Search Results

Search found 17068 results on 683 pages for 'merge array'.

Page 523/683 | < Previous Page | 519 520 521 522 523 524 525 526 527 528 529 530  | Next Page >

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • .NET Regular expressions on bytes instead of chars

    - by brickner
    Hi, I'm trying to do some parsing that will be easier using regular expressions. The input is an array (or enumeration) of bytes. I don't want to convert the bytes to chars for the following reasons: Computation efficiency Memory consumption efficiency Some non-printable bytes might be complex to convert to chars. Not all the bytes are printable. So I can't use Regex. The only solution I know, is using Boost.Regex (which works on bytes - C chars), but this is a C++ library that wrapping using C++/CLI will take considerable work. How can I use regular expressions on bytes in .NET directly, without working with .NET strings and chars? Thank you.

    Read the article

  • XSLT: How to escape square brackets in Urls

    - by ilariac
    I have a set of records from Solr where field[@name='url'] can have the following format: http://url/blabla/blabla.aspx?sv=[keyword%20keyword,%201] My understanding is that the square brackets denote an array syntax and I would like to use XSLT to remove the square brackets from all Urls. The reason for this is that I am using an Open URL resolver, which does not currently handle well those characters. The best option would be to strip the square brackets from all URLs before such resources are mediated by the Open URL resolver. There are cases where I have multiple occurrences of square brackets per Url. Can you please help me with this? Thanks for your help, I.

    Read the article

  • rails update whole index of a model with one click

    - by mattherick
    hello! i have a store model, this will handle my leaflet and my shoppingcart for my shop. now i d´like to show all items added from an user to his leaflet in the index of store. in the store an user can change the quantity of the choosen items. and now i want to save that the changes of the different quantities in the database with one click on a button "update store". so how could i implement an update over the whole index with one click? i´d like to do this with ajax and most dynamically. somebody has an idea? i render all items into a form so far, but now i have the problem, when i submit this form only the last quantity and item id are included in the params. further i pushed every quantity into an array and i want to submit this also as a param. but i could not. please give me some tips, will be very fine :) mattherick

    Read the article

  • How to get nearby POIs

    - by balexandre
    I have a database with Points of Interest that all have an address. I want to know what is the method/name/call to get all nearby POIs from a given position. I understand that I need to convert all my addresses to LAT / LON coordinates at least, but my question is: for a given LAT / LONG how do I get from the database/array what POIs are nearby by distance, for example: You are here 0,0 nearest POIs in a 2km radius are: POI A (at 1.1 Km) POI C (at 1.3 Km) POI F (at 1.9 Km) I have no idea what should I look into to get what I want :-( Any help is greatly appreciated. Thank you

    Read the article

  • /clr option in c++

    - by muhammad-aslam
    hello friendzz plz give me a solution for this error "fatal error C1190: managed targeted code requires a '/clr' option" HOw can i resolve this problem?? My configuration is .. Visual studio 2008 windows 7 Here is the code (i got by using net resources) using using namespace System; using namespace System::IO; int main() { // Create a reference to the current directory. DirectoryInfo* di = new DirectoryInfo(Environment::CurrentDirectory); // Create an array representing the files in the current directory. FileInfo* fi[] = di-GetFiles(); Console::WriteLine(S"The following files exist in the current directory:"); // Print out the names of the files in the current directory. Collections::IEnumerator* myEnum = fi-GetEnumerator(); while (myEnum-MoveNext()) { FileInfo* fiTemp = __try_cast(myEnum-Current); Console::WriteLine(fiTemp-Name); } } PLZZZZZZZZ

    Read the article

  • Prototype to JQuery - how to access originator of event

    - by ciaranarcher
    Hi there I'm coming from a Prototype background and looking into JQuery. I'd like to know the 'right' way to do attach a click event to a bunch of elements, but then know in the event handler which one of my elements was clicked. I've come up with the following: MYNS.CarouselHelper.prototype.attachImgHandlers = function () { $j(".carouselItem").bind("click", this, function(e){ e.data.openCarouselImage(e) }); } I then have the following in my event handler: MYNS.CarouselHelper.prototype.openCarouselImage = function(e) { var img = e.currentTarget; // Do stuff to the image element }; Is this 'right'? It feels wrong to me as I am used to explicitly passing the element to the event handler in Prototype as I loop through an array of elements. Thanks in advance.

