Search Results

Search found 28643 results on 1146 pages for 'go'.

Page 545/1146 | < Previous Page | 541 542 543 544 545 546 547 548 549 550 551 552  | Next Page >

  • Vhost in Apache only working locally?

    - by Gasman
    Ok, I have added lines like: 127.0.0.1 somedomain.com Or some other domain that points to my routers IP, and is forwarded, but I get to the main site, but I want it to go to the subfolder I defined in my httpd-vhosts.conf: NameVirtualHost somedomain.com:80 <VirtualHost somedomain.com:80> DocumentRoot "D:/Apps/xampp/htdocs/somedomain" ServerName somedomain.com ServerAlias somedomain.com </VirtualHost> So, locally somedomain.com works, just remotely it goes to the root htdocs. So If I use a *:80 wildcard I works, but then everything points to the subfolder and all the other vhosts seem to get ignored. Any Idea why this is?

    Read the article

  • Why would Linux VM in vSphere ESXi 5.5 show dramatically increased disk i/o latency?

    - by mhucka
    I'm stumped and I hope someone else will recognize the symptoms of this problem. Hardware: new Dell T110 II, dual-core Pentium G860 2.9 GHz, onboard SATA controller, one new 500 GB 7200 RPM cabled hard drive inside the box, other drives inside but not mounted yet. No RAID. Software: fresh CentOS 6.5 virtual machine under VMware ESXi 5.5.0 (build 174 + vSphere Client). 2.5 GB RAM allocated. The disk is how CentOS offered to set it up, namely as a volume inside an LVM Volume Group, except that I skipped having a separate /home and simply have / and /boot. CentOS is patched up, ESXi patched up, latest VMware tools installed in the VM. No users on the system, no services running, no files on the disk but the OS installation. I'm interacting with the VM via the VM virtual console in vSphere Client. Before going further, I wanted to check that I configured things more or less reasonably. I ran the following command as root in a shell on the VM: for i in 1 2 3 4 5 6 7 8 9 10; do dd if=/dev/zero of=/test.img bs=8k count=256k conv=fdatasync done I.e., just repeat the dd command 10 times, which results in printing the transfer rate each time. The results are disturbing. It starts off well: 262144+0 records in 262144+0 records out 2147483648 bytes (2.1 GB) copied, 20.451 s, 105 MB/s 262144+0 records in 262144+0 records out 2147483648 bytes (2.1 GB) copied, 20.4202 s, 105 MB/s ... but after 7-8 of these, it then prints 262144+0 records in 262144+0 records out 2147483648 bytes (2.1 GG) copied, 82.9779 s, 25.9 MB/s 262144+0 records in 262144+0 records out 2147483648 bytes (2.1 GB) copied, 84.0396 s, 25.6 MB/s 262144+0 records in 262144+0 records out 2147483648 bytes (2.1 GB) copied, 103.42 s, 20.8 MB/s If I wait a significant amount of time, say 30-45 minutes, and run it again, it again goes back to 105 MB/s, and after several rounds (sometimes a few, sometimes 10+), it drops to ~20-25 MB/s again. Plotting the disk latency in vSphere's interface, it shows periods of high disk latency hitting 1.2-1.5 seconds during the times that dd reports the low throughput. (And yes, things get pretty unresponsive while that's happening.) What could be causing this? I'm comfortable that it is not due to the disk failing, because I also had configured two other disks as an additional volume in the same system. At first I thought I did something wrong with that volume, but after commenting the volume out from /etc/fstab and rebooting, and trying the tests on / as shown above, it became clear that the problem is elsewhere. It is probably an ESXi configuration problem, but I'm not very experienced with ESXi. It's probably something stupid, but after trying to figure this out for many hours over multiple days, I can't find the problem, so I hope someone can point me in the right direction. (P.S.: yes, I know this hardware combo won't win any speed awards as a server, and I have reasons for using this low-end hardware and running a single VM, but I think that's besides the point for this question [unless it's actually a hardware problem].) ADDENDUM #1: Reading other answers such as this one made me try adding oflag=direct to dd. However, it makes no difference in the pattern of results: initially the numbers are higher for many rounds, then they drop to 20-25 MB/s. (The initial absolute numbers are in the 50 MB/s range.) ADDENDUM #2: Adding sync ; echo 3 > /proc/sys/vm/drop_caches into the loop does not make a difference at all. ADDENDUM #3: To take out further variables, I now run dd such that the file it creates is larger than the amount of RAM on the system. The new command is dd if=/dev/zero of=/test.img bs=16k count=256k conv=fdatasync oflag=direct. Initial throughput numbers with this version of the command are ~50 MB/s. They drop to 20-25 MB/s when things go south. ADDENDUM #4: Here is the output of iostat -d -m -x 1 running in another terminal window while performance is "good" and then again when it's "bad". (While this is going on, I'm running dd if=/dev/zero of=/test.img bs=16k count=256k conv=fdatasync oflag=direct.) First, when things are "good", it shows this: When things go "bad", iostat -d -m -x 1 shows this:

