Search Results

Search found 17443 results on 698 pages for 'base convert'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 50/698 | < Previous Page | 46 47 48 49 50 51 52 53 54 55 56 57  | Next Page >

  • How to convert a PGresult to custom data type with libpq (PostgreSQL)

    - by mocopera
    Hi everyone! I'm using the libpq library in C to accessing my PostgreSQL database. So, when I do res = PQexec(conn, "SELECT point FROM test_point3d"); I don't know how to convert the PGresult I got to my custom data type. I know I can use the PQgetValue function, but again I don't know how to convert the returning string to my custom data type. Any suggestion? Thanks in advice.

    Read the article

  • Count in base 2, 3, 4 etc in Java and output all permutations

    - by tree-hacker
    I want to write a function in Java that takes as input an integer and outputs every possible permutation of numbers up to that integer. For example: f(1) 0 f(2) should output: 00 01 10 11 f(3) should output: 000 001 002 010 011 012 020 021 022 100 .... 220 221 222 That is it should output all 27 permutations of the digits of the numbers 0, 1, 2. f(4) should output 0000 0001 0002 0003 0010 ... 3330 3331 3332 3333 f(4) should output 00000 00001 ... 44443 44444 I have been trying to solve this problem but cannot seem to work out how to do it and keep getting confused by how many loops I need. Does anyone know how to solve this problem? Thanks in advance.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Convert Java.Util.HashMap to System.Collections.IDictionary

    - by Paul
    In Xamarin I've got a .jar I've imported using a Java Binding Library. One of the callbacks has a Java.Lang.Object parameter which gives me Java.Util.HashMap and Java.Util.ArrayList at runtime. I'm abstracting this SDK behind a cross-platform interface, so I need to convert this to a .NET type. It there anything like the ArrayAdapter except in reverse that can convert the Java types to their .NET equivalents?

    Read the article

  • How to convert a BufferedImage to 8 bit?

    - by Zach Sugano
    I was looking at the ImageConverter class, trying to figure out how to convert a BufferedImage to 8-bit color, but I have no idea how I would do this. I was also searching around the internet and I could find no simple answer, they were all talking about 8 bit grayscale images. I simply want to convert the colors of an image to 8 bit... nothing else, no resizing no nothing. Does anyone mind telling me how to do this.

    Read the article

  • Convert video from .mp4 to .ogg

    - by Unknown
    I am using ffmpeg version 0.11.1 Copyright (c) 2000-2012 the FFmpeg developers . I need to convert a file .mp4, to .ogg format. I am on Mac OS X, and I have tried this so far: ffmpeg -i sample_mpeg4.mp4 -acodec vorbis -vcodec libtheora -f ogg output.ogv I am getting: Unknown encoder 'libtheora' ffmpeg -i sample_mpeg4.mp4 -acodec libvorbis -vcodec --enable-libtheora output.ogv I am getting: Unknown encoder '--enable-libtheora' ffmpeg -i sample_mpeg4.mp4 -acodec libvorbis -vcodec libtheora -f ogv output.ogv I am getting: [NULL @ 0x7f81bb00f800] Requested output format 'ogv' is not a suitable output format output.ogv: Invalid argument ffmpegtheora is not an option as it can not be install on the server.

    Read the article

  • C++ allocate objects on heap of base class with protected constructors via inheritance

    - by KRao
    I have a class with protected constructor: class B { protected: B(){}; }; Now I derive from it and define two static functions and I manage to actually create objects of the class B, but not on the heap: class A : public B { public: static B createOnStack() {return B();} //static B* createOnHeap() {return new B;} //Compile time Error on VS2010 }; B b = A::createOnStack(); //This works on VS2010! The question is: 1) Is VS2010 wrong in allowing the first case? 2) Is it possible to create objects of B without modifying B in any way (no friendship and no extra functions). I am asking, because it is possible to make something similar when dealing with instances of B and its member functions, see: http://accu.org/index.php/journals/296 Thank you in advance for any suggestion! Kind regards

    Read the article

  • static member specialization of templated child class and templated base class

    - by b3nj1
    I'm trying to have a templated class (here C) that inherits from another templated class (here A) and perform static member specialization (of int var here), but I cant get the right syntax to do so (if it's possible #include <iostream> template<typename derived> class A { public: static int var; }; //This one works fine class B :public A<B> { public: B() { std::cout << var << std::endl; } }; template<> int A<B>::var = 9; //This one doesn't works template<typename type> class C :public A<C<type> > { public: C() { std::cout << var << std::endl; } }; //template<> template<typename type> int A<C<type> >::a = 10; int main() { B b; C<int> c; return 0; } I put an example that works with a non templated class (here B) and i can get the static member specialization of var, but for C that just doesn't work. Here is what gcc tells me : test.cpp: In constructor ‘C<type>::C()’: test.cpp:29:26: error: ‘var’ was not declared in this scope test.cpp: At global scope: test.cpp:34:18: error: template definition of non-template ‘int A<C<type> >::a’ I'm using gcc version 4.6.3, thanks for any help

    Read the article

  • Reduce the number of additional Queries to 0 by overriding functions in the base model

    - by user334017
    my basic database setup is: User:... Info: relations: User: { foreignType:one } When displaying information on the user it takes: 1 query to find info on the user, and 1 query to find additional info I want to reduce this to one query that finds both, I assume I need to override a function from BaseUser.class.php, or something along those lines but I'm not really sure what to do. Thanks!

