Search Results

Search found 17068 results on 683 pages for 'merge array'.

Page 521/683 | < Previous Page | 517 518 519 520 521 522 523 524 525 526 527 528  | Next Page >

  • Building resultset using collection object

    - by Bhaskara Krishna Mohan Potam
    Hi, I had an issue in building the resultset using java. Here it goes... I am storing a collection object which is organized as row wise taken from a resultset object and putting the collection object(which is stored as vector/array list) in cache and trying to retrieve the same collection object. Here i need to build back the resultset again using the collection object. Now my doubt is building the resultset in this way possible or not? Please let me know asap. Thanks in advance, Bhaskar

    Read the article

  • What is the scope of JS variables in anonymous functions

    - by smorhaim
    Why does this code returns $products empty? If I test for $products inside the function it does show data... but once it finishes I can't seem to get the data. var $products = new Array(); connection.query($sql, function(err, rows, fields) { if (err) throw err; for(i=0; i< rows.length; i++) { $products[rows[i].source_identifier] = "xyz"; } }); connection.end(); console.log($products); // Shows empty.

    Read the article

  • Equality Comparison with Multiple Instances/IEqualityComparer problems in LINQ

    - by Stacey
    This is similar to my last question; but from a different angle. http://stackoverflow.com/questions/2792393/see-if-item-exists-once-in-enumerable-linq Given the following set of items, and lists containing them... Item 1 Item 2 Item 3 Item 4 Item 5 class Item { string Name { get; set; } } List<Item> available = new List<Item>() { Item 1 Item 1 Item 2 Item 3 Item 5 } List<Item> selected = new List<Item>() { Item 1 Item 2 Item 3 } I need to make a third List that has everything from "available", except what is in "selected". However 'Item 1' is in 'available' twice, but only in 'selected' once. Since they are instances of the same item, I am having trouble figuring out the appropriate logic to accomodate this. The final array should look like... List<Item> selectable = new List<Item>() { Item 1 Item5 }

    Read the article

  • Difference between mutableArrayValueForKey and calling insertObject:inEmployeesAtIndex: directly

    - by jasonbogd
    I have a question regarding using KVO-compliant methods to insert/remove objects from an array. I'm working through Aaron Hillegass' Cocoa Programming for Mac OS X and I saw the following line of code (in the insertObject:inEmployeesAtIndex: method: [[undoManager prepareWithInvocationTarget:self] removeObjectFromEmployeesAtIndex:index]; Correct me if I'm wrong, but I always thought it was better to call mutableArrayValueForKey: and then removeObjectAtIndex:...so I tried changing the above line to this: [[undoManager prepareWithInvocationTarget:[self mutableArrayValueForKey:@"employees"]] removeObjectAtIndex:index]; And it didn't work. Can someone explain the difference and why the first line works but the second line doesn't?

    Read the article

  • Scala wont pattern match with java.lang.String and Case Class

    - by Stefan
    Hello fellow Scala Programmers I have been working with Scala for some month now, however I have a problem with some properly basic stuff, I am hoping you will help my out with it. case class PersonClass(name: String, age: Int) object CaseTester { def main(args:Array[String]) { val string = "hej" string match { case e:String => println(string) case PersonClass => println(string) } } } When I am doing like this I get error: pattern type is incompatible with expected type; found : object PersonClass required: java.lang.String case PersonClass = println(string) And if I then change the second line in the pattern matching to the following: case e:PersonClass => println(string) I then get the error: error: scrutinee is incompatible with pattern type; found : PersonClass required: java.lang.String case e:PersonClass = println(string) However if I change the string definition to the following it compiles fine in both cases. val string:AnyRef = "hej"

    Read the article

  • How can I use a variable as a module name in Perl?

    - by mjn12
    I know it is possible to use a variable as a variable name for package variables in Perl. I would like to use the contents of a variable as a module name. For instance: package Foo; our @names =("blah1", "blah2"); 1; And in another file I want to be able be able to set the contents of a scalar to "foo" and then access the names array in Foo through that scalar. my $packageName = "Foo"; Essentially I want to do something along the lines of: @{$packageName}::names; #This obviously doesn't work. I know I can use my $names = eval '$'. $packageName . "::names" But only if Foo::names is a scalar. Is there another way to do this without the eval statement?

