Search Results

Search found 52807 results on 2113 pages for 'system tables'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 524/2113 | < Previous Page | 520 521 522 523 524 525 526 527 528 529 530 531  | Next Page >

  • Symfony 1.4: use relations in fixtures with propel

    - by iggnition
    Hello, I just started to use the PHP symfony framework. Currently I'm trying to create fixture files in YAML to easily insert data into my MySQL database. Now my database has a couple of relations, I have the tables Organisation and Location. Organisation org_id (PK) org_name Location loc_id (PK) org_id (FK) loc_name Now I'm trying too link these tables in my fixture file, but for the life of me I cannot figure out how. Since the org_id is auto-incremented I can't simply use org_id: 1 In the location fixture. How can I fix this?

    Read the article

  • Enable access for assistive device programmatically

    - by Dheeraj
    Hi All, I want to enable Access for assistive devices in System Preferences programmatically. But Problem is that my application is not running as root user and i do not want my application to be as root user and also should not ask for any authentication in between. I want to tap all keyboard events globally. I am using CGEventTapCreate() for the same.In the documentation of CGEventTapCreate() API it is mentioned that, Event taps receive key up and key down events if one of the following conditions is true: The current process is running as the root user. Access for assistive devices is enabled. In Mac OS X v10.4 & later, you can enable this feature using System Preferences, Universal Access panel, Keyboard view. I tried manually by checking the Enable Access for assistive devices from System Preference and it gives me expected output. So is there any way to do the same via program without asking for authentication and also application is not running as root user? Thanks, Dheeraj.

    Read the article

  • Minimizing SQL queries using join with one-to-many relationship

    - by Brian
    So let me preface this by saying that I'm not an SQL wizard by any means. What I want to do is simple as a concept, but has presented me with a small challenge when trying to minimize the amount of database queries I'm performing. Let's say I have a table of departments. Within each department is a list of employees. What is the most efficient way of listing all the departments and which employees are in each department. So for example if I have a department table with: id name 1 sales 2 marketing And a people table with: id department_id name 1 1 Tom 2 1 Bill 3 2 Jessica 4 1 Rachel 5 2 John What is the best way list all departments and all employees for each department like so: Sales Tom Bill Rachel Marketing Jessica John Pretend both tables are actually massive. (I want to avoid getting a list of departments, and then looping through the result and doing an individual query for each department). Think similarly of selecting the statuses/comments in a Facebook-like system, when statuses and comments are stored in separate tables.

    Read the article

  • Can't Use Path in ASP MVC Action

    - by user1477388
    I am trying to use Path() but it has a blue line under it and says, "local variable (path) cannot be referred to until it is declared." How can I use Path()? Imports System.Globalization Imports System.IO Public Class MessageController Inherits System.Web.Mvc.Controller <EmployeeAuthorize()> <HttpPost()> Function SendReply(ByVal id As Integer, ByVal message As String, ByVal files As IEnumerable(Of HttpPostedFileBase)) As JsonResult ' upload files For Each i In files If (i.ContentLength > 0) Then Dim fileName = path.GetFileName(i.FileName) Dim path = path.Combine(Server.MapPath("~/App_Data/uploads"), fileName) i.SaveAs(path) End If Next End Function End Class

    Read the article

  • Java - getClassLoader().getResource() driving me bonkers

    - by Click Upvote
    I have this test app: import java.applet.*; import java.awt.*; import java.net.URL; public class Test extends Applet { public void init() { URL some=Test.class.getClass().getClassLoader().getResource("/assets/pacman.png"); System.out.println(some.toString()); System.out.println(some.getFile()); System.out.println(some.getPath()); } } When I run it from Eclipse, I get the error: java.lang.NullPointerException at Test.init(Test.java:9) at sun.applet.AppletPanel.run(Unknown Source) at java.lang.Thread.run(Unknown Source) Classpath (from .CLASSPATH file) <classpathentry kind="src" path="src"/> In my c:\project\src folder, I have only the Test.java file and the 'assets' directory which contains pacman.png. What am I doing wrong and how to resolve it?

