Search Results

Search found 17068 results on 683 pages for 'merge array'.

Page 523/683 | < Previous Page | 519 520 521 522 523 524 525 526 527 528 529 530  | Next Page >

• Can an Excel VBA UDF called from the worksheet ever be passed an instance of any Excel VBA object mo

  - by jtolle

  I'm 99% sure that the answer is "no", but I'm wondering if someone who is 100% sure can say so. Consider a VBA UDF: Public Function f(x) End Function When you call this from the worksheet, 'x' will be a number, string, boolean, error, array, or object of type 'Range'. Can it ever be, say, an instance of 'Chart', 'ListObject', or any other Excel-VBA object model class? (The question arose from me moving to Excel 2007 and playing with Tables, and wondering if I could write UDFs that accept them as parameters instead of Ranges. The answer to that seems to be no, but then I realized I didn't know for sure in general.)

  Read the article

• Implementing a configurable factory

  - by Decko

  I'm having difficulties finding out how to implement a 'configurable' behavior in a factory class in PHP. I've got at class, which takes another class as an argument in its constructor. The argument class could take a number of arguments in its constructor. An instance of my main class could look something like this $instance = new MyClass(new OtherClass(20, true)); $instance2 = new MyClass(new DifferentClass('test')); This is rather clumsy and has a number of problems and therefore I would like to move this into a factory class. The problem is that this factory somehow needs to know how to instantiate the argument class, as this class can have any number of arguments in the constructor. Preferably I would like to be able to do something like this $instance = Factory::build('OtherClass'); $instance2 = Factory::build('DifferentClass'); And let the factory retrieve the arguments from a configuration array or similar. Is there a proper solution to this problem?

  Read the article

• Zend Regex Route > Track the api version

  - by dskanth

  Hi, i am building a web service with zend and i am using modules to separate my api versions. Ex: "applications/modules/v1/controllers", "applications/modules/v2/controllers" have different set of actions and functionality. I have made "v1" as the default module in "application.ini" file: resources.modules = "" resources.frontController.defaultModule = "v1" resources.frontController.moduleDirectory = APPLICATION_PATH "/modules" resources.frontController.moduleControllerDirectoryName = "controllers" I have written the following in my bootstrap file: $router = $front->getRouter(); $r1 = new Zend_Controller_Router_Route_Regex('api/v1/tags.xml', array('module' => 'v1', 'controller' => 'tags', 'action' => 'index')); $router->addRoute('route1', $r1); Suppose, if this is my url: http://localhost/api/v1/tags.xml then it belongs to version 1 (v1). But i dont want to write many routes like this one, so i want to know how can i track the version from the regex url and dynamically determine the api version to be used (1 or 2).

  Read the article

• Which are your favorite programming language gadgets?

  - by FerranB

  There are some gadgets/features for programming languages that I like a lot because they save a lot of coding or simply because they are magical or nice. Some of my favorites are: C++ increment/decrement operator: my_array[++c]; C++ assign and sum or substract (...): a += b C# yield return: yield return 1; C# foreach: foreach (MyClass x in MyCollection) PLSQL for loop: for c in (select col1, col2 from mytable) PLSQL pipe row: for i in 1..x loop pipe row(i); end loop; Python Array access operator: a[:1] PLSQL ref cursors. Which are yours?

