Search Results

Search found 16413 results on 657 pages for 'array manipulation'.

Page 499/657 | < Previous Page | 495 496 497 498 499 500 501 502 503 504 505 506  | Next Page >

• How to get ouput from expect

  - by Mallikarjunarao

  i wrote a script for spawing the bc command package require Expect proc bc {eq} { spawn e:/GnuWin32/bc/bin/bc send "$eq\r" expect -re "(.*)\r" return "$expect_out(0,string)" } set foo "9487294387234/sqrt(394872394879847293847)" puts "the valule [bc $foo]" how to get the output from this. When i am running this one i get ouput like this bc 1.06 Copyright 1991-1994, 1997, 1998, 2000 Free Software Foundation, Inc. This is free software with ABSOLUTELY NO WARRANTY. For details type `warranty'. 9487294387234/sqrt(394872394879847293847) 477 can't read "expect_out(0,string)": no such element in array while executing "return "The values is $expect_out(0,string)"" (procedure "bc" line 6) invoked from within "bc $foo" invoked from within "puts "the valule [bc $foo]"" (file "bc.tcl" line 21) how to resolve this one.

  Read the article

• $.(ajax) wrapper for Jquery - passing parameters to delegates

  - by gnomixa

  I use $.(ajax) function extensively in my app to call ASP.net web services. I would like to write a wrapper in order to centralize all the ajax calls. I found few simple solutions, but none address an issue of passing parameters to delegates, for example, if i have: $.ajax({ type: "POST", url: "http://localhost/TemplateWebService/TemplateWebService/Service.asmx/GetFoobar", data: jsonText, contentType: "application/json; charset=utf-8", dataType: "json", success: function(response) { var results = (typeof response.d) == 'string' ? eval('(' + response.d + ')') : response.d; OnSuccess(results, someOtherParam1, someOtherParam2); }, error: function(xhr, status, error) { OnError(); } }); The wrapper to this call would have to have the way to pass someOtherParam1, someOtherParam2 to the OnSuccess delegate...Aside from packing the variables into a generic array, I can't think of other solutions. How did you guys address this issue?

  Read the article

• Completion block not being called. How to check validity?

  - by HCHogan

  I have this method which takes a block, but that block isn't always called. See the method: - (void)updateWithCompletion:(void (^)(void))completion { [MYObject myMethodWithCompletion:^(NSArray *array, NSError *error) { if (error) { NSLog(@"%s, ERROR not nil", __FUNCTION__); completion(); return; } NSLog(@"%s, calling completion %d", __FUNCTION__, &completion); completion(); NSLog(@"%s, finished completion", __FUNCTION__); }]; } I have some more NSLogs inside completion. Sometimes this program counter just blows right past the call to completion() in the code above. I don't see why this would be as the calling code always passes a literal block of code as input. If you're curious of the output of the line containing the addressof operator, it's always something different, but never 0 or nil. What would cause completion not to be executed?

  Read the article

• Sales figures not displayed in form

  - by Brian Wilson

  Trying to calculate total sales for 5 items, 3 stores. Here's a s/s of what Im getting, along with my code. What am I missing/doing wrong? (p.s. It's not returning an error code in 'debug') Public Class Form1 Private Sub btnCalc_Click(sender As Object, e As EventArgs) Handles btnCalc.Click Dim ttlsales As Double 'set up array data Dim sales(,) As Integer = {{25, 64, 23, 45, 14}, {12, 82, 19, 34, 63}, {54, 22, 17, 43, 35}} Dim price() As Double = {12.0, 17.95, 95.0, 86.5, 78.0} 'mark totals Dim totals(2) As Double For store As Integer = 0 To 2 For item As Integer = 0 To 4 Next Next 'display output lstOut.Items.Add("Sales Per Store") For store As Integer = 0 To 2 lstOut.Items.Add(store + 1 & ":" & FormatCurrency(totals(store))) ttlsales += totals(store) Next lstOut.Items.Add("Total Sales: " & FormatCurrency(ttlsales)) End Sub End Class

