile); //sets file's filesize to dblCurrentStatus and adds it to current total of files dblCurrentStatus = dblCurrentStatus + FileSize.Length; double dblPercentage = dblCurrentStatus/dblFolderSize; prgProgressBar.Fraction = dblPercentage; } //loop over each folder in target folder foreach (string strDirectory in staAllDirectories) { //string containing directories inside target folder but not any higher directories string strDirectoryInsideTarget = strDirectory.Substring(fchTarget.CurrentFolder.Length); //tests if directory does not exist inside destination folder if (!Directory.Exists(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget)) { //it directory does not exisit create it Directory.CreateDirectory(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget); } //run sync on all files in directory SyncTarget(strDirectory); } } Any help will be greatly appreciated as after this the program will pretty much be finished :D

  Read the article

• Compatibility issues with <a> and calling a function(); across different web browsers

  - by Matthew

  Hi, I am new to javascript. I wrote the following function rollDice() to produce 5 random numbers and display them. I use an anchor with click event to call the function. Problem is, in Chrome it won't display, works fine in IE, in firefox the 5 values display and then the original page w/anchor appears! I am suspicious that my script tag is too general but I am really lost. Also if there is a display function that doesn't clear the screen first that would be great. diceArray = new Array(5) function rollDice() { var i; for(i=0; i<5; i++) { diceArray[i]=Math.round(Math.random() * 6) % 6 + 1; document.write(diceArray[i]); } } when I click should display 5 rand variables

  Read the article

• CommunicationException in WCF

  - by user343159

  Hi I have a problem with a WCF Service I've just created. This was working yesterday but for some reason it's just stopped working. One of my WCF methods returns an array of an Entity Framework entity, like this: public BranchContactDetail[] GetClosestBranches(string postcode, int howManyBranches) { GeoLocation geoLocation = GetLocationFromPostcode(postcode); Location location = new Location(geoLocation.Latitude, geoLocation.Longitude); using (BranchDirectoryEntities entities = new BranchDirectoryEntities()) { var branchesInOrder = entities.BranchContactDetails .Where(b => b.latitude.HasValue && b.longitude.HasValue ) .OrderBy(b => location.DistanceFrom(b.latitude, b.longitude)) .Take(howManyBranches) .ToArray(); return branchesInOrder; } } ...and, as I say, this was working fine yesterday. Now I'm getting a "The underlying connection was closed: The connection was closed unexpectedly." I've hunted all over the web but no-one seems to know the answer. Anyone shed any light on this issue? Regards, Mark

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Why does my program crash when given negative values?