  Read the article

• Rails route, show all elements on the same page

  - by Igor Oliveira Antonio

  I need to show all my elements on the same page. In routes: namespace :nourishment do resources :diets do resources :nourishment_meals, :controller => 'meals' get 'nourishment_meals/show_all_meals' => 'meals#show_all_meals', as: "show_all_meals" end end which will generate: nourishment_diet_nourishment_meals_path GET /nourishment/diets/:diet_id/nourishment_meals(.:format) nourishment/meals#index POST /nourishment/diets/:diet_id/nourishment_meals(.:format) nourishment/meals#create new_nourishment_diet_nourishment_meal_path GET /nourishment/diets/:diet_id/nourishment_meals/new(.:format) nourishment/meals#new edit_nourishment_diet_nourishment_meal_path GET /nourishment/diets/:diet_id/nourishment_meals/:id/edit(.:format) nourishment/meals#edit nourishment_diet_nourishment_meal_path GET /nourishment/diets/:diet_id/nourishment_meals/:id(.:format) nourishment/meals#show PATCH /nourishment/diets/:diet_id/nourishment_meals/:id(.:format) nourishment/meals#update PUT /nourishment/diets/:diet_id/nourishment_meals/:id(.:format) nourishment/meals#update DELETE /nourishment/diets/:diet_id/nourishment_meals/:id(.:format) nourishment/meals#destroy [**THIS**] nourishment_diet_show_all_meals_path GET /nourishment/diets/:diet_id/nourishment_meals/show_all_meals(.:format) nourishment/meals#show_all_meals The problem, when I do this: <%= link_to "Show all meals", nourishment_diet_show_all_meals_path, :class=>"button green" %> This error raise: Problem: Document(s) not found for class NourishmentMeal with id(s) show_all. Summary: When calling NourishmentMeal.find with an id or array of ids, each parameter must match a document Can someone help me?

  Read the article

• Drag and Drop to explorer causing invalid FORMATETC (DV_E_FORMATETC) error

  - by JustABill

  I'm trying to use this excellent example to implement dropping virtual files into Windows Explorer. However, I'm stymied by this error. Towards the bottom, inside void System.Runtime.InteropServices.ComTypes.IDataObject.GetData(ref System.Runtime.InteropServices.ComTypes.FORMATETC formatetc, out System.Runtime.InteropServices.ComTypes.STGMEDIUM medium) on the first call to ((System.Runtime.InteropServices.ComTypes.IDataObject)this).GetDataHere(ref formatetc, ref medium); I'm getting back a DV_E_FORMATETC error. As far as I can tell, all the elements of the FORMATETC struct that are being passed in are valid: cfFormat is "Shell IDList Array" (-16141), ptd is 0, dwAspect is DVASPECT_CONTENT, lindex is -1, and tymed is TYMED_HGLOBAL. I'm kind of confused how there'd be a problem anyway, since this was generated by explorer. I know very little about COM interaction, so any help would be greatly appreciated.

  Read the article

• How do I include 2 tables in one LocalStorage item?

  - by Noor

  I've got a table that you can edit, and I've got a simple code saving that list when you're done with editing it. (the tables have the contenteditable on) The problem I've stumbled upon is that if I double click on enter, the table gets divided into two separate tables with the same ID. This causes the code I'm using to set the localStorage to only store one of the tables (I assume the first).. I've thought of different solutions and I wonder if someone could point out the pro's and con's (if the solutions even works that is). Make a loop that checks the page after tables and stores them into an array of localStorage-items.. I'd have to dynamically create a localStorage item for each table. Take the whole div that the tables are in, and store that in the localStorage, when a user revisits the page, the page checks after the items in storage and displays the whole divs. Any suggestions you have that can beat this :).. (but no cache, it has to be with the localStorage!) Thanks

  Read the article

• Setting post tags in wordpress via XMLRPC API when submitting a post?

  - by aviv

  Hi, I am trying to use WordPress API via XMLRPC to submit new posts. But i can't set the post tags (nor the categories). echo "Adding $term to blog via XMLRPC ..."; $client = new IXR_Client("http://$blog.wordpress.com/xmlrpc.php"); $content = array('title'=>$term, 'description'=>"All about $term", 'category'=>'barvaz,moshe', 'tags'=>'tag1,tag2'); $client->query('metaWeblog.newPost', 0, $username, $password, $content, true); $rv = $client->getResponse(); print_r($rv); Any idea?