  Read the article

• Defining a dd/mm/yyyy field within an abstract table model

  - by Simon Andi

  I have defined an abstract table model but one of the columns should house date values as dd/mm/yyyy format not sure how to do this. I have a external global file and have hard coded the dates as dd/mm/yyyy. How can I define this column within my abstract table model so that to only allow only dates having dd/mm/yyyy format. public class OptraderGlobalParameters { public static boolean DEBUG = true; //Set DEBUG = true for Debugging /*=========================*/ /*Table Array For Dividends*/ /*=========================*/ public static String[] columnNames = {"Date", "Dividend", "Actual", "Yield (%)" }; public static Object[][] data = { {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, }; }

  Read the article

• (External) Java library for creating Tree structure ?

  - by suVasH.....

  I am planning to implement a tree structure where every node has two children and a parent along with various other node properties (and I'd want to do this in Java ) Now, the way to it probably is to create the node such that it links to other nodes ( linked list trick ), but I was wondering if there is any good external library to handle all this low level stuff. ( for eg. the ease of stl::vector vs array in C++ ). I've heard of JDots, but still since i haven't started (and haven't programmed a lot in Java), I'd rather hear out before I begin.

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Output to jTextArea in realtime

  - by Robert

  I have some code which takes a few minutes to process, it has to connect to the web for each string in a long array, each string is a url. I want to make it so that everytime it connects, it should refresh the jtextarea so that the user is not staring into a blank page that looks frozen for 20 min. or however long it takes. here is an example of something i tried and didnt work: try { ArrayList<String> myLinks = LinkParser.getmyLinksArray(jTextArea1.getText()); for (String s : myLinks) { jTextArea2.append(LinkChecker.checkFileStatus(s) + "\n"); } } catch (IOException ex) { JOptionPane.showMessageDialog(jTextArea1, "Parsing Error", "Parsing Error", JOptionPane.ERROR_MESSAGE); Logger.getLogger(MYView.class.getName()).log(Level.SEVERE, null, ex); }

  Read the article

• runtime loading of ValidateAntiForgeryToken Salt value

  - by p.campbell

  Consider an ASP.NET MVC application using the Salt parameter in the [ValidateAntiForgeryToken] directive. The scenario is such that the app will be used by many customers. It's not terribly desirable to have the Salt known at compile time. The current strategy is to locate the Salt value in the web.config. [ValidateAntiForgeryToken(Salt = Config.AppSalt)] //Config.AppSalt is a static property that reads the web.config. This leads to a compile-time exception suggesting that the Salt must be a const at compile time. An attribute argument must be a constant expression, typeof expression or array creation expression of an attribute parameter type How can I modify the application to allow for a runtime loading of the Salt so that the app doesn't have to be re-salted and recompiled for each customer? Consider that the Salt won't change frequently, if at all, thereby removing the possibility of invalidating form

  Read the article

• how to get last inserted id - zend

  - by Lemon

  I'm trying to get latest inserted id from a table using this code: $id = $tbl->fetchAll (array('public=1'), 'id desc'); but it's always returning "1" any ideas? update: I've just discovered toArray();, which retrieves all the data from fetchAll. The problem is, I only need the ID. My current code looks like this: $rowsetArray = $id->toArray(); $rowCount = 1; foreach ($rowsetArray as $rowArray) { foreach ($rowArray as $column => $value) { if ($column="id") {$myid[$brr] = $value;} //echo"\n$myid[$brr]"; } ++$rowCount; ++$brr; } Obviously, I've got the if ($column="id") {$myid[$brr] = $value;} thing wrong. Can anyone point me in the right direction? An aternative would be to filter ID's from fetchAll. Is that possible?

  Read the article

• Estimate serialization size of objects?

  - by Stefan K.