    Read the article

  • How to restrict access to my web service?

    - by Hank
    I have http://example.com/index.html, which from within the HTML uses JavaScript to call a web services at http://example.com/json/?a=...&b=... The web service returns to index.html a JSON array of information to then be displayed on index.html. Since anyone can view the source code for index.html and see how I'm calling the JSON web services (http://example.com/json/), how do I prevent people from calling my JSON web service directly? Since the web service is essentially an open read into my database, I don't want people to abuse the web service and start DoS my server, fetching more information than they should, etc..

    Read the article

  • Zend Framework PartialLoop - questions

    - by Ian Warner
    Hi Ok dealing with Partial Loops I want to do several things Perhaps pass in extra variables - seen it done like this echo $this-partialLoop('Loop.phtml', array('data' = $data, 'var1' = foo)); But this does not seem to work - I can not extra the data using $this-var $this-data-var or $data-var not sure how to access the data in the loop Sutotals for columns - need a way of resetting variables or passing in a default value - linked to the above I suppose ie $subtotal += rowTotal; In the view that calls the partial I would like to get access to the subtotal values generated so I can display these in another table below. Any help appreciated the docs on partialLoop seems incomplete. Ian

    Read the article

  • Helper functions & prototype methods to replace heavy frameworks?

    - by Rob
    All frameworks aside, what are some of the common helper functions/prototype methods you use on a daily basis? Please note I am not arguing against frameworks. I've simply found that the majority of what I do on a daily basis can, most often, be done with a few dozen Array, String and Element.prototype methods. With the addition of a few helper functions like $ (getElementsById) and $$$ (getElementsByClass), I am able to satisfy some of the core benefits, however basic, of a much heavier framework. If you were to collect a small library of basic methods and functions to replace the core functionality of some of the popular frameworks, what would they be?

    Read the article

  • friendship and operator overloading help

    - by sil3nt
    hello there, I have the following class #ifndef Container_H #define Container_H #include <iostream> using namespace std; class Container{ friend bool operator==(const Container &rhs,const Container &lhs); public: void display(ostream & out) const; private: int sizeC; // size of Container int capacityC; // capacity of dynamic array int * elements; // pntr to dynamic array }; ostream & operator<< (ostream & out, const Container & aCont); #endif and this source file #include "container.h" /*----------------------------********************************************* note: to test whether capacityC and sizeC are equal, must i add 1 to sizeC? seeing as sizeC starts off with 0?? */ Container::Container(int maxCapacity){ capacityC = maxCapacity; elements = new int [capacityC]; sizeC = 0; } Container::~Container(){ delete [] elements; } Container::Container(const Container & origCont){ //copy constructor? int i = 0; for (i = 0; i<capacityC; i++){ //capacity to be used here? (*this).elements[i] = origCont.elements[i]; } } bool Container::empty() const{ if (sizeC == 0){ return true; }else{ return false; } } void Container::insert(int item, int index){ if ( sizeC == capacityC ){ cout << "\n*** Next: Bye!\n"; return; // ? have return here? } if ( (index >= 0) && (index <= capacityC) ){ elements[index] = item; sizeC++; } if ( (index < 0) && (index > capacityC) ){ cout<<"*** Illegal location to insert--"<< index << ". Container unchanged. ***\n"; }//error here not valid? according to original a3? have i implemented wrong? } void Container::erase(int index){ if ( (index >= 0) && (index <= capacityC) ){ //correct here? legal location? int i = 0; while (i<capacityC){ //correct? elements[index] = elements[index+1]; //check if index increases here. i++; } sizeC=sizeC-1; //correct? updated sizeC? }else{ cout<<"*** Illegal location to be removed--"<< index << ". Container unchanged. ***\n"; } } int Container::size()const{ return sizeC; //correct? } /* bool Container::operator==(const Container &rhs,const Container &lhs){ int equal = 0, i = 0; for (i = 0; i < capacityC ; i++){ if ( rhs.elements[i] == lhs.elements[i] ){ equal++; } } if (equal == sizeC){ return true; }else{ return false; } } ostream & operator<< (ostream & out, const Container & aCont){ int i = 0; for (i = 0; i<sizeC; i++){ out<< aCont.elements[i] << " " << endl; } } */ I dont have the other functions in the header file (just a quikie). Anyways, the last two functions in "/* */" I cant get to work, what am I doing wrong here? the first function is to see whether the two arrays are equal to one another

