Search Results

Search found 5120 results on 205 pages for 'inline editing'.

Page 56/205 | < Previous Page | 52 53 54 55 56 57 58 59 60 61 62 63  | Next Page >

  • pure-specifier on function-definition

    - by bebul
    While compiling on GCC I get the error: pure-specifier on function-definition, but not when I compile the same code using VS2005. class Dummy { //error: pure-specifier on function-definition, VS2005 compiles virtual void Process() = 0 {}; }; But when the definition of this pure virtual function is not inline, it works: class Dummy { virtual void Process() = 0; }; void Dummy::Process() {} //compiles on both GCC and VS2005 What does the error means? Why cannot I do it inline? Is it legal to evade the compile issue as shown in the second code sample?

    Read the article

  • JQuery .html() method and external scripts

    - by Marco
    Hi, i'm loading, using the JQuery ajax() method, an external page with both html and javascript code: <script type="text/javascript" src="myfile.js"></script> <p>This is some HTML</p> <script type="text/javascript"> alert("This is inline JS"); </script> and setting the results into a div element, using the html() method. While the html() method properly evaluates the inline JS code, it doesn't download and evaluate the external JS file "myfile.js". Any tip for this issue?

    Read the article

  • Does changing the order of class private data members breaks ABI

    - by Dmitry Yudakov
    I have a class with number of private data members (some of them static), accessed by virtual and non-virtual member functions. There's no inline functions and no friend classes. class A { int number; string str; static const int static_const_number; public: // got virtual and non-virtual functions, working with these memebers virtual void func1(); void func2(); // no inline functions or friends }; Does changing the order of private data members breaks ABI in this case? class A { string str; static const int static_const_number; int number; // <-- integer member moved here ... };

    Read the article

  • Wordpress css and ie6

    - by marc-andre menard
    my website : http://www.equipe94.com have a two column layout and in ie6 the right column is flushed at the button... it look like and inline problem, but even WITH the inline widget.. it's still at the bottom.. any idea to fix a wordpress template to play well with ie6 ? thanks in advance n.b. As mentioned in the comment... my page don't validate... after fixing the multiples problems now I validate in XHTML 1.0 Strict... but the problem is still there !

    Read the article

  • Migrating from Maven to SBT

    - by Vasil Remeniuk
    Hi people, As you know, SBT is compatible with Maven in some way -- SBT recognizes simple Maven POMs and can use dependencies and repositories specified in them. However, SBT wiki says that, if inline dependency is specified in SBT project definition, POM will be ignored (so using both in this case is impossible): Maven and Ivy configurations (pom.xml and ivy.xml) are ignored when inline dependency declarations are present. Does anyone know, if any kind of converter from Maven POM to SBT project definition exists (translating POM's XML into project definition Scala code)? I'm considering writing such script (that will help to migrate my old Scala/Maven projects to SBT), but want to know first, if this functionality already exists. Thanks in advance.

    Read the article

  • Edit and Create view using EditCreate.ascx partial in ASP.NET MVC

    - by mare
    If you look at the NerdDinner example of creating and editing dinners then you see they use a partial (ViewUserControl or ASCX) DinnerForm to put the functionality of creating and editing dinners into one file because it is essential the same and they use it using RenderPartial("DinnerForm"). This approach seems fine for me but I've run into a problem where you have to add additonal route values or html properties to the Form tag. This picks up the current action and controller automatically: <% using (Html.BeginForm()) { %> However, if I use another BeginForm() overload which allows to pass in enctype or any other attribute I have to do it like this: <% using ("Create", "Section", new { modal = true }, FormMethod.Post, new { enctype = "multipart/form-data" })) and as you can see we lose the ability to automatically detect in which View we are calling RenderPartial("OurCreateEditFormPartial"). We can't have hardcoded values in there because in Edit View this postback will fail or won't postback to the right controller action. What should I do in this case?