    Read the article

  • CommunicationException in WCF

    - by user343159
    Hi I have a problem with a WCF Service I've just created. This was working yesterday but for some reason it's just stopped working. One of my WCF methods returns an array of an Entity Framework entity, like this: public BranchContactDetail[] GetClosestBranches(string postcode, int howManyBranches) { GeoLocation geoLocation = GetLocationFromPostcode(postcode); Location location = new Location(geoLocation.Latitude, geoLocation.Longitude); using (BranchDirectoryEntities entities = new BranchDirectoryEntities()) { var branchesInOrder = entities.BranchContactDetails .Where(b => b.latitude.HasValue && b.longitude.HasValue ) .OrderBy(b => location.DistanceFrom(b.latitude, b.longitude)) .Take(howManyBranches) .ToArray(); return branchesInOrder; } } ...and, as I say, this was working fine yesterday. Now I'm getting a "The underlying connection was closed: The connection was closed unexpectedly." I've hunted all over the web but no-one seems to know the answer. Anyone shed any light on this issue? Regards, Mark

    Read the article

  • F#: Define an abstract class that inherits an infterface, but does not implement it

    - by akaphenom
    I owuld like to define an abstract class that inerhits from UserControl and my own Interface IUriProvider, but doesn't implement it. The goal is to be able to define pages (for silverlight) that implement UserControl but also provide their own Uri's (and then stick them in a list / array and deal with them as a set: type IUriProvider = interface abstract member uriString: String ; abstract member Uri : unit -> System.Uri ; end type UriUserControl() as this = inherit IUriProvider with abstract member uriString: String ; inherit UserControl() Also the Uri in the definition - I would like to implement as a property getter - and am having issues with that as well. this does not compile type IUriProvider = interface abstract member uriString: String with get; end Thank you...

    Read the article

  • Sales figures not displayed in form

    - by Brian Wilson
    Trying to calculate total sales for 5 items, 3 stores. Here's a s/s of what Im getting, along with my code. What am I missing/doing wrong? (p.s. It's not returning an error code in 'debug') Public Class Form1 Private Sub btnCalc_Click(sender As Object, e As EventArgs) Handles btnCalc.Click Dim ttlsales As Double 'set up array data Dim sales(,) As Integer = {{25, 64, 23, 45, 14}, {12, 82, 19, 34, 63}, {54, 22, 17, 43, 35}} Dim price() As Double = {12.0, 17.95, 95.0, 86.5, 78.0} 'mark totals Dim totals(2) As Double For store As Integer = 0 To 2 For item As Integer = 0 To 4 Next Next 'display output lstOut.Items.Add("Sales Per Store") For store As Integer = 0 To 2 lstOut.Items.Add(store + 1 & ":" & FormatCurrency(totals(store))) ttlsales += totals(store) Next lstOut.Items.Add("Total Sales: " & FormatCurrency(ttlsales)) End Sub End Class

    Read the article

  • Animation issue caused by C# parameters passed by reference rather than value, but where?

    - by Jordan Roher
    I'm having trouble with sprite animation in XNA that appears to be caused by a struct passed as a reference value. But I'm not using the ref keyword anywhere. I am, admittedly, a C# noob, so there may be some shallow bonehead error in here, but I can't see it. I'm creating 10 ants or bees and animating them as they move across the screen. I have an array of animation structs, and each time I create an ant or bee, I send it the animation array value it requires (just [0] or [1] at this time). Deep inside the animation struct is a timer that is used to change frames. The ant/bee class stores the animation struct as a private variable. What I'm seeing is that each ant or bee uses the same animation struct, the one I thought I was passing in and copying by value. So during Update(), when I advance the animation timer for each ant/bee, the next ant/bee has its animation timer advanced by that small amount. If there's 1 ant on screen, it animates properly. 2 ants, it runs twice as fast, and so on. Obviously, not what I want. Here's an abridged version of the code. How is BerryPicking's ActorAnimationGroupData[] getting shared between the BerryCreatures? class BerryPicking { private ActorAnimationGroupData[] animations; private BerryCreature[] creatures; private Dictionary<string, Texture2D> creatureTextures; private const int maxCreatures = 5; public BerryPickingExample() { this.creatures = new BerryCreature[maxCreatures]; this.creatureTextures = new Dictionary<string, Texture2D>(); } public void LoadContent() { // Returns data from an XML file Reader reader = new Reader(); animations = reader.LoadAnimations(); CreateCreatures(); } // This is called from another function I'm not including because it's not relevant to the problem. // In it, I remove any creature that passes outside the viewport by setting its creatures[] spot to null. // Hence the if(creatures[i] == null) test is used to recreate "dead" creatures. Inelegant, I know. private void CreateCreatures() { for (int i = 0; i < creatures.Length; i++) { if (creatures[i] == null) { // In reality, the name selection is randomized creatures[i] = new BerryCreature("ant"); // Load content and texture (which I create elsewhere) creatures[i].LoadContent( FindAnimation(creatures[i].Name), creatureTextures[creatures[i].Name]); } } } private ActorAnimationGroupData FindAnimation(string animationName) { int yourAnimation = -1; for (int i = 0; i < animations.Length; i++) { if (animations[i].name == animationName) { yourAnimation = i; break; } } return animations[yourAnimation]; } public void Update(GameTime gameTime) { for (int i = 0; i < creatures.Length; i++) { creatures[i].Update(gameTime); } } } class Reader { public ActorAnimationGroupData[] LoadAnimations() { ActorAnimationGroupData[] animationGroup; XmlReader file = new XmlTextReader(filename); // Do loading... // Then later file.Close(); return animationGroup; } } class BerryCreature { private ActorAnimation animation; private string name; public BerryCreature(string name) { this.name = name; } public void LoadContent(ActorAnimationGroupData animationData, Texture2D sprite) { animation = new ActorAnimation(animationData); animation.LoadContent(sprite); } public void Update(GameTime gameTime) { animation.Update(gameTime); } } class ActorAnimation { private ActorAnimationGroupData animation; public ActorAnimation(ActorAnimationGroupData animation) { this.animation = animation; } public void LoadContent(Texture2D sprite) { this.sprite = sprite; } public void Update(GameTime gameTime) { animation.Update(gameTime); } } struct ActorAnimationGroupData { // There are lots of other members of this struct, but the timer is the only one I'm worried about. // TimerData is another struct private TimerData timer; public ActorAnimationGroupData() { timer = new TimerData(2); } public void Update(GameTime gameTime) { timer.Update(gameTime); } } struct TimerData { public float currentTime; public float maxTime; public TimerData(float maxTime) { this.currentTime = 0; this.maxTime = maxTime; } public void Update(GameTime gameTime) { currentTime += (float)gameTime.ElapsedGameTime.TotalSeconds; if (currentTime >= maxTime) { currentTime = maxTime; } } }