    Read the article

  • Grouping search results with thinking_sphinx plugin for rails

    - by Shagymoe
    I can use the following to group results, but it only returns one result per group. @results = Model.search params[:search_query], :group_by => 'created_at', :group_function => :day, :page => params[:page], :per_page => 50 So, if I display the results by day, I only get one result per day. <% @results.each_with_groupby do |result, group| %> <div class="group"><%= group %></div> <ul class="result"> <li><%= result.name %></li> </ul> <% end %> Do I have to parse the @results array and group them by date manually or am I missing something? Here is the line from the sphinx docs: http://sphinxsearch.com/docs/current.html#clustering "The final search result set then contains one best match per group."

    Read the article

  • Setting post tags in wordpress via XMLRPC API when submitting a post?

    - by aviv
    Hi, I am trying to use WordPress API via XMLRPC to submit new posts. But i can't set the post tags (nor the categories). echo "Adding $term to blog via XMLRPC ..."; $client = new IXR_Client("http://$blog.wordpress.com/xmlrpc.php"); $content = array('title'=>$term, 'description'=>"All about $term", 'category'=>'barvaz,moshe', 'tags'=>'tag1,tag2'); $client->query('metaWeblog.newPost', 0, $username, $password, $content, true); $rv = $client->getResponse(); print_r($rv); Any idea?

    Read the article

  • Curl automatically display the result?

    - by Emily
    I'm using php 5.3.2 and when i execute a curl it display the result directly without adding a print or echo function. Here is my code: <?php $pvars = array('query' => 'ice age', 'orderby' => 'popularity'); $timeout = 30; $myurl = "http://www.website.com"; $curl = curl_init(); curl_setopt($curl, CURLOPT_URL, $myurl); curl_setopt($curl, CURLOPT_TIMEOUT, $timeout); curl_setopt($curl, CURLOPT_POST, 1); curl_setopt($curl, CURLOPT_POSTFIELDS, $pvars); $xml = curl_exec($curl); curl_close ($curl); ?> What's wrong with my code and why it displays the result?

    Read the article

  • Refreshing a UITableView

    - by MihaiD
    I have a UITableView subclass and a UITableViewCell sublass that I'm using for cells. I'm bulding all my cells in advance and store them in an array from where I use them in cellForRowAtIndexPath. Aside from this I have a thread that loads some images in each cell, in the background. The problem is that the cells don't get refreshed as fast as the images are loaded. For example, if I don't scroll my table view, the first cells only get refreshed when all cells have been modified and the thread has exited. Any ideas on how I can effectively refresh my tableview/cell?

    Read the article

  • Best practices for querying an entire row in a database table? (MySQL / CodeIgniter)

    - by Walker
    Sorry for the novice question! I have a table called cities in which I have fields called id, name, xpos, ypos. I'm trying to use the data from each row to set a div's position and name. What I'm wondering is what's the best practice for dynamically querying an unknown amount of rows (I don't know how many cities there might be, I want to pull the information from all of them) and then passing the variables from the model into the view and then setting attributes with it? Right now I've 'hacked' a solution where I run a different function each time which pulls a value using a query ('SELECT id FROM cities;'), then I store that in a global array variable and pass it into view. I do this for each var so I have arrays called: city_idVar, city_nameVar, city_xposVar, city_yposVar then I know that the city_nameVar[0] matches up with city_xposVar[0] etc. Is there a better way?

