Search Results

Search found 119079 results on 4764 pages for 'code first migrations'.

Page 557/4764 | < Previous Page | 553 554 555 556 557 558 559 560 561 562 563 564  | Next Page >

• Error loading operating system WinXP Pro

  - by Jakesan

  So im getting the error "Error loading operating system" when the computer tries to boot to a fresh install of WinXP Pro. To get to this point, I: Shrunk the only partition with Gparted to 33GB Copied the partition to the end of the 200GB drive Enlarged the first one to fill the space Formatted the first partition to NTFS Set the first partition to boot, tagged the latter to hidden, removed boot flag This was done all under Hiren's BootCD. Now this is where it goes down the drain. I installed XP Pro SP1a from its CD, and chose to quick format the partition. Now after the OS was installed, I can't start XP without using the default menu action from Hiren's BootCD. All I am greeted with is the "error loading operating system" message. I tried to use the XP recovery to fixboot, fixmbr and bootcfg /rebuild (dont remember if the command was like this, anyway the 3 suggested commands). This did nothing. What am I missing here?

  Read the article

• LaTex, Problem with Beamer and Listings

  - by Valdor65

  Hi, I'm trying to add some code in a presentation made with LaTex. I used beamer, added some frames without problems but once I add the listing, I can't compile the presentation anymore. \begin{frame}{Code} \begin{lstlisting} Sample Code \end{lstlisting} \end{frame} The error I pdflatex gave me is: Package Listings Warning: Text dropped after begin of listing on input line 80. Is there anything special to add to make it work ? Thanks

  Read the article

• Labels mail merge repeats on subsequent pages?

  - by leeand00

  I'm trying to do a mail merge to print to labels. The first field in the document does not contain a { NEXT } field code, and because of this the records repeat between label pages for example: Notice how the records shift to the left as the next page is displayed? But how they start over again in an off by one manner? Now I've tried to fix this by using the first record displayed on a page to see if the page number is 1. If it not on page 1 of the mail merge then it should just move to the next record; otherwise it should just display the first record: This doesn't work however, because when I do the preview and display the {page} field code, it reports that I am always on page 1 and thus the same behavior continues instead of just moving to the next record on the next page.

  Read the article

• SMTP Server Issue in intersystem cache

  - by nayanak

  I am facing an issue when I am sending Email from intersystems cache. I am able to send the mail, with out any problem the first time. But the second time when I am trying to send the smtp server is not responding properly. The first Helo command is sent. I recieve the confirmation 220 from the server. But I do not recieve the Message 250. So the next command is giving me the error 503, 5.5.2 "Send helo first" message. I am unable to find out why the server is not responding the second time.

  Read the article

• sed comand - remove virus from wordpress [duplicate]

  - by EliaszKubala

  This question already has an answer here: How do I deal with a compromised server? 12 answers I have malicious code in every php file. This malicius code is auto paste at the beginning of file. I want to remove this with UNIX command from console. This is malicious code: <?php $guobywgpku = '..... u=$bhpegpvvmc-1; ?> I write this RegExp, "/<\?php \$guobywgpku.*\?>/m" and this RegExp work. I tested it here. The problem is, write command which remove this malicious code from every php file on the sever. Please Help me. Now i have something like this. sed "/<\?php \$guobywgpku.*\?>/m" index.php

  Read the article

• Encrypt shared files on AD Domain.

  - by Walter

  Can I encrypt shared files on windows server and allow only authenticated domain users have access to these files? The scenario as follows: I have a software development company, and I would like to protect my source code from being copied by my programmers. One problem is that some programmers use their own laptops to developing the company's software. In this scenario it's impossible to prevent developers from copying the source code for their laptops. In this case I thought about the following solution, but i don't know if it's possible to implement. The idea is to encrypt the source code and they are accessible (decrypted) only when developers are logged into the AD domain, ie if they are not logged into the AD domain, the source code would be encrypted be useless. Can be implemented this ? What technology should be used?

  Read the article

• Multi-Document TOC showing in wrong order

  - by Jeremy DeStefano

  I had a large document that was having formatting issues, so I split it into 2 files. Chapters 1-7 are in the main doc with the TOC and a second doc has chapters 8-12. I have the following: {TOC \O "1-3" \H \Z \U} {RD \f "MCDPS Training Manual Part2.docx"} The TOC is created and has entries from both documents, however its showing the entries from Chapter 8-11 first and then Chapter 1-7. I've read that it should list them based on page numbers, but its not. Chapter 8 starts at page 121, yet its listing it first. How can I get it to show the TOC from the main doc first and then the RD?

  Read the article

• Laptop power supplies, does current matter?

