Search Results

Search found 20092 results on 804 pages for 'python import'.

Page 564/804 | < Previous Page | 560 561 562 563 564 565 566 567 568 569 570 571  | Next Page >

  • Java Web Service Client from Microsoft Live Search

    - by trendyy
    I generated java web service from here -- http://api.search.live.net/search.wsdl.. I want to make search and listing the return values. In my opinion i generated client and client is makes research but i can't display result, how i can do that.. Can anyone check my wrote code and help me about displaying result? Thanks... import java.rmi.RemoteException; import com.microsoft.schemas.LiveSearch._2008._03.Search.*; public class searchtry { public static void main(String[] args) throws RemoteException { LiveSearchPortTypeProxy client=new LiveSearchPortTypeProxy(); SearchRequest request=new SearchRequest(); SearchRequestType1 type1=new SearchRequestType1(); sorgu.setAppId("*********************************"); //Windows Live gave this id for using that service sorgu.setSources(new SourceType[]{SourceType.Web}); sorgu.setQuery("Java"); aratip.setParameters(request); SearchResponseType0 answer= client.search(type1); System.out.println(answer.toString()); }

    Read the article

  • search & replace on 3000 row, 25 column spreadsheet

    - by Deca
    I'm attempting to clean up data in this (old) spreadsheet and need to remove things like single and double quotes, HTML tags and so on. Trouble is, it's a 3000 row file with 25 columns and every spreadsheet app I've tried (NeoOffice, MS Excel, Apple Numbers) chokes on it. Hard. Any ideas on how else I can clean this thing up for import to MySQL? Clearly I could go through each record manually, row by row, but would like to avoid that if at all possible. Likewise, I could write a PHP script to handle it on import, but don't want to put the server into a death spiral either.

    Read the article

  • PHP: Coding long-running scripts when servers impose an execution time limit

    - by thomasrutter
    FastCGI servers, for example, impose an execution time limit on PHP scripts which cannot be altered using set_time_limit() in PHP. IIS does this too I believe. I wrote an import script for a PHP application that works well under mod_php but fails under FastCGI (mod_fcgid) because the script is killed after a certain number of seconds. I don't yet know of a way of detecting what your time limit is in this case, and haven't decided how I'm going to get around it. Doing it in small chunks with redirects seems like one kludge, but how? What techniques would you use when coding a long-running task such as an import or export task, where an individual PHP script may be terminated by the server after a certain number of seconds? Please assume you're creating a portable script, so you don't necessarily know whether PHP will eventually be run under mod_php, FastCGI or IIS or whether a maximum execution time is enforced at the server level.

    Read the article

  • Error when trying to use hibernate annotations.

    - by Wilhelm
    The error I'm receiving is listed here. That's my HibernateUtil.java package com.rosejapan; import org.hibernate.SessionFactory; import org.hibernate.cfg.AnnotationConfiguration;; public class HibernateUtil { private static final SessionFactory sessionFactory; static { try { // Create the SessionFactory from hibernate.cfg.xml sessionFactory = new AnnotationConfiguration().configure().buildSessionFactory(); } catch(Throwable e) { System.err.println("Initial sessionFactory creation failed. " + e); throw new ExceptionInInitializerError(e); } } public static SessionFactory getSessionFactory() { return sessionFactory; } } Everything looks all right... I've already included log4j-boot.jar in the CLASSPATH, but didn't resolved my problem.

    Read the article

  • dreamweaver sites

    - by ngreenwood6
    Hello, We have over 500 sites that we host. All of there ftp information is in a database. Whenever one of our programmers have to add a site they have to get all the info and set it up. However, I found that you can export them and it has all the info except for one problem. The password is encrypted. I am not trying to hack anything, I want to know how to encrypt our passwords so that we can import them using dreamweavers import feature. Can anyone tell me what encryption they use or a link on how to encrypt. I am not interested in decrypting at all because we already have all of them so it would not do me any good. Thanks for any help

    Read the article

  • org.apache.http.impl.cookie.BasicClientCookie not serializable???