    Read the article

  • Implementing a configurable factory

    - by Decko
    I'm having difficulties finding out how to implement a 'configurable' behavior in a factory class in PHP. I've got at class, which takes another class as an argument in its constructor. The argument class could take a number of arguments in its constructor. An instance of my main class could look something like this $instance = new MyClass(new OtherClass(20, true)); $instance2 = new MyClass(new DifferentClass('test')); This is rather clumsy and has a number of problems and therefore I would like to move this into a factory class. The problem is that this factory somehow needs to know how to instantiate the argument class, as this class can have any number of arguments in the constructor. Preferably I would like to be able to do something like this $instance = Factory::build('OtherClass'); $instance2 = Factory::build('DifferentClass'); And let the factory retrieve the arguments from a configuration array or similar. Is there a proper solution to this problem?

    Read the article

  • Overwriting arguments object for a Javascript function

    - by Ian Storm Taylor
    If I have the following: // Clean input. $.each(arguments, function(index, value) { arguments[index] = value.replace(/[\W\s]+/g, '').toLowerCase(); }); Would that be a bad thing to do? I have no further use for the uncleaned arguments in the function, and it would be nice not to create a useless copy of arguments just to use them, but are there any negative effects to doing this? Ideally I would have done this, but I'm guessing this runs into problems since arguments isn't really an Array: arguments = $.map(arguments, function(value) { return value.replace(/[\W\s]+/g, '').toLowerCase(); }); Thanks for any input. EDIT: I've just realized that both of these are now inside their own functions, so the arguments object has changed. Any way to do this without creating an unnecessary variable?

    Read the article

  • Which are your favorite programming language gadgets?

    - by FerranB
    There are some gadgets/features for programming languages that I like a lot because they save a lot of coding or simply because they are magical or nice. Some of my favorites are: C++ increment/decrement operator: my_array[++c]; C++ assign and sum or substract (...): a += b C# yield return: yield return 1; C# foreach: foreach (MyClass x in MyCollection) PLSQL for loop: for c in (select col1, col2 from mytable) PLSQL pipe row: for i in 1..x loop pipe row(i); end loop; Python Array access operator: a[:1] PLSQL ref cursors. Which are yours?

    Read the article

  • implicit parameter definition in class

    - by coubeatczech
    implicit val odkaz = head; def vypis(implicit odkaz:Prvek):String = { odkaz match{ case null => "" case e => e.cislo + " " + e.pocet + "\n" + vypis(e.dalsi) } } ... def main(args:Array[String]){ val q = new MyQueue() // insert some values println(q.vypis) } This method(vypis) is a member of an queue-class so I'll always want to implicity start the recursion from the start of the queue, when calling the method from outside. Is there a way how to write it, that the method from outside calling, there's no paramter, but in inside, there's a parameter - for recursion...? The compiler complains that the parameter is not defined when called from outside

    Read the article

  • Drag and Drop to explorer causing invalid FORMATETC (DV_E_FORMATETC) error

    - by JustABill
    I'm trying to use this excellent example to implement dropping virtual files into Windows Explorer. However, I'm stymied by this error. Towards the bottom, inside void System.Runtime.InteropServices.ComTypes.IDataObject.GetData(ref System.Runtime.InteropServices.ComTypes.FORMATETC formatetc, out System.Runtime.InteropServices.ComTypes.STGMEDIUM medium) on the first call to ((System.Runtime.InteropServices.ComTypes.IDataObject)this).GetDataHere(ref formatetc, ref medium); I'm getting back a DV_E_FORMATETC error. As far as I can tell, all the elements of the FORMATETC struct that are being passed in are valid: cfFormat is "Shell IDList Array" (-16141), ptd is 0, dwAspect is DVASPECT_CONTENT, lindex is -1, and tymed is TYMED_HGLOBAL. I'm kind of confused how there'd be a problem anyway, since this was generated by explorer. I know very little about COM interaction, so any help would be greatly appreciated.