    Read the article

  • How to recover the data from the crashed (external) hard disk drive (NTFS)?

    - by shveerab
    The 300 GB harddisk has 2 partitions,90 GB and 200 GB! I can see the drives in windows(XP) but unable to access them, the file system is shown as RAW, 0 used space and 0 free space!..chkdsk returns the error "unable to determine volume version and date. chkddsk aborted." Is the MBR corrupt? How do I restore it? TestDisk tool isn't recognizing the partitions and says invalid entry for heads/cylinder, 15 and should be 255 and suggests to change it..Should I go ahead and change it? Please advise!

    Read the article

  • Backup folder on sometimes attached external usb harddrive

    - by ctrler
    My girlfriend no longer has space her laptops drive to store her photos. The drive she has now is 750GB, so to go to a bigger drive would be expensive, as there isn't many 1.5tb 2.5 inch 9.5mm hdd on the market (as of now, there is only one). Because of that, I am thinking of moving her pictures to a cheap external usb hdd. As of now, I'm automatically backing up her important folders (My Documents, Pictures, etc.) using Windows 7 default backup software to a network drive. My problem is that I don't know of a good solution to automatically backup a folder residing on an usb disk. The usb disk won't be attached to the computer all the time, so I can't just treat it as a normal backup folder. Sometimes the backup would run and the folder would not be there! Anyone knows any software or methodology to backup folders on external usb hard drives that are not always present? Thanks

    Read the article

  • Create my own custom ellipsis bullet point

    - by Airn5475
    I regularly use an ellipsis as a bullet point in a list of items in Word/Outlook 2010. Example: I like summer because... ... it's warm out. ... we go on vacation. ... my birthday is in July. Currently in Word/Outlook if you type certain characters like a hyphen and hit space, it will automatically start a bulleted list using the hyphen. I would really like the same functionality with the ellipsis. When I type the third period and hit space, start a bulleted list. Does anyone know of a way to do this? Registry hack? Hidden Word Setting?

    Read the article

  • I have a 21TB array but only 16TB is visible from Windows

    - by Relentim
    CONTROLLER Raid Controller: 3Ware 9650SE-24M8 Disks: 21 x 1TB RAID5 Stripe 64KB WINDOWS OS: Windows Server 2003 SP2 32x Disk: Dynamic 19557.44GB Volume: Capacity 15832.19GB I guess my array must have a 4KB block size which is limiting it to 16TB. I think I would have to switch to a 64KB block size to be able to see a maximum of 256TB. Or create another unit on my controller to go above 16TB of storage. Unfortunately I have already added over 16TB, ideally I would like to shrink the array and reclaim the 5 disks that aren't doing anything. I don't think this is possible. More likely, can I change the block size so 20TB becomes visible in windows?