    - by Misha Koshelev
    Dear All: I am quite confused... I am reading here and BasicClientCookie clearly implements Serializable per JavaDoc: http://hc.apache.org/httpcomponents-client/httpclient/apidocs/org/apache/http/impl/cookie/BasicClientCookie.html However, my simple Groovy script: #!/usr/bin/env groovy @Grapes( @Grab(group='org.apache.httpcomponents', module='httpclient', version='4.0.1') ) import org.apache.http.impl.cookie.BasicClientCookie import java.io.File def cookie=new BasicClientCookie("name","value") println cookie instanceof Serializable def f=new File("/tmp/test") f.withObjectOutputStream() { oos-> oos.writeObject(cookie) } outputs: false Caught: java.io.NotSerializableException: org.apache.http.impl.cookie.BasicClientCookie at t$_run_closure1.doCall(t.groovy:12) at t.run(t.groovy:11) I have checked and I have no other versions of HttpClient anywhere in classpath (if I take Grapes statement out it cannot find file). Thank you! Misha Koshelev

    Read the article

  • multiline gtk.Label ignores xalign=0.5

    - by thomas
    A gtk.Label can't be aligned in center when line-wrap is turned on. Example code: import pygtk pygtk.require('2.0') import gtk class testwin(gtk.Window): def __init__(self): gtk.Window.__init__(self) width,height = 300,300 self.set_size_request(width,height) self.set_position(gtk.WIN_POS_CENTER) self.set_title("test window") label = gtk.Label("test text") label.set_line_wrap(True) label.set_justify(gtk.JUSTIFY_CENTER) label.set_alignment(0.5,0.5) label.connect("size-allocate",lambda l,s: l.set_size_request(s.width-1, -1)) self.add(label) self.connect("destroy", gtk.main_quit) self.show_all() testwin() gtk.main() It looks like this, that means, it's aligned left: http://m45.img-up.net/?up=pic122x97.png If you comment out line 14 (set_line_wrap) everything is perfectly fine: http://o54.img-up.net/?up=pic2y00p9.png Please note that yalign works fine. So it seems like the first argument in the gtk.Misc.set_alignment-function has no effect when line wrap is turned on. Using Fedora 16, 64bit, gtk 3.2.4, pygtk 2.24.0, python 2.7.2 Question: Is this intended or a bug? How is it supposed to be made or is a workaround available?

    Read the article

  • XCode project complains about missing files if a linked framework contains private headers

    - by darklight
    My Problem is this: My framework contains public and private headers - the public headers import private headers in the framework My app that links against this framework imports public headers Now when I compile it, XCode complains about missing files (the private headers that are indirectly imported via the frameworks public headers). I read somewhere on stackoverflow that I should do this: "In the public header file use @class to include other interfaces and use #import in the implementation file (.m)." I find this solution pretty unsatisfying - you have to use it for circular dependencies, too. Is there any better way to keep my headers private?

    Read the article

  • Whats wrong with this code.Runtime error

    - by javacode
    Hi I am writing this application in eclipse I added all the jar files.I am pasting the code and error.Please let me know what changes I should make to run the application properly. import javax.mail.*; import javax.mail.internet.*; import java.util.*; public class SendMail { public static void main(String [] args) { SendMail sm=new SendMail(); try{ sm.postMail(new String[]{"[email protected]"},"hi","hello","[email protected]"); } catch(MessagingException e) { e.printStackTrace(); } } public void postMail( String recipients[ ], String subject, String message , String from) throws MessagingException { boolean debug = false; //Set the host smtp address Properties props = new Properties(); props.put("mail.smtp.starttls.enable","true"); props.put("mail.smtp.host", "smtp.gmail.com"); props.setProperty("mail.smtp.port", "25"); // create some properties and get the default Session Session session = Session.getDefaultInstance(props, null); session.setDebug(debug); // create a message Message msg = new MimeMessage(session); // set the from and to address InternetAddress addressFrom = new InternetAddress(from); msg.setFrom(addressFrom); InternetAddress[] addressTo = new InternetAddress[recipients.length]; for (int i = 0; i < recipients.length; i++) { addressTo[i] = new InternetAddress(recipients[i]); } msg.setRecipients(Message.RecipientType.TO, addressTo); // Optional : You can also set your custom headers in the Email if you Want msg.addHeader("MyHeaderName", "myHeaderValue"); // Setting the Subject and Content Type msg.setSubject(subject); msg.setContent(message, "text/plain"); Transport.send(msg); } } Error: com.sun.mail.smtp.SMTPSendFailedException: 530 5.7.0 Must issue a STARTTLS command first. 13sm646598ewy.13 at com.sun.mail.smtp.SMTPTransport.issueSendCommand(SMTPTransport.java:1829) at com.sun.mail.smtp.SMTPTransport.mailFrom(SMTPTransport.java:1368) at com.sun.mail.smtp.SMTPTransport.sendMessage(SMTPTransport.java:886) at javax.mail.Transport.send0(Transport.java:191) at javax.mail.Transport.send(Transport.java:120) at SendMail.postMail(SendMail.java:54) at SendMail.main(SendMail.java:10)

    Read the article

  • How to organize asp.net mvc project (using entity framework) and a corresponding database project?