    Read the article

  • WordPress Problem with enqueing a script

    - by casben79
    I am trying to enqueue a script from the functions.php file for a custom theme. here is the code I am using: wp_enqueue_script('innerfade','correct/path/to/innerfade.js', array('jquery'), '', false); I also tried to hardcode from the the functions file like so: ?> <script type='text/javascript' src="correct/path/to/innerfade.js"></script> <?php and both are outputting the following: correct/path/to/innerfade.js'?ver=2.9.2 so It doesnt seem to be a wp_enqueue_script problem What I cannot seem to figure is where the hell is the comma after the .js is coming from, it is causing a dead link hence not loading the script, anyone have any ideas??

    Read the article

  • Benefits of Behavior Driven Development

    - by Aligned
    Originally posted on: http://geekswithblogs.net/Aligned/archive/2013/07/26/benefits-of-behavior-driven-development.aspxContinuing my previous article on BDD, I wanted to point out some benefits of BDD and since BDD is an extension of Test Driven Development (TDD), you get those as well. I’ll add another article on some possible downsides of this approach. There are many articles about the benefits of TDD and they apply to BDD. I’ve pointed out some here and copied some of the main points for each article, but there are many more including the book The Art of Unit Testing by Roy Osherove. http://geekswithblogs.net/leesblog/archive/2008/04/30/the-benefits-of-test-driven-development.aspx (Lee Brandt) Stability Accountability Design Ability Separated Concerns Progress Indicator http://tddftw.com/benefits-of-tdd/ Help maintainers understand the intention behind the code Bring validation and proper data handling concerns to the forefront. Writing the tests first is fun. Better APIs come from writing testable code. TDD will make you a better developer. http://www.slideshare.net/dhelper/benefit-from-unit-testing-in-the-real-world (from Typemock). Take a look at the slides, especially the extra time required for TDD (slide 10) and the next one of the bugs avoided using TDD (slide 11). Less bugs (slide 11) about testing and development (13) Increase confidence in code (14) Fearlessly change your code (14) Document Requirements (14) also see http://visualstudiomagazine.com/articles/2013/06/01/roc-rocks.aspx Discover usability issues early (14) All these points and articles are great and there are many more. The following are my additions to the benefits of BDD from using it in real projects for my company. July 2013 on MSDN - Behavior-Driven Design with SpecFlow Scott Allen did a very informative TDD and MVC module, but to me he is doing BDDCompile and Execute Requirements in Microsoft .NET ~ Video from TechEd 2012 Communication I was working through a complicated task that the decision tree kept growing. After writing out the Given, When, Then of the scenario, I was able tell QA what I had worked through for their initial test cases. They were able to add from there. It is also useful to use this language with other developers, managers, or clients to help make informed decisions on if it meets the requirements or if it can simplified to save time (money). Thinking through solutions, before starting to code This was the biggest benefit to me. I like to jump into coding to figure out the problem. Many times I don't understand my path well enough and have to do some parts over. A past supervisor told me several times during reviews that I need to get better at seeing "the forest for the trees". When I sit down and write out the behavior that I need to implement, I force myself to think things out further and catch scenarios before they get to QA. A co-worker that is new to BDD and we’ve been using it in our new project for the last 6 months, said “It really clarifies things”. It took him awhile to understand it all, but now he’s seeing the value of this approach (yes there are some downsides, but that is a different issue). Developers’ Confidence This is huge for me. With tests in place, my confidence grows that I won’t break code that I’m not directly changing. In the past, I’ve worked on projects with out tests and we would frequently find regression bugs (or worse the users would find them). That isn’t fun. We don’t catch all problems with the tests, but when QA catches one, I can write a test to make sure it doesn’t happen again. It’s also good for Releasing code, telling your manager that it’s good to go. As time goes on and the code gets older, how confident are you that checking in code won’t break something somewhere else? Merging code - pre release confidence If you’re merging code a lot, it’s nice to have the tests to help ensure you didn’t merge incorrectly. Interrupted work I had a task that I started and planned out, then was interrupted for a month because of different priorities. When I started it up again, and un-shelved my changes, I had the BDD specs and it helped me remember what I had figured out and what was left to do. It would have much more difficult without the specs and tests. Testing and verifying complicated scenarios Sometimes in the UI there are scenarios that get tricky, because there are a lot of steps involved (click here to open the dialog, enter the information, make sure it’s valid, when I click cancel it should do {x}, when I click ok it should close and do {y}, then do this, etc….). With BDD I can avoid some of the mouse clicking define the scenarios and have them re-run quickly, without using a mouse. UI testing is still needed, but this helps a bunch. The same can be true for tricky server logic. Documentation of Assumptions and Specifications The BDD spec tests (Jasmine or SpecFlow or other tool) also work as documentation and show what the original developer was trying to accomplish. It’s not a different Word document, so developers will keep this up to date, instead of letting it become obsolete. What happens if you leave the project (consulting, new job, etc) with no specs or at the least good comments in the code? Sometimes I think of a new scenario, so I add a failing spec and continue in the same stream of thought (don’t forget it because it was on a piece of paper or in a notepad). Then later I can come back and handle it and have it documented. Jasmine tests and JavaScript –> help deal with the non-typed system I like JavaScript, but I also dislike working with JavaScript. I miss C# telling me if a property doesn’t actually exist at build time. I like the idea of TypeScript and hope to use it more in the future. I also use KnockoutJs, which has observables that need to be called with ending (), since the observable is a function. It’s hard to remember when to use () or not and the Jasmine specs/tests help ensure the correct usage.   This should give you an idea of the benefits that I see in using the BDD approach. I’m sure there are more. It talks a lot of practice, investment and experimentation to figure out how to approach this and to get comfortable with it. I agree with Scott Allen in the video I linked above “Remember that TDD can take some practice. So if you're not doing test-driven design right now? You can start and practice and get better. And you'll reach a point where you'll never want to get back.”