    Read the article

  • Access a samba mount from an ssh connection

    - by Android
    I have Ubuntu 9.10 on my computer. I have made a samba mount to a windows computer. This works fine when I am on the Ubuntu computer directly. When I go to another computer and connect to Ubuntu with SSH. I can connect fine and everything works but the folder my mount is in appears empty. I have only 1 account and it has permissions on the file etc. When on the computer directly it all works perfectly, it is only when connecting with SSH that isn't visible. What am I doing wrong here? I made the mount with smbmount //computer/folder mount -o username=username,password=password Even if I run this command on the SSH connection then it is the same, visible on the computer directly but not on SSH.

    Read the article

  • Unidentified Window OnStartup

    - by CMP
    Every time I start up windows vista lately, I see a random floating window. It is a tiny little window with no title, and only the resize, maximize and restore buttons. I'd post an image, but I don't have reputation here yet. I can close it, and it does indeed go away, but I would love to figure out what it is and stop it from popping up at all. I used Autohotkey's window spy on it and all I learned is that it is a swing window, which doesn't help me out a whole lot. Is there a good way to identify which process it belongs to and figure out how to kill it?

    Read the article

  • Would a switch be covered by a router's firewall

    - by Uh-yeah...
    So... Hopefully; this is the right place for this question. I need more Ethernet ports on my home network. Sadly, we already have an old router connected to the main router and we still need more ports. I feel dumb for asking; but, I just would like to double check. Would the devices connected to the switch be "protected" by the Main router's firewall? ? Up to this point I have assumed that was the case; but, a co-worker is convinced that is not the case [ I believe he is thinking of a situation in which the switch (un-managed) is before an access point]. [It would go modem to main router; main router then has the switch and old router connected to it.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Windows 7 formatting HD

    - by Rick
    I have an Acer Aspire 5610 that I am trying to put an Operating System back on. I am trying to install windows 7 32-bit and it will not go through the install. Not sure why. I am now trying to reformat the hard drive and start with a fresh formatted HD. No other partitions. The problem is that the install disk is not doing the format it is giving me an error. The error is 0x8007045d. I am at a loss. This is the first time running into this issue. Please Help.

    Read the article

  • (Windows 7) Dial Up Connection Locks up the Networking Service

    - by Nick
    I connect to the internet by using my cell phone as a dial up modem. (shh, don't tell my service provider) The connection is usually seamless and the speed is good (150kbps) but occasionally, the connection will get terminated by either the phone or the network, I'm not sure which and then Windows7 stubbornly doesn't acknowledge that the connection is dead so I can re-dial. I have tried to manually kill the connection, but then anything related to the network service refuses to open and the connection is still there. No "Network and Sharing Center", "Network Devices" and often the tray menu will refuse to pop open. The only way I have found to clear the problem is a full restart which. Logging off doesn't work and I haven't been able to find the service that is frozen. If anyone knows how to fix this or prevent this from happening or even how to go about troubleshooting I would be very grateful. ps. This problem is non-existant when tethering in linux on the same machine. (Ubunutu 9 and JoliOS)

    Read the article

  • Is 50% download speed on a wireless G network normal?

    - by Bartlomiej Skwira
    I have a wired connection of about 36Mb/s, but my wireless speed is max at about 18-19Mb/s. I have a WRT54G-TM (T-Mobile, 802.11G) router with DD-WRT firmware - I've upgraded it to latest build. Done some settings changes: changed channel - 13 wireless network mode - G-only ACK Timing - 0 Fragmentation Threshold and RTS Threshold - 2304 Basic Rate - All Signal/Noise ratio: -46/-94, signal quality ~50-60%. Is this normal with G networks? Edit: The AP is located about 2 meters from laptop, no walls or metal objects, but its next to a TV. I've done a channel scan (had problems locating it, go to "Status - Wireless - Site survey" - lame naming) and everybody else is on channels 1 and 6. Switched to channel 11 but it didn't help. As for trasmit power I got best results with default 71mw. The antenna might be a factor, I'm using the default 2 antennas.