    Read the article

  • Storing millions of URLs in a database for fast pattern matching

    - by Paras Chopra
    I am developing a web analytics kind of system which needs to log referring URL, landing page URL and search keywords for every visitor on the website. What I want to do with this collected data is to allow end-user to query the data such as "Show me all visitors who came from Bing.com searching for phrase that contains 'red shoes'" or "Show me all visitors who landed on URL that contained 'campaign=twitter_ad'", etc. Because this system will be used on many big websites, the amount of data that needs to log will grow really, really fast. So, my question: a) what would be the best strategy for logging so that scaling the system doesn't become a pain; b) how to use that architecture for rapid querying of arbitrary requests? Is there a special method of storing URLs so that querying them gets faster? In addition to MySQL database that I use, I am exploring (and open to) other alternatives better suited for this task.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Problem with autocommit in ANT SQL task

    - by Alex Stamper
    I have an SQL script and want to apply it witn ANT task. This script clears out schema, creates new tables and views. The ANT defined task as follows: <sql driver="com.mysql.jdbc.Driver" url="jdbc:mysql://host:3306/smth" userid="smth" password="smth" expandProperties="false" autocommit="true" src="all.sql" > </sql> When this task launches, it shows in log that tables are cleared and created. But when it tries to create first view, it fails with: Failed to execute: CREATE VIEW component... AS SELECT component_raw.id AS MySQLSyntaxErrorException: Table 'component_raw' doesn't exist I have no idea why it fails here. Running this all.sql from MySQL query browser gives no errors. When I launched ANT with -v option, I didn't see any "COMMIT" messages.. Please, help to resolve the problem.

    Read the article

  • How to find all the file handles by a process programmatically?

    - by kumar
    I have a process "x" which uses "system" C function to start ntpd daemon. I observed that ntpd are passed the open file descriptors of "x". ntpd holds on to the file descriptors even after original file is deleted. for ex: Some log files used by "x" are rotated out after sometime, but "ntpd" has file handle opened for these deleted files. Will it cause any problem? Alternatively I thought of setting "FD_CLOEXEC" flag for all the file descriptors before calling "system" function. But as we are running as an extension library to third process "x"( "x" loads our library based on some condition), there is no easy way to know about all the file descriptors process has opened. One way is to read /proc//fd and set "FD_CLOEXEC" for each file handle and reset it back after "system" function returns. I'm using Linux 2.16. Is there any other easy way to find all the file handlers? Thanks,

    Read the article

  • SQL Server: Check if table exists

    - by Vincent
    I would like this to be the ultimate discussion on how to check if a table exists in SQL Server 2000/2005 using SQL Statement. When you Google for the answer, you get so many different answers. Is there an official/backward & forward compatible way of doing it? Here are two ways to start discussion: IF EXISTS (SELECT 1 FROM INFORMATION_SCHEMA.TABLES WHERE TABLE_TYPE='BASE TABLE' AND TABLE_NAME='mytablename') SELECT 1 AS res ELSE SELECT 0 AS res; IF OBJECT_ID (N'".$table_name."', N'U') IS NOT NULL SELECT 1 AS res ELSE SELECT 0 AS res; MySQL provides a nice SHOW TABLES LIKE '%tablename%'; statement. I am looking for something similar.

    Read the article

  • Problem with running c# application on another PC

    - by draghia-aurelian
    I wrote a Windows Form Application in C# and it works well for my computer. But on another PC, an error occurs when i try to do some stuff. code 1 private void rUNToolStripMenuItem_Click(object sender, EventArgs e) { MessageBox.Show("I'm in rUNToolStripMenuItem_Click!"); ... } code 2 private void dataPositionToolStripMenuItem_Click(object sender, EventArgs e) { MessageBox.Show("I'm in dataPositionToolStripMenuItem_Click!"); ... } Running on my computer: code1: MessageBox appears! code2: MessageBox appears! Running on another computer: code1: MessageBox doesn't appear and the error happens! code2: MessageBox appears! The error is: Method not found: "Void Microsoft.CSharp.RuntimeBinder.CSharpGetMemberBider..ctor(System.String.System.Type, System.Collections.Generic.IEnumerable'1)'. This is the PrintScreen with error: Please help me to solve the problem!

    Read the article

  • NDepend: How to not display 'tier' assemblies in dependency graph?

    - by Edward Buatois
    I was able to do this in an earlier version of nDepend by going to tools-options and setting which assemblies would be part of the analysis (and ignore the rest). The latest version of the trial version of nDepend lets me set it, but it seems to ignore the setting and always analyze all assemblies whether I want it to or not. I tried to delete the "tier" assemblies by moving them over to the "application assemblies" list, but when I delete them out of there, they just get added back to the "tier" list, which I can't ignore. I don't want my dependency graph to contain assemblies like "system," "system.xml," and "system.serialization!" I want only MY assemblies in the dependency graph! Or is that a paid-version feature now? Is there a way to do what I'm talking about?

    Read the article

  • Can computer crashes and reboots mean weak power supply?