  Read the article

• Zend Framework PartialLoop - questions

  - by Ian Warner

  Hi Ok dealing with Partial Loops I want to do several things Perhaps pass in extra variables - seen it done like this echo $this-partialLoop('Loop.phtml', array('data' = $data, 'var1' = foo)); But this does not seem to work - I can not extra the data using $this-var $this-data-var or $data-var not sure how to access the data in the loop Sutotals for columns - need a way of resetting variables or passing in a default value - linked to the above I suppose ie $subtotal += rowTotal; In the view that calls the partial I would like to get access to the subtotal values generated so I can display these in another table below. Any help appreciated the docs on partialLoop seems incomplete. Ian

  Read the article

• WordPress Problem with enqueing a script

  - by casben79

  I am trying to enqueue a script from the functions.php file for a custom theme. here is the code I am using: wp_enqueue_script('innerfade','correct/path/to/innerfade.js', array('jquery'), '', false); I also tried to hardcode from the the functions file like so: ?> <script type='text/javascript' src="correct/path/to/innerfade.js"></script> <?php and both are outputting the following: correct/path/to/innerfade.js'?ver=2.9.2 so It doesnt seem to be a wp_enqueue_script problem What I cannot seem to figure is where the hell is the comma after the .js is coming from, it is causing a dead link hence not loading the script, anyone have any ideas??

  Read the article

• property not updating in object when page is posted

  - by Jared

  Hi I have set a property in a constructor like so function __construct() { $this->count = count(@$_SESSION['filearray']); //count how many files in array } and using it in condition statements if($this->count > 10) //then do something but it appears the count isn't being updated when I use another method of injecting values into this 'filearray' until I refresh the page. am I doing something wrong? I thought that my constructor would detect a change had been made in the session and whenever I call $this-count I would get the current count value but it seems to be 1 step behind until I refresh the page. If this is all vague I can include my form page that has all the method calls, but this is the jist of my question, why is my property not updating and how do I fix it :) TIA

  Read the article

• How to restrict access to my web service?

  - by Hank

  I have http://example.com/index.html, which from within the HTML uses JavaScript to call a web services at http://example.com/json/?a=...&b=... The web service returns to index.html a JSON array of information to then be displayed on index.html. Since anyone can view the source code for index.html and see how I'm calling the JSON web services (http://example.com/json/), how do I prevent people from calling my JSON web service directly? Since the web service is essentially an open read into my database, I don't want people to abuse the web service and start DoS my server, fetching more information than they should, etc..

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Curl automatically display the result?

  - by Emily

  I'm using php 5.3.2 and when i execute a curl it display the result directly without adding a print or echo function. Here is my code: <?php $pvars = array('query' => 'ice age', 'orderby' => 'popularity'); $timeout = 30; $myurl = "http://www.website.com"; $curl = curl_init(); curl_setopt($curl, CURLOPT_URL, $myurl); curl_setopt($curl, CURLOPT_TIMEOUT, $timeout); curl_setopt($curl, CURLOPT_POST, 1); curl_setopt($curl, CURLOPT_POSTFIELDS, $pvars); $xml = curl_exec($curl); curl_close ($curl); ?> What's wrong with my code and why it displays the result?

  Read the article

• Inserting multiple types into an SQLite database with Python

  - by mankoff

  I'm trying to create an SQLite 3 database from Python. I have a few types I'd like to insert into each record: A float, and then 3 groups of n floats, currently a tuple but could be an array or list.. I'm not well-enough versed in Python to understand all the differences. My problem is the INSERT statement. DAS = 12345 lats = (42,43,44,45) lons = (10,11,12,13) times = (1,2,3,4,5,6,7,8,9) import sqlite3 connection = sqlite3.connect("test.db") cursor = connection.cursor() cursor.execute( "create table foo(DAS LONG PRIMARY KEY,lats real(4),lons real(4), times real(9) )" ) I'm not sure what comes next. Something along the lines of: cmd = 'INSERT into foo values (?,?,?,?), ..." cursor.execute(cmd) How should I best build the SQL insert command given this data?