    Read the article

  • Memory leak with preg_replace

    - by Silvio Donnini
    I'm using the preg_replace function to replace accents in a string, I'm working with UTF-8. I have incurred in what seems to be a memory leak, but I can't isolate the root cause, my code is rather simple: preg_replace( array_keys($aToNoAccents), array_values($aToNoAccents), $sText ); where $aToNoAccents is an associative array with entries like '~[A]~u' => 'A', '~[C]~u' => 'C',. My script prints this error for the above line: Fatal error: Allowed memory size of 1073741824 bytes exhausted (tried to allocate 3039 bytes) Obviously it's not a matter of increasing the allowed memory for PHP, (a 1Gb footprint is way off the scale of my application). Also, that line is executed thousands of times without problems but, just for some cases which are difficult to reproduce, it yields the error. Is anyone aware of memory problems with preg_replace and UTF-8 strings? Am I to use special care in passing actual parameters to such function? I'm using PHP 5.2.6-3 with Suhosin-Patch thanks Silvio

    Read the article

  • Compatibility issues with <a> and calling a function(); across different web browsers

    - by Matthew
    Hi, I am new to javascript. I wrote the following function rollDice() to produce 5 random numbers and display them. I use an anchor with click event to call the function. Problem is, in Chrome it won't display, works fine in IE, in firefox the 5 values display and then the original page w/anchor appears! I am suspicious that my script tag is too general but I am really lost. Also if there is a display function that doesn't clear the screen first that would be great. diceArray = new Array(5) function rollDice() { var i; for(i=0; i<5; i++) { diceArray[i]=Math.round(Math.random() * 6) % 6 + 1; document.write(diceArray[i]); } } when I click should display 5 rand variables