    - by TomA
    Recently I replaced the videocard in my PC for a newer, faster one. All games work perfectly but I get random system crashes and reboots. This happens even when the system is almost idle (browsing, playing music). It never happened with the old card. All drivers are up-to-date. Is it possible that the power supply is not powerful enough for the new card?

    Read the article

  • Should I commit or rollback a transaction that creates a temp table, reads, then deletes it?

    - by Triynko
    To select information related to a list of hundreds of IDs... rather than make a huge select statement, I create temp table, insert the ids into it, join it with a table to select the rows matching the IDs, then delete the temp table. So this is essentially a read operation, with no permanent changes made to any persistent database tables. I do this in a transaction, to ensure the temp table is deleted when I'm finished. My question is... what happens when I commit such a transaction vs. let it roll it back? Performance-wise... does the DB engine have to do more work to roll back the transaction vs committing it? Is there even a difference since the only modifications are done to a temp table? Related question here, but doesn't answer my specific case involving temp tables: http://stackoverflow.com/questions/309834/should-i-commit-or-rollback-a-read-transaction

    Read the article

  • PHP & MySQL deleting multiple rows script problem.

    - by oReiLLy
    I'm trying to delete two tables rows from two different tables at once when a user clicks the delete button, but for some reason I cant get the table rows to delete can some one help me figure out what is wrong with my script? Thanks Here is the MySQL tables. CREATE TABLE cases ( id INT UNSIGNED NOT NULL AUTO_INCREMENT, file VARCHAR(255) NOT NULL, case VARCHAR(255) NOT NULL, name VARCHAR(255) NOT NULL, PRIMARY KEY (id) ); CREATE TABLE users_cases ( id INT UNSIGNED NOT NULL AUTO_INCREMENT, cases_id INT UNSIGNED NOT NULL, user_id INT UNSIGNED NOT NULL, PRIMARY KEY (id) ); Here is the PHP & MySQL script. if(isset($_POST['delete_case'])) { $cases_ids = array(); $mysqli = mysqli_connect("localhost", "root", "", "sitename"); $dbc = mysqli_query($mysqli,"SELECT cases.*, users_cases.* FROM cases INNER JOIN users_cases ON users_cases.cases_id = cases.id WHERE users_cases.user_id='$user_id'"); if (!$dbc) { print mysqli_error($mysqli); } else { while($row = mysqli_fetch_array($dbc)){ $cases_ids[] = $row["cases_id"]; } } foreach($_POST['delete_id'] as $di) { if(in_array($di, $cases_ids)) { $mysqli = mysqli_connect("localhost", "root", "", "sitename"); $dbc = mysqli_query($mysqli,"DELETE FROM users_cases WHERE cases_id = '$delete_id'"); $dbc2 = mysqli_query($mysqli,"DELETE FROM cases WHERE id = '$delete_id'"); } } } Here is the XHTML. <li> <input type="text" name="file[]" size="25" /> <input type="text" name="case[]" size="25" /> <input type="text" name="name[]" size="25" /> <input type="hidden" name="delete_id" value="' . $row['cases_id'] . '" /> </li> <li> <input type="text" name="file[]" size="25" /> <input type="text" name="case[]" size="25" /> <input type="text" name="name[]" size="25" /> <input type="hidden" name="delete_id" value="' . $row['cases_id'] . '" /> </li> <li> <input type="text" name="file[]" size="25" /> <input type="text" name="case[]" size="25" /> <input type="text" name="name[]" size="25" /> <input type="hidden" name="delete_id" value="' . $row['cases_id'] . '" /> </li>

    Read the article

  • How to reference a sql server with a slash (\) in its name?

    - by Bill Paetzke
    Givens: One SQL Server is named: DevServerA Another is named: DevServerB\2K5 Problem: From DevServerA, how can I write a query that references DevServerB\2K5? I tried a sample, dummy query (running it from DevServerA): SELECT TOP 1 * FROM DevServerB\2K5.master.sys.tables And I get the error: Msg 102, Level 15, State 1, Line 2 Incorrect syntax near '\.'. However, I know my syntax is almost correct, since the other way around works (running this query from DevServerB\2K5): SELECT TOP 1 * FROM DevServerA.master.sys.tables Please help me figure out how to reference DevServerB\2K5 from DevServerA. Thanks.