  Read the article

• implicit parameter definition in class

  - by coubeatczech

  implicit val odkaz = head; def vypis(implicit odkaz:Prvek):String = { odkaz match{ case null => "" case e => e.cislo + " " + e.pocet + "\n" + vypis(e.dalsi) } } ... def main(args:Array[String]){ val q = new MyQueue() // insert some values println(q.vypis) } This method(vypis) is a member of an queue-class so I'll always want to implicity start the recursion from the start of the queue, when calling the method from outside. Is there a way how to write it, that the method from outside calling, there's no paramter, but in inside, there's a parameter - for recursion...? The compiler complains that the parameter is not defined when called from outside

  Read the article

• .NET Regular expressions on bytes instead of chars

  - by brickner

  Hi, I'm trying to do some parsing that will be easier using regular expressions. The input is an array (or enumeration) of bytes. I don't want to convert the bytes to chars for the following reasons: Computation efficiency Memory consumption efficiency Some non-printable bytes might be complex to convert to chars. Not all the bytes are printable. So I can't use Regex. The only solution I know, is using Boost.Regex (which works on bytes - C chars), but this is a C++ library that wrapping using C++/CLI will take considerable work. How can I use regular expressions on bytes in .NET directly, without working with .NET strings and chars? Thank you.

  Read the article

• What's the simplest way to create a Zend_Form tabular display with each row having a radio button?

  - by RenderIn

  I've seen simple examples of rendering a Zend_Form using decorators, but I'm not sure they are able to handle the issue I'm facing very well. I query the database and get an array of user objects. I want to display these users as a form, with a radio button next to each of them and a submit button at the bottom of the page. Here's roughly what the form will look like: [user id] [email] [full name] ( ) 1 [email protected] Test user 1 (*) 2 [email protected] Test user 2 [SUBMIT] Is this something achievable in a reasonably straightforward way or do I need to use the ViewScript partial?

  Read the article

• How can I capture multiple matches from the same Perl regex?

  - by Sho Minamimoto

  I'm trying to parse a single string and get multiple chunks of data out from the same string with the same regex conditions. I'm parsing a single HTML doc that is static (For an undisclosed reason, I can't use an HTML parser to do the job.) I have an expression that looks like: $string =~ /\<img\ssrc\="(.*)"/; and I want to get the value of $1. However, in the one string, there are many img tags like this, so I need something like an array returned (@1?) is this possible?

  Read the article

• Best practices for querying an entire row in a database table? (MySQL / CodeIgniter)

  - by Walker

  Sorry for the novice question! I have a table called cities in which I have fields called id, name, xpos, ypos. I'm trying to use the data from each row to set a div's position and name. What I'm wondering is what's the best practice for dynamically querying an unknown amount of rows (I don't know how many cities there might be, I want to pull the information from all of them) and then passing the variables from the model into the view and then setting attributes with it? Right now I've 'hacked' a solution where I run a different function each time which pulls a value using a query ('SELECT id FROM cities;'), then I store that in a global array variable and pass it into view. I do this for each var so I have arrays called: city_idVar, city_nameVar, city_xposVar, city_yposVar then I know that the city_nameVar[0] matches up with city_xposVar[0] etc. Is there a better way?