  In my thesis, I woud like to enhance messaging in a cluster. It's important to log runtime information about how big a message is (should I prefer processing local or remote). I could just find frameoworks about estimating the object memory size based on java instrumentation. I've tested classmexer, which didn't come close to the serialization size and sourceforge SizeOf. In a small testcase, SizeOf was around 10% wrong and 10x faster than serialization. (Still transient breaks the estimation completely and since e.g. ArrayList is transient but is serialized as an Array, it's not easy to patch SizeOf. But I could live with that) On the other hand, 10x faster with 10% error doesn't seem very good. Any ideas how I could do better?

  Read the article

• How do I include 2 tables in one LocalStorage item?

  - by Noor

  I've got a table that you can edit, and I've got a simple code saving that list when you're done with editing it. (the tables have the contenteditable on) The problem I've stumbled upon is that if I double click on enter, the table gets divided into two separate tables with the same ID. This causes the code I'm using to set the localStorage to only store one of the tables (I assume the first).. I've thought of different solutions and I wonder if someone could point out the pro's and con's (if the solutions even works that is). Make a loop that checks the page after tables and stores them into an array of localStorage-items.. I'd have to dynamically create a localStorage item for each table. Take the whole div that the tables are in, and store that in the localStorage, when a user revisits the page, the page checks after the items in storage and displays the whole divs. Any suggestions you have that can beat this :).. (but no cache, it has to be with the localStorage!) Thanks

  Read the article

• PHP anonymous functions scope question

  - by Dan

  Hi, I'm trying to sort an array of objects by a common property, however I cannot get my $property parameter to register in the inner function (I can use it in the outer one OK). The way I read the documentation, it sounded like the parameter would be available, have I misunderstood something? Here is what I have: public static function sortObjectsByProperty($objects, $property) { function compare_object($a, $b) { $a = $a->$property; $b = $b->$property; if ($a->$property == $b->$property) { return 0; } return ($a->$property > $b->$property) ? +1 : -1; } usort($objects, 'compare_object'); return $objects; } Any advice appreciated. Thanks.

  Read the article

• A controller problem using a base CRUD model

  - by rkj

  In CodeIgniter I'm using a base CRUD My_model, but I have this small problem in my browse-controller.. My $data['posts'] gets all posts from the table called "posts". Though the author in that table is just a user_id, which is why I need to use my "getusername" function (gets the username from a ID - the ID) to grab the username from the users table. Though I don't know how to proceed from here, since it is not just one post. Therefore I need the username to either be a part of the $data['posts'] array or some other smart solution. Anyone who can help me out? function index() { $this->load->model('browse_model'); $data['posts'] = $this->browse_model->get_all(); $data['user'] = $this->browse_model->getusername(XX); $this->load->view('header'); $this->load->view('browse/index', $data); $this->load->view('footer'); }

  Read the article

• How to GetGuiResources for all system processes?

  - by Krzysztof

  Hello, I need to measure all used GDI objects in a Windows xp system. I found a GetGuiResources(__in HANDLE hProcess, __in DWORD uiFlags) method (with the GR_GDIOBJECTS flag). I call it for the process which I get from the method GetCurrentProcess() defined in WinBase.h. I don't know how to call it for other system processes, which I get by System::Diagnostics::Process::GetProcesses(), because that function returns an array of Process pointers, and GetGuiResources takes a HANDLE. Does anybody know a solution for that? How can I transform Process pointer to a Handle or get HANDLEs for all running system processes? thanks for help in advance!

  Read the article

• Zend Regex Route > Track the api version

  - by dskanth

  Hi, i am building a web service with zend and i am using modules to separate my api versions. Ex: "applications/modules/v1/controllers", "applications/modules/v2/controllers" have different set of actions and functionality. I have made "v1" as the default module in "application.ini" file: resources.modules = "" resources.frontController.defaultModule = "v1" resources.frontController.moduleDirectory = APPLICATION_PATH "/modules" resources.frontController.moduleControllerDirectoryName = "controllers" I have written the following in my bootstrap file: $router = $front->getRouter(); $r1 = new Zend_Controller_Router_Route_Regex('api/v1/tags.xml', array('module' => 'v1', 'controller' => 'tags', 'action' => 'index')); $router->addRoute('route1', $r1); Suppose, if this is my url: http://localhost/api/v1/tags.xml then it belongs to version 1 (v1). But i dont want to write many routes like this one, so i want to know how can i track the version from the regex url and dynamically determine the api version to be used (1 or 2).