    Read the article

  • Can't get my head around background workers in .NET

    - by Connel
    I have wrote an application that syncs two folders together. The problem with the program is that it stops responding whilst copying files. A quick search of stack-overflow told me I need to use something called a background worker. I have read a few pages on the net about this but find it really hard to understand as I'm pretty new to programming. Below is the code for my application - how can I simply put all of the File.Copy(....) commands into their own background worker (if that's even how it works)? Below is the code for the button click event that runs the sub procedure and the sub procedure I wish to use a background worker on all the File.Copy lines. Button event: protected virtual void OnBtnSyncClicked (object sender, System.EventArgs e) { //sets running boolean to true booRunning=true; //sets progress bar to 0 prgProgressBar.Fraction = 0; //resets values used by progressbar dblCurrentStatus = 0; dblFolderSize = 0; //tests if user has entered the same folder for both target and destination if (fchDestination.CurrentFolder == fchTarget.CurrentFolder) { //creates message box MessageDialog msdSame = new MessageDialog(this, DialogFlags.Modal, MessageType.Error, ButtonsType.Close, "You cannot sync two folders that are the same"); //sets message box title msdSame.Title="Error"; //sets respone type ResponseType response = (ResponseType) msdSame.Run(); //if user clicks on close button or closes window then close message box if (response == ResponseType.Close || response == ResponseType.DeleteEvent) { msdSame.Destroy(); } return; } //tests if user has entered a target folder that is an extension of the destination folder // or if user has entered a desatination folder that is an extension of the target folder if (fchTarget.CurrentFolder.StartsWith(fchDestination.CurrentFolder) || fchDestination.CurrentFolder.StartsWith(fchTarget.CurrentFolder)) { //creates message box MessageDialog msdContains = new MessageDialog(this, DialogFlags.Modal, MessageType.Error, ButtonsType.Close, "You cannot sync a folder with one of its parent folders"); //sets message box title msdContains.Title="Error"; //sets respone type and runs message box ResponseType response = (ResponseType) msdContains.Run(); //if user clicks on close button or closes window then close message box if (response == ResponseType.Close || response == ResponseType.DeleteEvent) { msdContains.Destroy(); } return; } //gets folder size of target folder FileSizeOfTarget(fchTarget.CurrentFolder); //gets folder size of destination folder FileSizeOfDestination(fchDestination.CurrentFolder); //runs SyncTarget procedure SyncTarget(fchTarget.CurrentFolder); //runs SyncDestination procedure SyncDestination(fchDestination.CurrentFolder); //informs user process is complete prgProgressBar.Text = "Finished"; //sets running bool to false booRunning = false; } Sync sub-procedure: protected void SyncTarget (string strCurrentDirectory) { //string array of all the directories in directory string[] staAllDirectories = Directory.GetDirectories(strCurrentDirectory); //string array of all the files in directory string[] staAllFiles = Directory.GetFiles(strCurrentDirectory); //loop over each file in directory foreach (string strFile in staAllFiles) { //string of just the file's name and not its path string strFileName = System.IO.Path.GetFileName(strFile); //string containing directory in target folder string strDirectoryInsideTarget = System.IO.Path.GetDirectoryName(strFile).Substring(fchTarget.CurrentFolder.Length); //inform user as to what file is being copied prgProgressBar.Text="Syncing " + strFile; //tests if file does not exist in destination folder if (!File.Exists(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName)) { //if file does not exist copy it to destination folder, the true below means overwrite if file already exists File.Copy (strFile, fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName, true); } //tests if file does exist in destination folder if (File.Exists(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName)) { //long (number) that contains date of last write time of target file long lngTargetFileDate = File.GetLastWriteTime(strFile).ToFileTime(); //long (number) that contains date of last write time of destination file long lngDestinationFileDate = File.GetLastWriteTime(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName).ToFileTime(); //tests if target file is newer than destination file if (lngTargetFileDate > lngDestinationFileDate) { //if it is newer then copy file from target folder to destination folder File.Copy (strFile, fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName, true); } } //gets current file size FileInfo FileSize = new FileInfo(strFile); //sets file's filesize to dblCurrentStatus and adds it to current total of files dblCurrentStatus = dblCurrentStatus + FileSize.Length; double dblPercentage = dblCurrentStatus/dblFolderSize; prgProgressBar.Fraction = dblPercentage; } //loop over each folder in target folder foreach (string strDirectory in staAllDirectories) { //string containing directories inside target folder but not any higher directories string strDirectoryInsideTarget = strDirectory.Substring(fchTarget.CurrentFolder.Length); //tests if directory does not exist inside destination folder if (!Directory.Exists(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget)) { //it directory does not exisit create it Directory.CreateDirectory(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget); } //run sync on all files in directory SyncTarget(strDirectory); } } Any help will be greatly appreciated as after this the program will pretty much be finished :D