  Read the article

• Handle order dependence in for loops

  - by Matt

  Hey all, I'm making a templating system where I instantiate each tag using a foreach loop. The issue is that some of the tags rely on each other so, I'm wondering how to get around that ordering from the looping. Here's an example: Class A { public $width; __construct() { $this->width = $B->width(); // Undefined! Or atleast not set yet.. } } Class B { private $width; __construct() { $this->width = "500px"; } __tostring() { return "Hello World!"; } } Template.php $tags = array("A", "B"); foreach ($tags as $tag) { $TagObj[$tag] = new $tag(); } echo $TagObj['A']->width; // Nadamundo! I know this has applications elsewhere and I'm sure this has been solved before, if someone could enlighten me or point me in the right direction that'd be great! Thanks! Matt Mueler

  Read the article

• Why does GetClusterShape return null when the cluster specification was retrieved through the GetClu

  - by Markus Olsson

  Suppose I have a virtual earth shape layer called shapeLayer1 (my creative energy is apparently at an alltime low). When i call the GetClusteredShapes method I get an array of VEClusterSpecification objects that represent each and every one of my currently visible clusters; no problem there. But when I call the GetClusterShape() method it returns null... null! Why on earth would it do that? I used firebug to confirm that the private variable of the VEClusterSpecification that's supposed to hold a reference to the shape is indeed null so it's not the method that's causing the problem. Some have suggested that this is actually documented behavior Returns null if a VEClusterSpecification object was returned from the VEShapeLayer.GetClusteredShapes Method But looking at the current MSDN documentation for the VEShape class it says: Returns if a VEClusterSpecification object was returned from the VEShapeLayer.GetClusteredShapes Method Is this a bug or a feature? Is there any known workarounds or (if it is a bug) some plan on when they are going to fix it?

  Read the article

• What is the scope of JS variables in anonymous functions

  - by smorhaim

  Why does this code returns $products empty? If I test for $products inside the function it does show data... but once it finishes I can't seem to get the data. var $products = new Array(); connection.query($sql, function(err, rows, fields) { if (err) throw err; for(i=0; i< rows.length; i++) { $products[rows[i].source_identifier] = "xyz"; } }); connection.end(); console.log($products); // Shows empty.

  Read the article

• problem in return value from server to client in ajax useing zend-framework

  - by user1400

  hello i try to use ajax and zend in my application , i could pass variable to server but i can not get data from server , it does not return values, it return all html code page, where is my mistake? $('#myForm').submit(function($e){ $e.preventDefault(); var $paramToServer=$("#myForm").serialize(); $.ajax({ type:'POST', url:'test', data:$paramToServer , success:function(re){ var res = $.evalJSON(re); console.log(res.id); // to see in firebog }, dataType:'json' }); }); public function testAction() { // action body $this->_helper->getHelper('viewRenderer')->setNoRender(); // If you use layout, disable it Zend_Layout::getMvcInstance()->disableLayout(); $name=$this->getRequest()->getParam ( 'name' ); //pass $name to server $return = array( 'id' => '5', 'family' => 'hello ', ); $return = Zend_Json::encode( $return); // Response $this->getResponse()->setBody($return); }

  Read the article

• Sales figures not displayed in form

  - by Brian Wilson

  Trying to calculate total sales for 5 items, 3 stores. Here's a s/s of what Im getting, along with my code. What am I missing/doing wrong? (p.s. It's not returning an error code in 'debug') Public Class Form1 Private Sub btnCalc_Click(sender As Object, e As EventArgs) Handles btnCalc.Click Dim ttlsales As Double 'set up array data Dim sales(,) As Integer = {{25, 64, 23, 45, 14}, {12, 82, 19, 34, 63}, {54, 22, 17, 43, 35}} Dim price() As Double = {12.0, 17.95, 95.0, 86.5, 78.0} 'mark totals Dim totals(2) As Double For store As Integer = 0 To 2 For item As Integer = 0 To 4 Next Next 'display output lstOut.Items.Add("Sales Per Store") For store As Integer = 0 To 2 lstOut.Items.Add(store + 1 & ":" & FormatCurrency(totals(store))) ttlsales += totals(store) Next lstOut.Items.Add("Total Sales: " & FormatCurrency(ttlsales)) End Sub End Class

  Read the article

< Previous Page | 519 520 521 522 523 524 525 526 527 528 529 530  | Next Page >