    Read the article

  • Hibernate generate POJOs with Equals

    - by jschoen
    We are using hibernate in a new project where we use the hibernate.reveng.xml to create our *.hbm.xml files and POJOs after that. We want to have equals methods in each of our POJOs. I found that you can use <meta attribute="use-in-equals">true</meta> in your hbm files to mark which properties to use in the equals. But this would mean editing alot of files, and then re-editing the files again in the future if/when we modify tables or columns in our DB. So I was wondering if there is a way to place which properties to use in the equals method for each pojo(table) in the hibernate.reveng.xml file?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How to get `gcc` to generate `bts` instruction for x86-64 from standard C?

    - by Norman Ramsey
    Inspired by a recent question, I'd like to know if anyone knows how to get gcc to generate the x86-64 bts instruction (bit test and set) on the Linux x86-64 platforms, without resorting to inline assembly or to nonstandard compiler intrinsics. Related questions: Why doesn't gcc do this for a simple |= operation were the right-hand side has exactly 1 bit set? How to get bts using compiler intrinsics or the asm directive Portability is more important to me than bts, so I won't use and asm directive, and if there's another solution, I prefer not to use compiler instrinsics. EDIT: The C source language does not support atomic operations, so I'm not particularly interested in getting atomic test-and-set (even though that's the original reason for test-and-set to exist in the first place). If I want something atomic I know I have no chance of doing it with standard C source: it has to be an intrinsic, a library function, or inline assembly. (I have implemented atomic operations in compilers that support multiple threads.)

    Read the article

  • How do you handle files that can't support concurrent edits in Mercurial?

    - by Scott Whitlock
    I'm using Mercurial with TortoiseHg. Each developer has their own repositories, and there's one central repository on the server for synchronizing our changes. (This will sound lame, but we're using it to manage the source for a legacy VB6 project. Nothing we can do about that...) As has been pointed out elsewhere, there is a big problem in VB6 with merging the .frx (form resources) files. So code changes seem to merge fine, but if two developers both make changes at the same time in the form design view, we can't merge. I'm ok with disallowing concurrent edits, but of course the whole point of Mercurial is that it's distributed so there is no option to force a file to be locked before editing. I don't believe there's a Mercurial solution for this, so I'm wondering: other developers who are using Mercurial for version control, do you have some 3rd party tool that assists with locking files for editing in the cases where it's necessary? Did we make a mistake using Mercurial instead of something like SVN?

    Read the article

  • Change input text to regular text on blur and ability to edit jQuery

    - by eknown
    I'm creating a form where I'm eliminating the use of a save button. The form is made up of input text boxes and textareas. After the user enters data into the input field, I want to trigger an onBlur function and change the input into a span that contains the information that the user entered. I also want to have the ability to edit this information, so if the user clicks on the newly created span with text, it will turn back into the input field with the current information for their editing pleasure. For reference, I'm looking to have a functionality pretty much like on editing a photo title on Flickr. If possible, I'd also like to have the textbox show "saving..." for half a second after the blur to reflect interaction with server.