  Read the article

• Fastest method for SQL Server inserts, updates, selects from C# ASP.Net 2.0+

  - by Ian

  Hi All, long time listener, first time caller. I use SPs and this isn't an SP vs code-behind "Build your SQL command" question. I'm looking for a high-throughput method for a backend app that handles many small transactions. I use SQLDataReader for most of the returns since forward only works in most cases for me. I've seen it done many ways, and used most of them myself. Methods that define and accept the stored procedure parameters as parameters themselves and build using cmd.Parameters.Add (with or without specifying the DB value type and/or length) Assembling your SP params and their values into an array or hashtable, then passing to a more abstract method that parses the collection and then runs cmd.Parameters.Add Classes that represent tables, initializing the class upon need, setting the public properties that represent the table fields, and calling methods like Save, Load, etc I'm sure there are others I've seen but can't think of at the moment as well. I'm open to all suggestions.

  Read the article

• XSLT: How to escape square brackets in Urls

  - by ilariac

  I have a set of records from Solr where field[@name='url'] can have the following format: http://url/blabla/blabla.aspx?sv=[keyword%20keyword,%201] My understanding is that the square brackets denote an array syntax and I would like to use XSLT to remove the square brackets from all Urls. The reason for this is that I am using an Open URL resolver, which does not currently handle well those characters. The best option would be to strip the square brackets from all URLs before such resources are mediated by the Open URL resolver. There are cases where I have multiple occurrences of square brackets per Url. Can you please help me with this? Thanks for your help, I.

  Read the article

• http_post_data basic authentication?

  - by kristian nissen

  I have a remote service that I need to access, according to the documentation it's restricted using basic authentication and all requests have to be posted (HTTP POST). The documentation contains this code example - VB script: Private Function SendRequest(ByVal Url, ByVal Username, ByVal Password, ByVal Request) Dim XmlHttp Set XmlHttp = CreateObject("MSXML2.XmlHttp") XmlHttp.Open "POST", Url, False, Username, Password XmlHttp.SetRequestHeader "Content-Type", "text/xml" XmlHttp.Send Request Set SendRequest = XmlHttp End Function how can I accomplish this in PHP? When I post data to the remote server it replies: 401 Unauthorized Access which is fine because I'm not posting my user/pass just the data. Bu when I add my user/pass as it's describe here: http://dk.php.net/manual/en/http.request.options.php like this: $res = http_post_data('https://example.com', $data, array( 'Content-Type: "text/xml"', 'httpauth' => base64_encode('user:pass'), 'httpauthtype' => HTTP_AUTH_BASIC ) ); the protocol is https - I get a runtime error in return (it's a .Net service). I have tried it without the base64_encode but with the same result.

  Read the article

• WordPress Problem with enqueing a script

  - by casben79

  I am trying to enqueue a script from the functions.php file for a custom theme. here is the code I am using: wp_enqueue_script('innerfade','correct/path/to/innerfade.js', array('jquery'), '', false); I also tried to hardcode from the the functions file like so: ?> <script type='text/javascript' src="correct/path/to/innerfade.js"></script> <?php and both are outputting the following: correct/path/to/innerfade.js'?ver=2.9.2 so It doesnt seem to be a wp_enqueue_script problem What I cannot seem to figure is where the hell is the comma after the .js is coming from, it is causing a dead link hence not loading the script, anyone have any ideas??

  Read the article

• Node.js mongoose: how to use the .in and .sort methods of a query?