    Read the article

  • CodePlex Daily Summary for Monday, May 26, 2014

    CodePlex Daily Summary for Monday, May 26, 2014Popular ReleasesClosedXML - The easy way to OpenXML: ClosedXML 0.71.1: More performance improvements. It's faster and consumes less memory.Role Based Views in Microsoft Dynamics CRM 2011: Role Based Views in CRM 2011 and 2013 - 1.1.0.0: Issues fixed in this build: 1. Works for CRM 2013 2. Lookup view not getting blockedSimCityPak: SimCityPak 0.3.1.0: Main New Features: Fixed Importing of Instance Names (get rid of the Dutch translations) Added advanced editor for Decal Dictionaries Added possibility to import .PNG to generate new decals Added advanced editor for Path display entriesSimple Connect To Db: SimpleConnectToDb_v1: SimpleConnectToDb_v1CRM 2011 / CRM 2013 Form Helper: v2014.05.25: v2014.05.25 Added PhoneFormat & PhoneFormatAreaCode v2014.05.24 Initial ReleaseCreate Word documents without MS Word: Release 3.0: Add support for Sections, Sections Headers and Footers and right to left languages.Corporate News App for SharePoint 2013: CorporateNewsApp v1.6.2.0: Important note This version contains a major bug fix about the generic error "Request failed. Unexpected response data from server null" This error occurs on SharePoint Online only, following an update of the Javascript API after May 2014. If you have installed this application manually in your applications company catalog, you can download the CorporateNewsApp.app file in the zip archive and update it manually. If you have installed this application directly from the SharePoint Store, it ...DevOS: DevOS: Plugin-system added Including:DevOS.exe DevOS API.dll Files must be in the some folderTiny Deduplicator: Tiny Deduplicator 1.0.1.0: Increased version number to 1.0.1.0 Moved all options to a separate 'Options' dialog window. Allows the user to specify a selection strategy which will help when dealing with large numbers of duplicate files. Available options are "None," "Keep First," and "Keep Last"C64 Studio: 3.5: Add: BASIC renumber function Add: !PET pseudo op Add: elseif for !if, } else { pseudo op Add: !TRACE pseudo op Add: Watches are saved/restored with a solution Add: Ctrl-A works now in export assembly controls Add: Preliminary graphic import dialog (not fully functional yet) Add: range and block selection in sprite/charset editor (Shift-Click = range, Alt-Click = block) Fix: Expression evaluator could miscalculate when both division and multiplication were in an expression without parenthesisSEToolbox: SEToolbox 01.031.009 Release 1: Added mirroring of ConveyorTubeCurved. Updated Ship cube rotation to rotate ship back to original location (cubes are reoriented but ship appears no different to outsider), and to rotate Grouped items. Repair now fixes the loss of Grouped controls due to changes in Space Engineers 01.030. Added export asteroids. Rejoin ships will merge grouping and conveyor systems (even though broken ships currently only maintain the Grouping on one part of the ship). Installation of this version wi...Player Framework by Microsoft: Player Framework for Windows and WP v2.0: Support for new Universal and Windows Phone 8.1 projects for both Xaml and JavaScript projects. See a detailed list of improvements, breaking changes and a general overview of version 2 ADDITIONAL DOWNLOADSSmooth Streaming Client SDK for Windows 8 Applications Smooth Streaming Client SDK for Windows 8.1 Applications Smooth Streaming Client SDK for Windows Phone 8.1 Applications Microsoft PlayReady Client SDK for Windows 8 Applications Microsoft PlayReady Client SDK for Windows 8.1 Applicat...TerraMap (Terraria World Map Viewer): TerraMap 1.0.6: Added support for the new Terraria v1.2.4 update. New items, walls, and tiles Added the ability to select multiple highlighted block types. Added a dynamic, interactive highlight opacity slider, making it easier to find highlighted tiles with dark colors (and fixed blurriness from 1.0.5 alpha). Added ability to find Enchanted Swords (in the stone) and Water Bolt books Fixed Issue 35206: Hightlight/Find doesn't work for Demon Altars Fixed finding Demon Hearts/Shadow Orbs Fixed inst...DotNet.Highcharts: DotNet.Highcharts 4.0 with Examples: DotNet.Highcharts 4.0 Tested and adapted to the latest version of Highcharts 4.0.1 Added new chart type: Heatmap Added new type PointPlacement which represents enumeration or number for the padding of the X axis. Changed target framework from .NET Framework 4 to .NET Framework 4.5. Closed issues: 974: Add 'overflow' property to PlotOptionsColumnDataLabels class 997: Split container from JS 1006: Series/Categories with numeric names don't render DotNet.Highcharts.Samples Updated s...ConEmu - Windows console with tabs: ConEmu 140523 [Alpha]: ConEmu - developer build x86 and x64 versions. Written in C++, no additional packages required. Run "ConEmu.exe" or "ConEmu64.exe". Some useful information you may found: http://superuser.com/questions/tagged/conemu http://code.google.com/p/conemu-maximus5/wiki/ConEmuFAQ http://code.google.com/p/conemu-maximus5/wiki/TableOfContents If you want to use ConEmu in portable mode, just create empty "ConEmu.xml" file near to "ConEmu.exe" Aspose for Apache POI: Missing Features of Apache POI SL - v 1.1: Release contain the Missing Features in Apache POI SL SDK in Comparison with Aspose.Slides for dealing with Microsoft Power Point. What's New ?Following Examples: Managing Slide Transitions Manage Smart Art Adding Media Player Adding Audio Frame to Slide Feedback and Suggestions Many more examples are yet to come here. Keep visiting us. Raise your queries and suggest more examples via Aspose Forums or via this social coding site.PowerShell App Deployment Toolkit: PowerShell App Deployment Toolkit v3.1.3: Added CompressLogs option to the config file. Each Install / Uninstall creates a timestamped zip file with all MSI and PSAppDeployToolkit logs contained within Added variable expansion to all paths in the configuration file Added documentation for each of the Toolkit internal variables that can be used Changed Install-MSUpdates to continue if any errors are encountered when installing updates Implement /Force parameter on Update-GroupPolicy (ensure that any logoff message is ignored) ...WordMat: WordMat v. 1.07: A quick fix because scientific notation was broken in v. 1.06 read more at http://wordmat.blogspot.com????: 《????》: 《????》(c???)??“????”???????,???????????????C?????????。???????,???????????????????????. ??????????????????????????????????;????????????????????????????。Mini SQL Query: Mini SQL Query (1.0.72.457): Apologies for the previous update! FK issue fixed and also a template data cache issue.New ProjectsASP.Net MCV4 Simplified Code Samples: This project intended to simplify the same. In this project each task is implemented with minimum lines of code to reduces complicity.Calvin: net???CodeLatino by Latinosoft: A Modified version for codeShow -- Probably taking more than a month.freeasyBackup: A free and easy to use Backup Tool for everyone. Without any cloud restrictions. freeasyExplorer: A free and easy to use File Explorer for everyone.openPDFspeedreader: #spritz #pdfreader #speedreader PDF Editor to Edit PDF Files in your ASP.NET Applications: This sample application allows the users to edit PDF files online using Aspose.Pdf for .NET.SharePoint World Cup 2013: world cup 2014SSAS Long Running Query Performance Helper: This utility helps investigate long running multidimensional or mining queries in discovery, de-parameterization and re-parameterization back to source format.