  - by Wayfarer

  Alright, I am very confused, so I hope you friends can help me out. I'm working on a project using Cocos2D, the most recent version (.99 RC 1). I make some player objects and some buttons to change the object's life. But the weird thing is, the code crashes when I try to change their life by -5. Or any negative value for that matter, besides -1. NSMutableArray *lifeButtons = [[NSMutableArray alloc] init]; CCTexture2D *buttonTexture = [[CCTextureCache sharedTextureCache] addImage:@"Button.png"]; LifeChangeButtons *button = nil; //top left button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(50 , size.height - 30); [button buttonText:-5]; [lifeButtons addObject:button]; //top right button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(size.width - 50 , size.height - 30); [button buttonText:1]; [lifeButtons addObject:button]; //bottom left button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(50 , 30); [button buttonText:5]; [lifeButtons addObject:button]; //bottom right button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(size.width - 50 , 30); [button buttonText:-1]; [lifeButtons addObject:button]; for (LifeChangeButtons *theButton in lifeButtons) { [self addChild:theButton]; } This is the code that makes the buttons. It simply makes 4 buttons, puts them in each corner of the screen (size is the screen) and adds their life change ability, 1,-1,5, or -5. It adds them to the array and then goes through the array at the end and adds all of them to the screen. This works fine. Here is my code for the button class: (header file) // // LifeChangeButtons.h // Coco2dTest2 // // Created by Ethan Mick on 3/14/10. // Copyright 2010 Wayfarer. All rights reserved. // #import "cocos2d.h" @interface LifeChangeButtons : CCSprite <CCTargetedTouchDelegate> { NSNumber *lifeChange; } @property (nonatomic, readonly) CGRect rect; @property (nonatomic, retain) NSNumber *lifeChange; + (id)lifeButton:(CCTexture2D *)texture; - (void)buttonText:(int)number; @end Implementation file: // // LifeChangeButtons.m // Coco2dTest2 // // Created by Ethan Mick on 3/14/10. // Copyright 2010 Wayfarer. All rights reserved. // #import "LifeChangeButtons.h" #import "cocos2d.h" #import "CustomCCNode.h" @implementation LifeChangeButtons @synthesize lifeChange; //Create the button +(id)lifeButton:(CCTexture2D *)texture { return [[[self alloc] initWithTexture:texture] autorelease]; } - (id)initWithTexture:(CCTexture2D *)atexture { if ((self = [super initWithTexture:atexture])) { //NSLog(@"wtf"); } return self; } //Set the text on the button - (void)buttonText:(int)number { lifeChange = [NSNumber numberWithInt:number]; NSString *text = [[NSString alloc] initWithFormat:@"%d", number]; CCLabel *label = [CCLabel labelWithString:text fontName:@"Times New Roman" fontSize:20]; label.position = CGPointMake(35, 20); [self addChild:label]; } - (CGRect)rect { CGSize s = [self.texture contentSize]; return CGRectMake(-s.width / 2, -s.height / 2, s.width, s.height); } - (BOOL)containsTouchLocation:(UITouch *)touch { return CGRectContainsPoint(self.rect, [self convertTouchToNodeSpaceAR:touch]); } - (void)onEnter { [[CCTouchDispatcher sharedDispatcher] addTargetedDelegate:self priority:0 swallowsTouches:YES]; [super onEnter]; } - (void)onExit { [[CCTouchDispatcher sharedDispatcher] removeDelegate:self]; [super onExit]; } - (BOOL)ccTouchBegan:(UITouch *)touch withEvent:(UIEvent *)event { CGPoint touchPoint = [touch locationInView:[touch view]]; touchPoint = [[CCDirector sharedDirector] convertToGL:touchPoint]; if ( ![self containsTouchLocation:touch] ) return NO; NSLog(@"Button touch event was called returning yes. "); //this is where we change the life to each selected player NSLog(@"Test1"); NSMutableArray *tempArray = [[[UIApplication sharedApplication] delegate] selectedPlayerObjects]; NSLog(@"Test2"); for (CustomCCNode *aPlayer in tempArray) { NSLog(@"we change the life by %d.", [lifeChange intValue]); [aPlayer changeLife:[lifeChange intValue]]; } NSLog(@"Test3"); return YES; } - (void)ccTouchMoved:(UITouch *)touch withEvent:(UIEvent *)event { CGPoint touchPoint = [touch locationInView:[touch view]]; touchPoint = [[CCDirector sharedDirector] convertToGL:touchPoint]; NSLog(@"You moved in a button!"); } - (void)ccTouchEnded:(UITouch *)touch withEvent:(UIEvent *)event { NSLog(@"You touched up in a button"); } @end Now, This function: - (BOOL)ccTouchBegan:(UITouch *)touch withEvent:(UIEvent *)event Is where all the shit goes down. It works for all of the buttons except the -5 one. And then, it gets to: NSLog(@"we change the life by %d.", [lifeChange integerValue]); And it crashes at that statement. It only crashes when given anything less than -1. -1 works, but nothing smaller does. Here is the code in the CustomCCNode Class, "changeLife" that is being called. - (void)changeLife:(int)lifeChange { NSLog(@"change life in Custom Class was called"); NSLog(@"wtf is lifechange: %d", lifeChange); life += lifeChange; lifeString = [[NSString alloc] initWithFormat:@"%d",life]; [text setString:lifeString]; } Straight forward, but when the NSnumber is -5, it doesn't even get called, it crashes at the NSlog statement. So... what's up with that?

  Read the article

• Sending POST variables through a PHP proxy for AJAX?

  - by b. e. hollenbeck

  I've decided that using a PHP proxy for AJAX calls for a project is the best way to go - but I have a question regarding passing POST data through the proxy. As in - how to do it. Should I need to create a single variable in the javascript using alternate characters, then have the PHP proxy parse and modify the variable to reassemble a valid HTTP request? Or is there some means of passing along the $_POST array in new request to the external server by pulling the data out of the headers and re-sending it?

  Read the article

• Make object available within php functions without passing them or making them global

  - by Matt

  Hey all, This requirement is just for simplicity for developers and beautiful code. I'm building a template system and I really would just like an object variable to simply be there in all functions. Here's some code: Librarian.php: $class = "slideshow"; $function = "basic"; $args = array(...); $librarian = $this; // I WOULD LIKE THIS TO BE PRESENT IN CALLED FUNCTION ... return call_user_func($class.'::'.$function, $args); ... Slideshow.php: public static function basic($args) { echo $librarian; // "Librarian Object" } Thanks! Matt Mueller

  Read the article

• Completion block not being called. How to check validity?

  - by HCHogan

  I have this method which takes a block, but that block isn't always called. See the method: - (void)updateWithCompletion:(void (^)(void))completion { [MYObject myMethodWithCompletion:^(NSArray *array, NSError *error) { if (error) { NSLog(@"%s, ERROR not nil", __FUNCTION__); completion(); return; } NSLog(@"%s, calling completion %d", __FUNCTION__, &completion); completion(); NSLog(@"%s, finished completion", __FUNCTION__); }]; } I have some more NSLogs inside completion. Sometimes this program counter just blows right past the call to completion() in the code above. I don't see why this would be as the calling code always passes a literal block of code as input. If you're curious of the output of the line containing the addressof operator, it's always something different, but never 0 or nil. What would cause completion not to be executed?