    Read the article

  • Bullets WILL NOT dissapear in firefox

    - by DunlopBurns
    Hoping you can help me with a problem. I cannot get rid of Bullets in Firefox, i don't want any anywhere, hence my list-style-type: none!important being everywhere. It only appears in Firefox as far as i can tell. the HTML.... <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" lang="en" xml:lang="en"> <head> <title>littleprints.nl</title> <meta name="description" content="----" /> <meta name="keywords" content="----" /> <meta http-equiv="Content-Type" content="text/html; charset=iso-8859-1" /> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1.4/jquery.min.js"></script> <script type="text/javascript" src="js/slimbox2.js"></script> <link rel="stylesheet" href="css/slimbox2.css" type="text/css" media="screen" /> <link rel="stylesheet" href="layout.css"/> <link rel="stylesheet" href="style.css"/> </head> <body> <div id="container"> <div id="inline1"> <div id="mainpic"> <img src="myimages/circle.jpg" width="100%" alt="Circle bracelet"/> </div> <div id="intro"> <p>Hi and welcome to little prints NL. we make this and that all by hand with 100% silver. my name is Donna Burns and i work by commision, ive been studying for 4 years and am currently learning to become a goldsmith.</p> </div> </div> <div id="inline2"> <p>Click for more...</p> <div id="images"> <a href="myimages/photos/dogtag.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/chunky.gif" alt="chunky"/></a> <a href="myimages/photos/hearts.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/hearts.gif" alt="hearts"/></a> <a href="myimages/photos/close.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/close.gif" alt="close"/></a> <a href="myimages/photos/pearl.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/flower.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/frontcircle.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/dogtag.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> </div> </div> </div><!--end container--> <div id="footer"> <div id="footalign"> <div id="social"> <ul> <li> <a href="http://www.facebook.com/littleprints" title="Little Prints"> <img src="myimages/facebook.png" width="50px" height="50px" alt="FB"/> </a> </li> <li> <a href="contact.html" title="contact"> <img src="myimages/at.gif" alt="@"/> </a> </li> </ul> </div> <div id="contact"> <p><br/>To enquire about a charm either phone:<br/> 0787463289<br/> or use one of the methods to the side.</p> </div> </div> </div> </body> </html> the CSS... * {margin: 0; padding: 0; border: 0;} html, body { background-color: #000000;image; text-align: center; font: 16px/1.8 Verdana, Arial, Helvetica, sans-serif; list-style-type: none!important; text-decoration: none;} #container { position: relative; width: 900px; top: 0; min-height: 100%; margin-left: auto; margin-right: auto; padding-top: 20px; background-image: URL(myimages/back2.gif); margin-bottom: 180px; } #footer { background-color: #555555; position: relative; clear: both; bottom: 0; width: 900px; height: auto; margin-left: auto; margin-right: auto; margin-bottom: 20px; padding-bottom: 22px; margin-top: -180px; } #inline1{ display: inline-block; margin-top: 250px; margin-bottom: 20px; } #inline2 { display: inline-block; margin-top: 30px; margin-bottom: 50px; } #mainpic { float: left; width: 68%; margin-left: 20px; } #intro { float: right; width: 20%; margin-left: auto; margin-right: 50px; margin-top: 20px; } #images { margin-bottom: 20px; margin-left: auto; margin-right: auto; } #footalign { display: inline; width:900px; list-style-type: none; } #contact { text-align: center; background-color:#555555; float: middle; list-style-type: none; } #social{ background-color:#555555; float: right; list-style: none; padding:0; padding-right: 5px; text-align:center; list-style-type: none!important; } #social img{ border: none; list-style-type: none!important; margin: 3px; } #social ul{ border: none; list-style-type: none!important; } #social a{ display:inline-block; -webkit-transition:all .5s ease-out; -moz-transition:all .5s ease-out; -ms-transition:all .5s ease-out; -o-transition:all .5s ease-out; transition:all .5s ease-out; list-style-type: none!important; } #social a:hover{ display:inline-block; -webkit-transform:translate(-10px,0px); -moz-transform:translate(0px,-10px); -ms-transform:translate(-10px,0px); -o-transform:translate(-10px,0px); transform:translate(-10px,0px); list-style-type: none!important; } #form { margin-top: 250px; margin-bottom: 50px; } .nav1 {font-family: sans-serif;font-size: 22px;text-shadow: 2px 2px 5px #000000;} a:link {text-decoration:none; color:#000000; padding:3px;} a:visited {text-decoration:none; color:#000000;} a:active {text-decoration:none; color:#555555;} a:hover {text-decoration:none; color:#555555;} .nav2 {font-family: sans-serif;font-size: 22px;text-shadow: 2px 2px 5px #ffffff;} a:link {text-decoration:none; color:#ffffff; padding:3px;} a:visited {text-decoration:none; color:#ffffff;} a:active {text-decoration:none; color:#555555;} a:hover {text-decoration:none; color:#555555;} .p1 { color: #ffffff; } div#images img { max-width: 500px; height: auto; }