    Read the article

  • Windows 7 stopped booting

    - by jstawski
    I have a laptop which after shutdown it stopped booting. I tried repair, safe mode, and even start with Windows 7 Installation. The screen just goes blank with a mouse pointer that I can move around. I removed the harddrive from the laptop and connected it to my desktop using an External HD casing. The computer recognizes the disk, but it seems like it can't read it. If I go to My Computer it shows up, but it doesn't display usage information. When I double click on the drive it sits there as if it was loading something and eventually shows "G:\ is not accessible. The parameter is incorrect." Disk Management and Diskpart also take forever to load and when it does it shows the drive. My question, do you think this is a hardware problem or some corrupted sector? How can I try to fix the drive without formatting it? Thanks...

    Read the article

  • Kernel Compiling from Vanilla to several machines

    - by Linux Pwns Mac
    When compiling kernels for machines is there a safe or correct way to create a template for say servers? I work with a lot of RHEL servers and want to compile them with GRSEC. However, I do not wish to always rebuild off of the .config for each machine and go in and remove a bunch of unrelated modules like wireless, bluetooth, ect... which you typically do not need in servers. I want to create a template .config that can be used on any machine, but is there a safe way to do that when hardware changes? I know with Linux, at least from my experience, you can cross jump hardware way easier then Windows/OSX. I assume that as long as I leave MOST of all the main hardware modules/CPU in that this could create a .config that would work for all or just about any machine?

    Read the article

  • Hardware specs for web cache

    - by Raj
    I am looking for recommendations for hardware specs for a server that needs to be a web cache for a user population of about 2,000 concurrent connections. The clients are viewing segmented HTTP video in bitrates ranging from 150kbps to 2mbps. Most video is "live" meaning segments of 2-10 secs each, of which 100 or so are maintained at a time. There are also some pre-recorded fixed length videos. How would I go about doing the provisioning calculation for such a server: What kind of HDD (SSD?), how many NICs how much RAM etc? I am thinking of using Varnish on Linux, all the RAM I can get my hands on, 2 CPUs with 6-8 cores each.

    Read the article

  • I need a wirless interenet card thingy for my stationary computer

    - by user60859
    Going to move my stationary computer and hook it up to the TV. Which is far away from the wireless router. So i'm going to need a way to go on the Internet wirelessly from my stationary computer. I was looking at some of those.. wireless pci adapter things. But i have no idea which one would be compatible with my computer. How can i tell? oh i have a pentium 4, Windows XP like 600 megs of ram in case any of that matters.

    Read the article

  • Default Program With Multiple Versions Installed

    - by Optimal Solutions
    I have multiple versions of Excel installed. Excel 2010, 2007 and 2003. I have them installed on one hard drive with Windows 7 Ultimate as the OS. When I double-click on an XLS file, Excel 2007 opens. I would like Excel 2010 to open. I read and followed the instructions to go to the Control Panel at "Control Panel\All Control Panel Items\Default Programs" and set the default programs. I changed the default to the physical EXE for Excel 2010 at the proper folder that it is installed. When I double-click on the XLS files, Excel 2007 still opens. So I tried to change it to Excel 2003 just to see if it changed to that and it still opens Excel 2007. What am I missing? I would really like the file extension to open Excel 2010, but can not seem to do that.

    Read the article

  • How much data does windows write on boot

    - by soandos
    This question was inspired by Bob's comment to my answer here. On boot, windows writes files to the hard drive (I imagine this to be the case, as it has a way of detecting if the boot was previously interrupted by a hard power-off, and I am sure many other things). But assuming that there is a "smooth" boot, where there are no error, etc, and no logon scripts that run, and things like that, about how much (a few KB, a few MB, a few GB) data gets written to the drive? For simplicity's sake, assume that: hibernation is turned off windows 7 pagefile is turned off (does this matter right at boot, or only later?) How could one go about measuring this? Are there resources that have this information?