  - by CodeSlave

  I have two laptops (same manufacture), with the same type of power connector. However, the power supplies/transformers are slightly different. The output on the first laptop's power supply is 15.6 V at 8.0 A. The output on the second laptop's power supply is 15.6 V at 5A. Clearly the voltages are the same, but the currents are different. I assume the second laptop's power supply can not be used on the first, because it can't supply enough power to the laptop. However, can the first laptop's power supply be safely used on the second laptop?

  Read the article

• Is there a reason the partition tool GParted doesn't show a percentage finish number initially?

  - by Jian Lin

  I am using GParted more, and it seems to do a reliable work. I just wonder why if the tasks is to resize a 250GB partition to 190GB, and then create a new partition, the first 10, 15 minutes, there is only a blue bar moving left and right, but there won't be an indicator showing how many percent is done. Then after that 10 to 15 minutes, it does show 1:05:00 left to finish the job. Update: at first I thought there is no percentage or time remaining at all... but after waiting for 10, 15 mintues, it does show. I just wonder why it didn't show at first.

  Read the article

• Win Server 2008: Task Scheduler runs programs twice or late

  - by SomeName

  Hi, I need to restart a service every day. I have logon hours restricted at 3:00 am, and the server will logout existing TS connections. I have two tasks scheduled: "Daily At 3:20 am every day" "start a program" "c:\windows\system32\sc.exe stop myservice" "Daily At 3:22 am every day" "start a program" "c:\windows\system32\sc.exe start myservice" I came in today to notice that the service wasn't running. I've been digging in logs, and found these entries: For stop task, history: a) 3:29:35 am: Action Completed (sc result code 0) b) 3:20:00 am: Action Completed (sc result code 0) For start task, history: a) 3:29:35 am: Action Completed (sc result code ERROR_SERVICE_ALREADY_RUNNING 1056 (0x420)) b) 3:22:01 am: Action Completed (sc result code 0) Checking event logs shows me: a) 3:29:35 am, Application log, Source myservice, "The service was stopped" b) 3:29:25 am, System log, Source Service Control Manager, "The myservice service entered the stopped state" So, What would have caused both tasks to run at 3:29 am? Why don't I see a message from the SCM saying that the service entered the running state? Is this the preferred way to do this? Thanks!

  Read the article

• Flow of packets in network

  - by user58859

  I can't visualize in my mind the network traffic flow. eg. If there are 15 pc's in a LAN When packet goes from router to local LAN, do it passes all the computers? Does it go to the ethernet card of every computer and those computers accept the packet based on their physical address? To which pc the packet will go first? To the nearest to the router? What happens if that first pc captures that packet(though it is not for it)? What happens when a pc broadcast a message? Do it have to generate 14 packets for all the pc's or only one packet reach to all pc's? If it is one packet and captured by first pc, how other pc's can get that? I can't imagine how this traffic is exactly flows? May be my analogy is completely wrong. Can anybody explain me this?

  Read the article

• Word: MAC 2011, TOC on too many pages

  - by Mark

  I have a Word: MAC 2011 document where the bottom of the first 40 pages or so say "TOC: Page x". This notation appears to be in the Footer, as it is gray until I click on it (then the rest of the text goes gray instead). There is no TOC that I can see in the document, so I'm presuming someone tried to create one and messed things up. After the first 40 pages or so, all the other bottom of the page notations appear to be correct. (i.e. Chapter One, Chapter Two, etc.) How can I get those first 40 pages to be part of Chapter One rather than TOC?

  Read the article

• Why does Windows Explorer highlight only second entry?

  - by normanius

  Why does Windows Explorer highlight the second but never the first entry if I use the keyboard for navigation? Example: let's look at a folder that contains the following entries a1 a2 a3 b1 b2 If I hit 'a' on the keyboard, the explorer highlights entry 'a2' instead of 'a1'. It works fine for 'b' with 'b1' (because it's not the first entry). Similarly, if I open a folder and use the arrow-down key to navigate then the first entry is skipped again. Why?! It's probable that I'm too stupid for this but this "feature" really annoys me!

  Read the article

• PHP + IIS7 + X64 OS (Windows 7 or Server 2008)

  - by Eric

  I'm going to answer my own question here, but I thought this might be important enough to post so that it would be indexed for the next person who runs into my situation. Problem: I can not seem to get PHP code to execute on a x64 bit version ofIIS7, whether it be in my desktop, Windows 7, or the application's final destination on Windows Server 2008. Every time I try and look at a test php document to confirm installation, I only see the source code. I've followed the documentation from PHP, from iis.net, blogs, howtos, just about anywhere I can find that Google would send me. I tried the web installer, tried manual installations instead of the MSI, tried version 5.3.5, tried version 5.2.17, but no matter what, the code would never execute. I even tried registering .eric files with PHP FastCGI Module, but same result, php source code only.