  Read the article

• Rendering a variable with erb.

  - by TZer0

  I've got the following problem: I have rhtml (html minced together with ruby inside <% % and <%= % tags) stored in a database which I want to render. The information is acquired through a query. I need to be able to evaluate the information I get from the database as though as it was normal content inside the .erb-file. What I currently have: <% @mymods.each do |mod| %> <%= render_text(mod["html"])%> <% end %> Where mod["html"] is the variable containing the rhtml-code and @mymods an array of objects from the query. I have currently no idea what function I should use (render_text does, of course, not work). Help is greatly appreciated. /TZer0

  Read the article

• Help needed with Javascript Variable Scope / OOP and Call Back Functions

  - by gargantaun

  I think this issue goes beyond typical variable scope and closure stuff, or maybe I'm an idiot. Here goes anyway... I'm creating a bunch of objects on the fly in a jQuery plugin. The object look something like this function WedgePath(canvas){ this.targetCanvas = canvas; this.label; this.logLabel = function(){ console.log(this.label) } } the jQuery plugin looks something like this (function($) { $.fn.myPlugin = function() { return $(this).each(function() { // Create Wedge Objects for(var i = 1; i <= 30; i++){ var newWedge = new WedgePath(canvas); newWedge.label = "my_wedge_"+i; globalFunction(i, newWedge]); } }); } })(jQuery); So... the plugin creates a bunch of wedgeObjects, then calls 'globalFunction' for each one, passing in the latest WedgePath instance. Global function looks like this. function globalFunction(indicator_id, pWedge){ var targetWedge = pWedge; targetWedge.logLabel(); } What happens next is that the console logs each wedges label correctly. However, I need a bit more complexity inside globalFunction. So it actually looks like this... function globalFunction(indicator_id, pWedge){ var targetWedge = pWedge; someSql = "SELECT * FROM myTable WHERE id = ?"; dbInterface.executeSql(someSql, [indicator_id], function(transaction, result){ targetWedge.logLabel(); }) } There's a lot going on here so i'll explain. I'm using client side database storage (WebSQL i call it). 'dbInterface' an instance of a simple javascript object I created which handles the basics of interacting with a client side database [shown at the end of this question]. the executeSql method takes up to 4 arguments The SQL String an optional arguments array an optional onSuccess handler an optional onError handler (not used in this example) What I need to happen is: When the WebSQL query has completed, it takes some of that data and manipulates some attribute of a particular wedge. But, when I call 'logLabel' on an instance of WedgePath inside the onSuccess handler, I get the label of the very last instance of WedgePath that was created way back in the plugin code. Now I suspect that the problem lies in the var newWedge = new WedgePath(canvas); line. So I tried pushing each newWedge into an array, which I thought would prevent that line from replacing or overwriting the WedgePath instance at every iteration... wedgeArray = []; // Inside the plugin... for(var i = 1; i <= 30; i++){ var newWedge = new WedgePath(canvas); newWedge.label = "my_wedge_"+i; wedgeArray.push(newWedge); } for(var i = 0; i < wedgeArray.length; i++){ wedgeArray[i].logLabel() } But again, I get the last instance of WedgePath to be created. This is driving me nuts. I apologise for the length of the question but I wanted to be as clear as possible. END ============================================================== Also, here's the code for dbInterface object should it be relevant. function DatabaseInterface(db){ var DB = db; this.sql = function(sql, arr, pSuccessHandler, pErrorHandler){ successHandler = (pSuccessHandler) ? pSuccessHandler : this.defaultSuccessHandler; errorHandler = (pErrorHandler) ? pErrorHandler : this.defaultErrorHandler; DB.transaction(function(tx){ if(!arr || arr.length == 0){ tx.executeSql(sql, [], successHandler, errorHandler); }else{ tx.executeSql(sql,arr, successHandler, errorHandler) } }); } // ---------------------------------------------------------------- // A Default Error Handler // ---------------------------------------------------------------- this.defaultErrorHandler = function(transaction, error){ // error.message is a human-readable string. // error.code is a numeric error code console.log('WebSQL Error: '+error.message+' (Code '+error.code+')'); // Handle errors here var we_think_this_error_is_fatal = true; if (we_think_this_error_is_fatal) return true; return false; } // ---------------------------------------------------------------- // A Default Success Handler // This doesn't do anything except log a success message // ---------------------------------------------------------------- this.defaultSuccessHandler = function(transaction, results) { console.log("WebSQL Success. Default success handler. No action taken."); } }

  Read the article

< Previous Page | 494 495 496 497 498 499 500 501 502 503 504 505  | Next Page >