    Read the article

  • C# Winform : Deployment Problem after using DataRepeater of MS Visual Basics power pack

    - by Mohsan
    hi. Microsoft Visual Studio 2008 Service pack 1 comes with Visual Basic Powerpacks which has the DataRepeater control. I used this control in my c# winform application. in my system everything is running fine. now i copied the debug folder to other system which has only .Net Framework 3.5 SP1 installed. in this system is giving me error cannot load dependency Microsoft.VisualBasic.PowerPacks.dll even i set the Copy Local to "true" for "Microsoft.VisualBasic.dll" and "Microsoft.VisualBasic.PowerPacks.Vs.dll" please tell me how to solve this problem

    Read the article

  • Android and SQLite using the SQLiteOpenHelper

    - by tunneling
    I have a SQLite database, and several tables within that database. I am developing a DBAdapter for each table within the database. (reference Reto Meier's Professional Android 2 Application Development, Listing 7.1). I am using the adb shell to interface with the database from the command line and see that the database is being populated as I expect. Occasionally, I want to drop a table so that I can ensure it's being built properly, from scratch. The problem is that SQLiteOpenHelper only checks to see if the database exists. Is there a typical solution to writing a helper to also see that the table(s) exists? Basically once I drop a table, the helper checks to see that the database exists and assumes all is well. Also, the CREATE_DATABASE string used in the reference above only creates the one table. Should I consider using the DBAdapter for an adapter to ALL of my tables? That doesn't seem as clean to me. Reference Material

    Read the article

  • Can I use JPA/EJB3 on a table that was created at runtime?

    - by tieTYT
    This is weird and probably not possible but I'll ask anyway. I'm making this app that reads in a meta file and creates some tables then populates them with data. I was wondering if I could somehow use JPA to populate those tables. Obviously, there's no way I could have an entity with annotations on it since the table didn't exist at compile time. But perhaps JPA or the entity manager has a way to load data into a nameless table? If possible, I'd expect a method like entityManager.update("myTableName", hashMapOfColumnNamesAndColumnDataValues);

    Read the article

  • Generate SQL Server Express database from Entity Framework 4 model

    - by Cranialsurge
    I am able to auto-generate a SQL Server CE 4.0 *.sdf file using code-first generation as explained by Scott Guthrie here. The connection string for the same is as follows: <add name="NerdDinners" providerName="System.Data.SqlServerCe.4.0" connectionString="data source=|DataDirectory|NerdDinner.sdf"/> However if I try to generate an mdf instead using the following connection string, it fails to do so with the following error - "The provider did not return a ProviderManifestToken string.". <add name="NerdDinners" providerName="System.Data.SqlClient" connectionString="data source=|DataDirectory|NerdDinner.mdf"/> Even directly hooking into a SQLEXPRESS instance using the following connection string fails <add name="NerdDinners" providerName="System.Data.SqlClient" connectionString="Data Source=.\SQLEXPRESS;Initial Catalog=NerdDinner;Integrated Security=True"/> Does EF 4 only support SQL CE 4.0 for database creation from a model for now or am I doing something wrong here?

    Read the article

  • PostgreSQL - disabling constraints

    - by azp74
    I have a table with approx 5 million rows which has a fk constraint referencing the primary key of another table (also approx 5 million rows). I need to delete about 75000 rows from both tables. I know that if I try doing this with the fk constraint enabled it's going to take an unacceptable amount of time. Coming from an Oracle background my first thought was to disable the constraint, do the delete & then reenable the constraint. PostGres appears to let me disable constraint triggers if I am a super user (I'm not, but I am logging in as the user that owns/created the objects) but that doesn't seem to be quite what I want. The other option is to drop the constraint and then reinstate it. I'm worried that rebuilding the constraint is going to take ages given the size of my tables. Any thoughts?

    Read the article

  • Should I worry about the integrity of my linux software RAID5 after a crash or kernel panic?

    - by Josh
    I have a dual core Intel i5 Ubuntu Server 10.04 LTS system running kernel 2.6.32-22-server #33-Ubuntu SMP with three 1TB SATA hard drives set up in a RAID5 array using linux md devices. I have read about the RAID5 write hole and am concerned: if my linux system locks up or kernel panics, should I be assume that the integrety of my data has been compromised and restore from backup? How can I know if the data on the RAID5 array is "safe"?

    Read the article

  • Assigning the Tag Property of a Control in WPF

    - by jmayor
    If I have 7 checkBoxes, one for each day of the week, Can I assing in XAML the Tag property to each one of the the System.DayOfWeek enumeration value? <StackPanel > <StackPanel.Resources> <system:DayOfWeek x:Key="Monday" >Monday</system:DayOfWeek> </StackPanel.Resources> <CheckBox Name="chkMo" Tag="{StaticResource Monday}">Mo</CheckBox> ... </StackPanel> Is there a way to assign directly the enum value to the tag without using resources?

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 520 521 522 523 524 525 526 527 528 529 530 531  | Next Page >