    Read the article

  • loading an asp after starting a session

    - by Noam Smadja
    the jQuery $("#loginform").submit(function(){ $.ajax({ type: "POST", url: "loginrespajax.asp", data: $("#loginform").serialize(), success: function(){ $("#loginform").hide("slow"); $("#loginform").load("userheader.asp"); $("#loginform").show("slow"); } }); }); thats userheader.asp <div class="userlinks"> <%if (session("userlevel")) then%> <% select case session("userlevel") case 1 %> <a href="managenews.asp"><%langstring("header_news")%></a> | <a href="managebooks.asp"><%langstring("header_books")%></a> | <a href="manageusers.asp"><%langstring("manage_users")%></a> | <a href="manageorders.asp"><%langstring("manage_orders")%></a> | <a href="managelanguage.asp"><%langstring("manage_language")%></a> | <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% case 2 %> <a href="managenews.asp"><%langstring("header_news")%></a> | <a href="managebooks.asp"><%langstring("header_books")%></a> | <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% case 3 %> <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% End select %> <a href="editprofile.asp"><%langstring("editprofile_header")%></a> | <a href="changepassword.asp"><%langstring("changepassword_header")%></a> | <a href="logout.asp"><%langstring("logout_header")%></a> <%else%> <form action="loginrespajax.asp" method="POST" name="loginform" id="loginform" class="loginform" onSubmit="return false;"> <input type="text" name="username" value="username" class="input inline" onFocus="clearText(this);"> <input type="password" name="password" value="password" class="input inline" onFocus="clearText(this);"> <input type="submit" value="Log In" class="submit inline"> </form> <%End if%> </div> i am submiting the login form using AJAX and the jQuery partially works. it does hide and show again. but it prints the ELSE part of in userheader.asp. the session does start, for sure :)

    Read the article

  • to change the style of div

    - by ramyatk06
    hi guys, I have 2 buttons and 2 divs div1 and div2.On click button1 div1 is made visible and div2 invisible,On clicking button2 div2 is made visible and div1 is invisible. For that i used javascript. function showdiv2() { document.getElementById("div2").style.visibility="visible"; document.getElementById("div2").style.display="inline"; document.getElementById("div1").style.visibility="hidden"; document.getElementById("div1").style.display = "none"; document.getElementById("lbl_msg").innerHTML = "" } function showdiv1() { document.getElementById("div1").style.visibility="visible"; document.getElementById("div1").style.display="inline"; document.getElementById("div2").style.visibility="hidden"; document.getElementById("div2").style.display = "none"; document.getElementById("lbl_msg").innerHTML = "" } In div2 i have a gridview in which i have a linkbutton named lnkDelete.In its click control is going to div1.In click of lnkDelete,i want to make div1 invisible,but on clicking button1 div1 should be visible.Can anybody help to make div1 invisible in clickevent of lnkDelete in codebehind?

    Read the article

  • HTML list wrapping problem

    - by Daniel
    I have a HTML list with this style: font-weight: bold; padding: 0px; margin: 0px; list-style-type: none; display: block; width:700px; font-size: 14px; white-space: pre-wrap; and the cells have this style: display: inline; and I have spacer cells between each cell with this style: padding-right: 20px; display: inline; My problem is that when the list is too long for its 700 pixels, it wraps. I want this, but I dont want the objects to be on two separate lines. I have tried the CSS white-space property, but nothing seems to work. Any ideas?

    Read the article

  • How to preserve sibling element position when one sibling is absolutely positioned?

    - by Casey
    In the snippet below, the child div is normally positioned until it is :hovered , when it becomes absolutely positioned. The reasoning behind this markup is to simulate a popup style in a limited environment where I can't use a <select> (among other limitations). When child is hovered, the sibling elements jump around, which is expected, as the contents of the block have changed. But how can I preserve their positioning? That is, what CSS can I add to prevent the siblings from jumping around when child is hovered. Javascript is also not allowed, so please no answers using JS. HTML: <div class="container"> <div class="child"> <span class="d4"></span> <label><input type="radio" name="radio" value="1"/>One</label> <label><input type="radio" name="radio" value="2"/>Two</label> </div> <input type="text" name="sibling"/> <button name="sibling2">Button</button> </div> CSS: .container, .child, button { display:inline-block; } .child { vertical-align: middle; width: 35px; height: 35px; } .child:hover { background: gray; position:absolute; width: 100px; height: auto; } .child:hover > .d4 { display: none; } .child label { display:none; } .child:hover label { display: inline-block; } .d4 { background-position: -411px -1px; width: 35px; height: 35px; background-image: url("https://i.imgur.com/zkgyBOi.png"); background-repeat: no-repeat; color: transparent; display: inline-block; } Here's a fiddle: http://jsfiddle.net/cpctZ/1/