  Read the article

• Boot from Second SATA Drive

  - by Chris

  I have a Dell Precision 490 Workstation, and I just had my other question answered, Install Ubuntu to drive B without impacting drive A, and now I'm having a boot sequence issue. The external drive is great, boots up fine on my laptop, but how do I tell my desktop to boot from my second SATA drive and not the first SATAdrive. My drive configuration as follows SATA-0: Windows SATA-1: DVDR SATA-2: Ubuntu When I choose the boot menu, the option I have is "Internal Hard Drive". I assume it searches all drives, and loads the first bootable one it finds (which happens to be Windows), but I'd like to be able to select the drive from a list. Has anyone experienced this? Is possible without disabling the first hard drive in the BIOS?

  Read the article

• Pre-load MS Windows right-click menus and Start menu at startup

  - by Steve

  Hello brainy people. On my WinXP SP3 laptop (1.4Ghz 1.2GB ram), after I first log in, when I right-click in Windows Explorer and choose New, the submenu can take up to 15 seconds to load, which is a pain in the ass when you want to do a quick easy operation. After the submenu has loaded the first time, subsequent loads perform instantly, obviously as the menu has been cached. My question is: can these right-click menus (and the Start menu, which also takes some time to load the first time) be pre-loaded at Windows startup? Thanks.

  Read the article

• PHP application failed to connect after a network plugged back in

  - by tntu

  My data-center appears to have had some issues with their network and thus my server has suffered from on an off network connectivity for about an hour. After the connection has been completely re-established my code still kept reporting the same issue over and over until I have restarted the service. The code is a simple PHP code that loops forever checking the Apple feed-back server and then sleeps for a few minutes and then it begins all over again. Now I understand the error being generated if the network is down but once it got back up why did it continue until I have restarted the code? Does PHP have something that needs to be re-initialized or something?? Messges log: Dec 20 08:57:22 server kernel: r8169: eth0: link down Dec 20 08:57:28 server kernel: r8169 0000:06:00.0: eth0: link up Dec 20 08:57:29 server kernel: r8169: eth0: link down Dec 20 08:57:33 server kernel: r8169 0000:06:00.0: eth0: link up Dec 20 08:57:33 server kernel: r8169: eth0: link down Dec 20 08:57:37 server kernel: r8169 0000:06:00.0: eth0: link up Dec 20 08:57:38 server kernel: r8169: eth0: link down Dec 20 08:57:44 server kernel: r8169 0000:06:00.0: eth0: link up Dec 20 08:57:44 server kernel: r8169: eth0: link down Dec 20 08:57:52 server kernel: r8169 0000:06:00.0: eth0: link up Dec 20 08:57:52 server kernel: r8169: eth0: link down Dec 20 09:10:58 server kernel: r8169 0000:06:00.0: eth0: link up PHP Error: PHP Warning: stream_socket_client(): php_network_getaddresses: getaddrinfo failed: Name or service not known in /home/push/feedback.php on line 36 Code Line 36: $apns = stream_socket_client('ssl://feedback.sandbox.push.apple.com:2196', $errcode, $errstr, 60, STREAM_CLIENT_CONNECT, $stream_context);

  Read the article

• Justification of Amazon EC2 Performance

  - by Adroidist

  I have a .jar file that represents a server which receives over TCP an image in bytes (of size at most 500 kb) and writes it file. It then sobels this image and sends it over TCP socket to the client side. I ran it on my laptop and it was very fast. But when I put it on Amazon EC2 server m1.large instance, i found out it is very slow - around 10 times slower. It might be the inefficiency in the code algorithm but in fact my code is nothing but receive image (like any byte file) run the sobel algorithm and send. I have the following questions: 1- Is it normal performance of Amazon EC2 server- I have read the following links link1 and link2 2- Even if the code is not that efficient, the server is finally handling a very low load (just one client), does the "inefficient" code justify such performance? 3- My laptop is dual core only...Why would the amazon ec2 server have worse performance that my laptop? How is this explained? Excuse me for my ignorance.

  Read the article

• How Do I Enable CUPS Browsing Across A Network?

  - by David Mackintosh

  I have a CUPS server with two print queues defined. Once this was defined, all the CUPS clients on the same subnet could see the two print queues automatically, no problem. Now I have a collection of machines on a separate subnet, reachable from the first subnet by a router. How do I enable CUPS browsing on the second set of machines so that they can see the print queues defined on the first machine? Let's call the server A.B.C.7. The first subnet is A.B.C.0/24. The second subnet is A.B.D.0/24, and there is a router with arms on both networks.