    Read the article

  • Best way to parse command line arguments in C#

    - by Paul Stovell
    When building console applications that take parameters, you can use the arguments passed to Main(string[] args). In the past I've simply indexed/looped that array and done a few regular expressions to extract the values. However, when the commands get more complicated, the parsing can get pretty ugly. More recently, I built the world's simplest Backus-Naur Form parser in C# to parse the arguments. It does the job, but it also feels like overkill. So I'm interested in: Libraries that you use Patterns that you use Assume the commands always adhere to common standards such as answered here.

    Read the article

  • Memory in Eclipse

    - by user247866
    I'm getting the java.lang.OutOfMemoryError exception in Eclipse. I know that Eclipse by default uses heap size of 256M. I'm trying to increase it but nothing happens. For example: eclipse -vmargs -Xmx16g -XX:PermSize=2g -XX:MaxPermSize=2g I also tried different settings, using only the -Xmx option, using different cases of g, G, m, M, different memory sizes, but nothing helps. Does not matter which params I specify, the heap exception is thrown at the same time, so I assume there's something I'm doing wrong that Eclipse ignores the -Xmx parameter. I'm using a 32GB RAM machine and trying to execute something very simple such as: double[][] a = new double[15000][15000]; It only works when I reduce the array size to something around 10000 on 10000. I'm working on Linux and using the top command I can see how much memory the Java process is consuming; it's less than 2%. Thanks!

    Read the article

  • Replacing backslash with another symbol in PHP

    - by Skyfe
    Hi there, Been struggling with replacing a backslash by another symbol such as '.-.' just to indicate the position of backslashes as I could not send a string such as 'C\xampp\etc.' through url as GET variable so I thought I'd first replace the backslashes in that string by another symbol, then send through url, and then replace them back to backslashes in the PHP file that handles it. Though would there be a better way to send such strings through url? Because when I try a script such as: $tmp_name = preg_replace("\", ".-.", $_FILES['uploadfile']['tmp_name']); It turns out into a php error as \ is also used as delimiter.. Could anyone help me out on this? Thanks in advanced! Btw, if I'd be able to send a full array through url, this whole problem would be solved, but I don't think it's possible?

    Read the article

  • Why does my program crash when given negative values?