  - by Chris

  Hi there, I'm trying to wrap my head around mongoose, but I'm having a hard time finding any kind of documentation for some of the more advanced query options, specifically the .in and .sort methods. What's the syntax for sorting, for example, a Person by age? db.model("Person").find().sort(???).all(function(people) { }); Then, let's say I want to find a Movie based on a genre, where a Movie can have many genres (in this case, an array of strings). Presumably, I'd use the .in function to accomplish that, but I'm not sure what the syntax would be. Or perhaps I don't have to use the .in method at all...? Either way, I'm lost. db.model("Movie").find().in(???).all(function(movies) { }); Anyone have any ideas? Or even better, a link to some comprehensive documentation? Thanks! Chris

  Read the article

• Stackoverflow Flair Facebook app error

  - by emre

  Just to lewt you know, what happened when I allowed the app in FB Fatal error: Uncaught exception 'FacebookRestClientException' with message 'Param assoc_time must be a number' in /home/content/r/e/j/rejun2000/html/fb_so/php/facebookapi_php5_restlib.php:2878 Stack trace: #0 /home/content/r/e/j/rejun2000/html/fb_so/php/facebookapi_php5_restlib.php(2544): FacebookRestClient-call_method('facebook.data.s...', Array) #1 /home/content/r/e/j/rejun2000/html/fb_so/utils.php(188): FacebookRestClient-data_setAssociation('uid_so_uid2', '616867493', '5004213880486') #2 /home/content/r/e/j/rejun2000/html/fb_so/utils.php(208): setSoUID('616867493', -1, Object(Facebook)) #3 /home/content/r/e/j/rejun2000/html/fb_so/index.php(26): updateProfileBox('616867493', -1, Object(Facebook)) #4 {main} thrown in /home/content/r/e/j/rejun2000/html/fb_so/php/facebookapi_php5_restlib.php on line 2878

  Read the article

• Creating a proper CMS thoughts

  - by dallasclark

  I'm just about to expand the functionality of our own CMS but was thinking of restructuring the database to make it simpler to add/edit data types and values. Currently, the CMS is quite flat - the CMS requires a field in the database for every type of stored value. The first option that comes to mind is simply a table which keeps the data types (ie: Address 1, Suburb, Email Address etc) and another table which holds values for each of these data types. Just like how Wordpress keeps values in the 'options' table, serialize would be used to store an array of values. The second option is how Drupal works, the CMS creates tables for every data type. Unlike Wordpress, this can be a bit of an overkill but really useful for SQL queries when ordering and grouping by a particular value. What's everyone's thoughts?

  Read the article

• How to restrict access to my web service?

  - by Hank

  I have http://example.com/index.html, which from within the HTML uses JavaScript to call a web services at http://example.com/json/?a=...&b=... The web service returns to index.html a JSON array of information to then be displayed on index.html. Since anyone can view the source code for index.html and see how I'm calling the JSON web services (http://example.com/json/), how do I prevent people from calling my JSON web service directly? Since the web service is essentially an open read into my database, I don't want people to abuse the web service and start DoS my server, fetching more information than they should, etc..

  Read the article

• codeigniter: how to redirect after login to current controller (php_self in regular php)

  - by krike

  Well it's not really a problem but I check if the user exist and log them in and redirect to site/members_area, but I don't want to send the user to a specific page but i want to reload the current controller. So if I login in index/home I would like to be redirected at index/home, how should I proceed? in regular php I would put in the action to redirect to current page <?php echo $_SERVER['PHP_SELF']; ?> This is the code in the framework function validate_credentials() { $this->load->model('membership_model'); $query = $this->membership_model->validate(); if($query) // if the user's credentials validated... { $data = array( 'username' => $this->input->post('username'), 'is_logged_in' => true ); $this->session->set_userdata($data); redirect('site/members_area'); //<-- this line here should be dynamic } else // incorrect username or password { $this->index(); } }

  Read the article

< Previous Page | 495 496 497 498 499 500 501 502 503 504 505 506  | Next Page >