    Read the article

  • Why would the assignment operator ever do something different than its matching constructor?

    - by Neil G
    I was reading some boost code, and came across this: inline sparse_vector &assign_temporary(sparse_vector &v) { swap(v); return *this; } template<class AE> inline sparse_vector &operator=(const sparse_vector<AE> &ae) { self_type temporary(ae); return assign_temporary(temporary); } It seems to be mapping all of the constructors to assignment operators. Great. But why did C++ ever opt to make them do different things? All I can think of is scoped_ptr?

    Read the article

  • How to achieve table like rows within container using CSS

    - by Barry
    I'm helping an artist maintain her website and have inherited some pretty outdated code. Have moved lots of redundant common code to include files and am now working on moving from inline styles to more CSS-driven styles. For the gallery pages, e.g. http://artistsatlaketahoe.com/abstract.html, a lot of inline styling is used to force the current layout. My preference would be to replace this entirely with CSS that presents the following table-like layout within the "content" div: [image] [image descriptives and purchase button] [image] [image descriptives and purchase button] [image] [image descriptives and purchase button] I'd like to middle-align the image descriptives & purchase button relative to the image if possible. And then apply some padding above and below each row to stop using tags for vertical spacing. Any ideas how to create a div that I can use to get this kind of layout? Thanks!

    Read the article

  • Scroll to a text position in Javascript

    - by Andy
    I have a real-time HTML editor, with a textarea on the left for code entry, and a 'preview' DIV on the right to contain the preview of the code entered. At the moment, when editing the code in the left pane, the preview just sits where it is, so often the part of the code you're editing is not in the visible area of the preview (especially when images are involved). My question is how do I make the preview scroll to show the part of the code that's currently being edited? Here is the page I have so far: http://www.caerphoto.com/rtedit.html You'll notice in the source I have a (currently unused) matchPreview() function that tries to match the scroll position of the preview based on the scroll position of the textarea, but obviously if images or large text are involved the two panes no longer match.

    Read the article

  • Document Management System - Where to Store Files?

    - by Diego AC
    Hey, stack! I'm on charge of building an ASP.NET MVC Document Management System. It have to be able to do basic document management tasks like adding, editing and searching entries and also perform versioning. Anyways, I'm targeting PDF, Office and many image formats as the file attached to each document entry in the database. My question is: What design guidelines do pros follow when building the storage mechanism? Do they store the document files in the file system? Database? How file uploading is handled? I used to upload the files to a temporal location while the user was editing the data and move it to permanent storage when the user confirmed the entry creation. Is this good? Any suggestions on improvement?

    Read the article

  • Why can't I save CSS changes in FireBug?

    - by Dean
    FireBug is the most convenient tool I've found for editing CSS - so why isn't there a simple "Save" option? I am always finding myself making tweaks in FireBug, then going back to my original .css file and replicating the tweaks. Has anyone come up with a better solution? EDIT: I'm aware the code is stored on a server (in most cases not my own), but I use it when building my own websites. Firebug's just using the .css file FireFox downloaded from the server, it knows precisely what lines in which files its editing, I can't see why there's not an "Export" or "Save" option which allows you to store the new .css file. (Which I could then replace the remote one with). I have tried looking in temporary locations, and choosing file-save and experimenting with the output options on FireFox, but I still haven't found a way. Here's hoping someone has a nice solution... EDIT 2: The Official Group has a lot of questions, but no answers.

    Read the article

< Previous Page | 52 53 54 55 56 57 58 59 60 61 62 63  | Next Page >