    - by Wayfarer
    Alright, I am very confused, so I hope you friends can help me out. I'm working on a project using Cocos2D, the most recent version (.99 RC 1). I make some player objects and some buttons to change the object's life. But the weird thing is, the code crashes when I try to change their life by -5. Or any negative value for that matter, besides -1. NSMutableArray *lifeButtons = [[NSMutableArray alloc] init]; CCTexture2D *buttonTexture = [[CCTextureCache sharedTextureCache] addImage:@"Button.png"]; LifeChangeButtons *button = nil; //top left button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(50 , size.height - 30); [button buttonText:-5]; [lifeButtons addObject:button]; //top right button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(size.width - 50 , size.height - 30); [button buttonText:1]; [lifeButtons addObject:button]; //bottom left button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(50 , 30); [button buttonText:5]; [lifeButtons addObject:button]; //bottom right button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(size.width - 50 , 30); [button buttonText:-1]; [lifeButtons addObject:button]; for (LifeChangeButtons *theButton in lifeButtons) { [self addChild:theButton]; } This is the code that makes the buttons. It simply makes 4 buttons, puts them in each corner of the screen (size is the screen) and adds their life change ability, 1,-1,5, or -5. It adds them to the array and then goes through the array at the end and adds all of them to the screen. This works fine. Here is my code for the button class: (header file) // // LifeChangeButtons.h // Coco2dTest2 // // Created by Ethan Mick on 3/14/10. // Copyright 2010 Wayfarer. All rights reserved. // #import "cocos2d.h" @interface LifeChangeButtons : CCSprite <CCTargetedTouchDelegate> { NSNumber *lifeChange; } @property (nonatomic, readonly) CGRect rect; @property (nonatomic, retain) NSNumber *lifeChange; + (id)lifeButton:(CCTexture2D *)texture; - (void)buttonText:(int)number; @end Implementation file: // // LifeChangeButtons.m // Coco2dTest2 // // Created by Ethan Mick on 3/14/10. // Copyright 2010 Wayfarer. All rights reserved. // #import "LifeChangeButtons.h" #import "cocos2d.h" #import "CustomCCNode.h" @implementation LifeChangeButtons @synthesize lifeChange; //Create the button +(id)lifeButton:(CCTexture2D *)texture { return [[[self alloc] initWithTexture:texture] autorelease]; } - (id)initWithTexture:(CCTexture2D *)atexture { if ((self = [super initWithTexture:atexture])) { //NSLog(@"wtf"); } return self; } //Set the text on the button - (void)buttonText:(int)number { lifeChange = [NSNumber numberWithInt:number]; NSString *text = [[NSString alloc] initWithFormat:@"%d", number]; CCLabel *label = [CCLabel labelWithString:text fontName:@"Times New Roman" fontSize:20]; label.position = CGPointMake(35, 20); [self addChild:label]; } - (CGRect)rect { CGSize s = [self.texture contentSize]; return CGRectMake(-s.width / 2, -s.height / 2, s.width, s.height); } - (BOOL)containsTouchLocation:(UITouch *)touch { return CGRectContainsPoint(self.rect, [self convertTouchToNodeSpaceAR:touch]); } - (void)onEnter { [[CCTouchDispatcher sharedDispatcher] addTargetedDelegate:self priority:0 swallowsTouches:YES]; [super onEnter]; } - (void)onExit { [[CCTouchDispatcher sharedDispatcher] removeDelegate:self]; [super onExit]; } - (BOOL)ccTouchBegan:(UITouch *)touch withEvent:(UIEvent *)event { CGPoint touchPoint = [touch locationInView:[touch view]]; touchPoint = [[CCDirector sharedDirector] convertToGL:touchPoint]; if ( ![self containsTouchLocation:touch] ) return NO; NSLog(@"Button touch event was called returning yes. "); //this is where we change the life to each selected player NSLog(@"Test1"); NSMutableArray *tempArray = [[[UIApplication sharedApplication] delegate] selectedPlayerObjects]; NSLog(@"Test2"); for (CustomCCNode *aPlayer in tempArray) { NSLog(@"we change the life by %d.", [lifeChange intValue]); [aPlayer changeLife:[lifeChange intValue]]; } NSLog(@"Test3"); return YES; } - (void)ccTouchMoved:(UITouch *)touch withEvent:(UIEvent *)event { CGPoint touchPoint = [touch locationInView:[touch view]]; touchPoint = [[CCDirector sharedDirector] convertToGL:touchPoint]; NSLog(@"You moved in a button!"); } - (void)ccTouchEnded:(UITouch *)touch withEvent:(UIEvent *)event { NSLog(@"You touched up in a button"); } @end Now, This function: - (BOOL)ccTouchBegan:(UITouch *)touch withEvent:(UIEvent *)event Is where all the shit goes down. It works for all of the buttons except the -5 one. And then, it gets to: NSLog(@"we change the life by %d.", [lifeChange integerValue]); And it crashes at that statement. It only crashes when given anything less than -1. -1 works, but nothing smaller does. Here is the code in the CustomCCNode Class, "changeLife" that is being called. - (void)changeLife:(int)lifeChange { NSLog(@"change life in Custom Class was called"); NSLog(@"wtf is lifechange: %d", lifeChange); life += lifeChange; lifeString = [[NSString alloc] initWithFormat:@"%d",life]; [text setString:lifeString]; } Straight forward, but when the NSnumber is -5, it doesn't even get called, it crashes at the NSlog statement. So... what's up with that?