  Read the article

• Can you install the Unicenter Event Agent on a Windows 2008 server?

  - by hsatterwhite

  I'm trying to install just the Unicenter Event Agent on a Windows 2008 virtual server, but every time I run the NSM 11.2 installer I get the following error code: Unknown or bad error code from "cadepchkx.exe" error code = -1 There are already some Unicenter agents installed on this server, but that was done from a custom install script. Has any one experienced this or know how I can get the installer to run properly, so I can install the event agent?

  Read the article

• Excel Matching problem with logic expression

  - by abelenky

  I have a block of data that represents the steps in a process and the possible errors: ProcessStep Status FeesPaid OK FormRecvd OK RoleAssigned OK CheckedIn Not Checked In. ReadyToStart Not Ready for Start I want to find the first Status that is not "OK". I have attempted this: =Match("<>""OK""", StatusRange, 0) which is supposed to return the index of the first element in the range that is NOT-EQUAL (<) to "OK" But this doesn't work, instead returning #N/A. I expect it to return 4 (index #4, in a 1-based index, representing that CheckedIn is the first non-OK element) Any ideas how to do this?

  Read the article

• Migrating ODBC information through a batch file

  - by DeskSide

  I am a desktop support technician currently working on a large scale migration project across multiple sites. I am looking at a way to transfer ODBC entries from Windows XP to Windows 7. If anyone knows of a program or anything prebuilt that already does this, please redirect me. I've already looked but haven't found anything, so I'm trying to build my own. I know enough basic programming to read the work of others and monkey around with something that already exists, but not much else. I have come across a custom batch file written at one site that (among other things) exports ODBC information from the old computer and stores it on a server (labelled as y: through net use at the beginning of the file), then later transfers it from the server to a new computer. The pre-existing code is for Windows XP to XP migrations. Here are the pertinate bits of code: echo Exporting ODBC Information start /wait regedit.exe /e "y:\%username%\odbc.reg" HKEY_LOCAL_MACHINE\SOFTWARE\ODBC\ODBC.INI (and later on) echo Importing ODBC start /wait regedit /s "y:\%username%\odbc.reg" We are now migrating from Windows XP to 7, and this part of the batch file still seems to work for this particular site, where Oracle 8i and 10g are used. I'm looking to use my cut down version of this code at multiple sites, and I'm wondering if the same lines of code will still work for anything other than Oracle. Also, my research on this issue has shown that there are different locations in 64 bit operating systems for 32/64 bit entries, and I'm wondering what effect that would have on the code. Could I copy the same data to both parts of the registry, in hopes of catching everything? Any assistance would be appreciated. Thank you for your time.

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Sudo asks for password twice with LDAP authentication

  - by Gnudiff

  I have Ubuntu 8.04 LTS machine and Windows 2003 AD domain. I have succesfully set up that I can log in with domain username and password, using domain prefix, like "domain+username". Upon login to machine it all works first try, however, for some reason when I try to sudo my logged in user, it asks for the password twice every time when I try sudo. It accepts the password after 2nd time, but not the first time. Once or twice I might think I just keep entering wrong pass the first time, but this is what happens always, any ideas of what's wrong? pam.conf is empty pam.d/sudo only includes common-auth & common-account, and common-auth is: auth sufficient pam_unix.so nullok_secure auth sufficient pam_winbind.so auth requisite pam_deny.so auth required pam_permit.so

  Read the article

• ESX Firewall Command Troubles

  - by John

  Hi, I am working on creating some firewall rules to stop some of the SSH brute-force attacks that we have seen recently on our ESX server hosts. I have tried the following rules from the CLI to first block all SSH traffic and then allow the two ranges that I am interested in: esxcfg-firewall --ipruleAdd 0.0.0.0/0,22,tcp,REJECT,"Block_SSH" esxcfg-firewall --ipruleAdd 11.130.0.0/16,22,tcp,ACCEPT,"Allow_PUBLIC_SSH" esxcfg-firewall --ipruleAdd 10.130.0.0/16,22,tcp,ACCEPT,"Allow_PRIVATE_SSH" However, these rules are not working as intended. I know that if you do not enter the block rule first, then the allow rule will not be processed. We are now having the issue where the first entered allow rule is being ignored such that the block rule works and the last entered allow rule works. I was curious if anyone had any ideas on how I could allow a few different ranges of IP's with the esxcfg-firewall --ipruleAdd command? I am at a loss and am having a hard time locating examples or further documentation about this. Thanks in advance for your help with this.

  Read the article

< Previous Page | 553 554 555 556 557 558 559 560 561 562 563 564  | Next Page >