    Read the article

  • Selectively routing traffic via ethernet or wifi, with proper DNS (Mac OS X 10.6)

    - by Dan
    When I'm at work, I access various intranet pages as well as the wider Internet through ethernet. However, the company LAN blocks some ports (e.g. Google Calendar). I can get to those through WiFi. So, I gave the Airport priority, and then using route add, I set up selective routing: all intranet traffic goes through the ethernet and everything else via WiFi: sudo route add 10.0.0.0/8 <intranet gateway>. However, there are a number of intranet sites that have their own DNS; i.e., hr.company.com only resolves on the intranet. The only way that I can get the DNS to work properly is to add the internal DNS server to the Airport DNS listing, however I fear that when I go elsewhere and forget, this will break things. What's the right way to get the DNS to resolve using this setup?

    Read the article

  • Is there a good, free way to fix broken/corrupt .wmv files?

    - by chbtn
    I've recovered some files from an hdd that weren't supposed to be deleted in the first place, but they have seeking problems/crash the players. Since they have the right size, I'm thinking it might be a problem of corrupt index/header, so I'm trying to find a way to fix them. It's easy to find examples on how to fix corrupt .avi files with mencoder, but .wmv seems trickier. Also, I realize there might not be a way to fix these files, but I figure I might as well as try. As far as players go, I've tried opening it with vlc/mplayer/windows media player. I can use anything on Windows XP/7 and Ubuntu, as long as it's free. Since the files are 200mb+ and there are quite a few, I don't think trial software would work.

    Read the article

  • Emacs org-mode: how to avoid duplicate lines in agenda, when items is scheduled AND has deadline

    - by Martin
    Many of my TODO items in Emacs org-mode have a DEADLINE defined in the future (e. g. Friday) and are at the same time SCHEDULED today so that I already know I have to start working on this task. Then, this task will appear twice in my agenda. That's not nice but not necessarily a problem yet, but if then the task has assigned a time estimate for its duration and I go to column view with C-C C-X C-C to see how much time my tasks today will need, the time estimate for this task is counted twice, so e. g. if the time effort estimate is 2 hours, I'll have 4 hours in my daily agenda, as the item appears as well as scheduled today (or in the past) as also with its deadline in 3 days. How can I avoid counting an item twice?

    Read the article

  • Setting up VMWare ESXi 5 with a single physical NIC

    - by deed02392
    I have a cheap but powerful dedicated server I am leasing with OVH, because they were recently having a promotion. I would like to try and manage all this power by playing with VMs using ESXi. However I am only provided with a single NIC. I had thought this would be easy to get around since, at home I have a single NIC which is my broadband modem, and yet a simple NAT gateway device happily provides internet access to all my devices. I am struggling to implement this on ESXi, though. Can anyone advise on how I could go about having ESXi and multiple VMs working with just one NIC? Here's my current setup: I believe all I need is to be able to configure NAT from the NIC to all the VMs etc.. How would I set up and administer this kind of infrastructure?

    Read the article

  • Delete Google Chrome's tab history

    - by wizlog
    After browsing the web for a while, I want to delete my history. So I press CTRL and H keys, and click the Edit items on the blue bar at the top of the page. Then I select the checkboxes for the items I want to remove. Then I click remove selected items. When I go into any of my open tabs, their history isn't deleted. Without restarting the tab or the browser, is there any way to clear the history within a tab? I also want to know how to clear just one tab's history, without needing to know all the pages that the tab had visited, then going to the history page...

    Read the article

  • Is there a way to watch EyeTV in alarm-clock style "sleep" mode on your iMac?

    - by Mark S.
    My wife likes to watch TV to go to sleep, the only trouble is that the only TV we have in our house is the iMac with the EyeTV Hybrid. I'd like to have the TV turn off after 1.5 hours of watching without changing the channels/volume--sortof like an alarm clock 'sleep' function. Do you know of a way to do this either with an EyeTV plugin or an App that might be able to try to detect such conditions and shut down the display? Right now EyeTV overrides the screensaver. The Power saver functions don't really work because she doesn't start watching at the same time every night and periodically she will want to record a 2 or 3 AM show. All I want to do is "close" (but not quit) EyeTV and shut off the display.

    Read the article

< Previous Page | 541 542 543 544 545 546 547 548 549 550 551 552  | Next Page >