    Read the article

  • Convert any object to pretty HTML in java

    - by ripper234
    How can I convert a given object (in a generic way with reflection) to pretty printable HTML? What ready made library do you recommend that does this? I need support for simple nested objects (as long as they don't create loops in the object graph). I tried to convert it to JSON, but DefaultPrettyPrinter is not HTML friendly.

    Read the article

  • Base class Undefined WEIRD problem . Need help

    - by nXqd
    My CGameStateLogo which inherit from CGameState: CGameStateLogo.h #pragma once #include "GameState.h" class CGameMain; class CGameState; class CGameStateLogo: public CGameState { public: void MessageEnter (); void MessageUpdate( int iKey ); void MessagePaint( HDC* pDC ); public: CGameStateLogo(CGameMain* pGameMain); CGameStateLogo(void); ~CGameStateLogo(void); }; CGameState.h #pragma once #include "GameMain.h" #include "MyBitmap.h" class CGameMain; class CMyBitmap; class CGameState { public: CMyBitmap* pbmCurrent; CGameMain* pGM; int GameStateID; virtual void MessageEnter () = 0; virtual void MessageUpdate( int iKey ) = 0; virtual void MessagePaint( HDC* pDC ) = 0; void StateHandler ( int msg, HDC* pDC, int key ); public: CGameState(void); ~CGameState(void); }; Thanks for reading this :)

    Read the article

  • VMware convert to Virtualbox?

    - by TechSavvySmurf
    I downloaded a Kali Linux ISO VMware image thinking that it would be able to run in Virtualbox as well. However, this only seems to be the case with .vmdk files, and my image is a .vm.tar.gz file. Virtualbox does not recognize it as a valid ISO file, and I am not sure how to convert it. The entire thing is kali-linux-1.0-i386-gnome-vm.tar.gz The goal is to be able to run this in a Virtualbox, is there any way to convert this from VMware to Virtualbox?

    Read the article

  • Convert &euro; -> € in XUL

    - by Michael
    I need to convert HTML special symbols to their appropriate Unicode values in my Firefox extension. I'm not dealing with HTML DOM, so can't use the trick with giving value to div and taking back. Also there are too many of them to convert manually. Thought Firefox has something to use. The converted text should go to XUL's description element on statusbar. Any idea how to accomplish this?

    Read the article

  • When to use reflection to convert datarow to an object

    - by Daniel McNulty
    I'm in a situation now were I need to convert a datarow I've fetched from a query into a new instance of an object. I can do the obvious looping through columns and 'manually' assign these to properties of the object - or I can look into reflection such as this: http://www.codeproject.com/Articles/11914/Using-Reflection-to-convert-DataRows-to-objects-or What would I base the decision on? Just scalability??

    Read the article

  • base class , inheritate class sizeof()

    - by user1279988
    why sizeof(X) is 4 and sizeof(Y) is 8? and another question, in class X, only the int(i) count as sizeof() 4? member function does take any memory space? Plz tell me, thanks! class X { int i; public: X() { i = 0; } void set(int ii) { i = ii; } int read() const { return i; } int permute() { return i = i * 47; } }; class Y : public X { int i; // Different from X's i public: Y() { i = 0; } int change() { i = permute(); // Different name call return i; } void set(int ii) { i = ii; X::set(ii); // Same-name function call } }; cout << "sizeof(X) = " << sizeof(X) << endl; cout << "sizeof(Y) = "

    Read the article

  • Data base design with Blob

    - by mmuthu
    Hi, I have a situation where i need to store the binary data into database as blob column. There are three different table exists in my database where in i need to store a blob data for each record. Not every record will have the blob data all the time. It is time and user based. The table one will have to store the *.doc files almost for all the record The table two will have to store the *.xml optionally. The table three will have to store images (not sure what is frequency, etc) Now my questions is whether it is a good idea to maintain a separate table to store the blob data pointing it to the respective table PK's (Yes, there will be no FK's and assuming program will maintain it). It will be some thing like below, BLOB|PK_ID|TABLE_NAME Alternatively, is it a good idea to keep the blob column in respective tables. As for as my application runtime is concerned, The table 2 will be read very frequently. Though the blob column will not be required. The table 2 record will gets deleted frequently. Similarly other blob data in respective table will not be accessed frequently. All of the blob content will be read on-demand basis. I'm thinking first approach will work better for me. What do you guys think? Btw, I'm using Oracle.

    Read the article

  • How to insert into data base using multi threading programming [closed]

    - by user1196650
    I am having a method and that method needs to do the following thing: It has to insert records into a database. No insert is done for the same table again. All inserts are into different tables. I need a multi threading logic which inserts the details into db using different threads. I am using oracle db and driver configuration and remaining stuff are perfect. Please help me with an efficient answer. Can anyone could provide me with a skeleton logic of the program.

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 46 47 48 49 50 51 52 53 54 55 56 57  | Next Page >