    Read the article

  • How to draw/manage a hexagon grid?

    - by W.N.
    I've read this article: generating/creating hexagon grid in C . But look like both the author and answerer have already abandoned it. v(hexagonSide - hexagonWidth * hexagonWidth): What's hexagonSide and hexagonWidth? Isn't it will < 0 (so square root can't be calculated). And, can I put a hexagon into a rectangle? I need to create a grid like this: One more thing, how can I arrange my array to store data, as well as get which cells are next to one cell? I have never been taught about hexagon, so I know nothing about it, but I can easily learn new thing, so if you can explain or give me a clue, I may do it myself.

    Read the article

  • how do i see if a big JSON object contains a value?

    - by Haroldo
    I'm using PHP to json encode a massive multi-dimensional array of events, so i get something like this: var ents = {"7":{"event_id":"7","nn":"The Whisky Drifters","nn_url":"the-whisky-drifters","venue":"The Grain Barge","date_num":"2010-06-11","date_txt":"Friday 11th June","gig_club":"1","sd":"A New Acoustic String Band...","ven_id":"44","art":0},"15":{"event_id":"15","nn":"Bass Kitchen","nn_url":"bass-kitchen","venue":"Timbuk2","date_num":"2010-06-11","date_txt":"Friday 11th June","gig_club":"2","sd":"Hexadecimal \/ DJ Derek \/ Id","ven_id":"21","art":1}, the first dimension is the id, see var ents = {"7":{ So its possible to get the ids without examining the nested objects... What's the fastest, most efficent way to check if my JSON contains an id?

    Read the article

< Previous Page | 519 520 521 522 523 524 525 526 527 528 529 530  | Next Page >