    Read the article

  • Multiple key/value pairs in HTTP POST where key is the same name

    - by randombits
    I'm working on an API that accepts data from remote clients, some of which where the key in an HTTP POST almost functions as an array. In english what this means is say I have a resource on my server called "class". A class in this sense, is the type a student sits in and a teacher educates in. When the user submits an HTTP POST to create a new class for their application, a lot of the key value pairs look like: student_name: Bob Smith student_name: Jane Smith student_name: Chris Smith What's the best way to handle this on both the client side (let's say the client is cURL or ActiveResource, whatever..) and what's a decent way of handling this on the server-side if my server is a Ruby on Rails app? Need a way to allow for multiple keys with the same name and without any namespace clashing or loss of data.

    Read the article

  • Sending POST variables through a PHP proxy for AJAX?

    - by b. e. hollenbeck
    I've decided that using a PHP proxy for AJAX calls for a project is the best way to go - but I have a question regarding passing POST data through the proxy. As in - how to do it. Should I need to create a single variable in the javascript using alternate characters, then have the PHP proxy parse and modify the variable to reassemble a valid HTTP request? Or is there some means of passing along the $_POST array in new request to the external server by pulling the data out of the headers and re-sending it?

    Read the article

  • Rendering a variable with erb.

    - by TZer0
    I've got the following problem: I have rhtml (html minced together with ruby inside <% % and <%= % tags) stored in a database which I want to render. The information is acquired through a query. I need to be able to evaluate the information I get from the database as though as it was normal content inside the .erb-file. What I currently have: <% @mymods.each do |mod| %> <%= render_text(mod["html"])%> <% end %> Where mod["html"] is the variable containing the rhtml-code and @mymods an array of objects from the query. I have currently no idea what function I should use (render_text does, of course, not work). Help is greatly appreciated. /TZer0

    Read the article

  • Make object available within php functions without passing them or making them global

    - by Matt
    Hey all, This requirement is just for simplicity for developers and beautiful code. I'm building a template system and I really would just like an object variable to simply be there in all functions. Here's some code: Librarian.php: $class = "slideshow"; $function = "basic"; $args = array(...); $librarian = $this; // I WOULD LIKE THIS TO BE PRESENT IN CALLED FUNCTION ... return call_user_func($class.'::'.$function, $args); ... Slideshow.php: public static function basic($args) { echo $librarian; // "Librarian Object" } Thanks! Matt Mueller

    Read the article

  • Routing configuration in cakephp

    - by ShiVik
    Hello all I am trying to implement routing in cakephp. I want the urls to mapped like this... www.example.com/nodes/main - www.example.com/main www.example.com/nodes/about - www.example.com/about So for this I wrote in my config/routes.php file.. Router::connect('/:action', array('controller' => 'nodes')); Now, I got the thing going but when I click on the links, the url in browser appears like www.example.com/nodes/main www.example.com/nodes/about Is there some way where I can get the urls to appear the way they are routed? Setting in .htaccess or httpd.conf would be easy - but I don't have access to that. Regards Vikram

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Completion block not being called. How to check validity?

    - by HCHogan
    I have this method which takes a block, but that block isn't always called. See the method: - (void)updateWithCompletion:(void (^)(void))completion { [MYObject myMethodWithCompletion:^(NSArray *array, NSError *error) { if (error) { NSLog(@"%s, ERROR not nil", __FUNCTION__); completion(); return; } NSLog(@"%s, calling completion %d", __FUNCTION__, &completion); completion(); NSLog(@"%s, finished completion", __FUNCTION__); }]; } I have some more NSLogs inside completion. Sometimes this program counter just blows right past the call to completion() in the code above. I don't see why this would be as the calling code always passes a literal block of code as input. If you're curious of the output of the line containing the addressof operator, it's always something different, but never 0 or nil. What would cause completion not to be executed?

    Read the article

< Previous Page | 517 518 519 520 521 522 523 524 525 526 527 528  | Next Page >