    - by Bernie
    I recently switched to vs2010 and am experimenting with asp.net MVC2. I am building a simple website and use the entity framework to design the data model. From the .edmx file, I generate the database tables. After a few iterations, I decided that it would be nice to have version control of the database schema as well, and therefore I added a database project into which I imported the script that is generated from the datamodel. As a result, I have to generate the sql every time that I change the model and redo the import. The database project automatically updates the database. Although the manual steps to generate the sql and the import are annoying, this works pretty well, until I wanted to add the standard tables for user accounts/authorization etc. I can use the framework tools to add the necessary tables, views etc. to the database, but as I do not want to have them in the .edmx model I end up with a third manual step. Is anybody facing similar issues?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Why does my program crash when given negative values?

    - by Wayfarer
    Alright, I am very confused, so I hope you friends can help me out. I'm working on a project using Cocos2D, the most recent version (.99 RC 1). I make some player objects and some buttons to change the object's life. But the weird thing is, the code crashes when I try to change their life by -5. Or any negative value for that matter, besides -1. NSMutableArray *lifeButtons = [[NSMutableArray alloc] init]; CCTexture2D *buttonTexture = [[CCTextureCache sharedTextureCache] addImage:@"Button.png"]; LifeChangeButtons *button = nil; //top left button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(50 , size.height - 30); [button buttonText:-5]; [lifeButtons addObject:button]; //top right button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(size.width - 50 , size.height - 30); [button buttonText:1]; [lifeButtons addObject:button]; //bottom left button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(50 , 30); [button buttonText:5]; [lifeButtons addObject:button]; //bottom right button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(size.width - 50 , 30); [button buttonText:-1]; [lifeButtons addObject:button]; for (LifeChangeButtons *theButton in lifeButtons) { [self addChild:theButton]; } This is the code that makes the buttons. It simply makes 4 buttons, puts them in each corner of the screen (size is the screen) and adds their life change ability, 1,-1,5, or -5. It adds them to the array and then goes through the array at the end and adds all of them to the screen. This works fine. Here is my code for the button class: (header file) // // LifeChangeButtons.h // Coco2dTest2 // // Created by Ethan Mick on 3/14/10. // Copyright 2010 Wayfarer. All rights reserved. // #import "cocos2d.h" @interface LifeChangeButtons : CCSprite <CCTargetedTouchDelegate> { NSNumber *lifeChange; } @property (nonatomic, readonly) CGRect rect; @property (nonatomic, retain) NSNumber *lifeChange; + (id)lifeButton:(CCTexture2D *)texture; - (void)buttonText:(int)number; @end Implementation file: // // LifeChangeButtons.m // Coco2dTest2 // // Created by Ethan Mick on 3/14/10. // Copyright 2010 Wayfarer. All rights reserved. // #import "LifeChangeButtons.h" #import "cocos2d.h" #import "CustomCCNode.h" @implementation LifeChangeButtons @synthesize lifeChange; //Create the button +(id)lifeButton:(CCTexture2D *)texture { return [[[self alloc] initWithTexture:texture] autorelease]; } - (id)initWithTexture:(CCTexture2D *)atexture { if ((self = [super initWithTexture:atexture])) { //NSLog(@"wtf"); } return self; } //Set the text on the button - (void)buttonText:(int)number { lifeChange = [NSNumber numberWithInt:number]; NSString *text = [[NSString alloc] initWithFormat:@"%d", number]; CCLabel *label = [CCLabel labelWithString:text fontName:@"Times New Roman" fontSize:20]; label.position = CGPointMake(35, 20); [self addChild:label]; } - (CGRect)rect { CGSize s = [self.texture contentSize]; return CGRectMake(-s.width / 2, -s.height / 2, s.width, s.height); } - (BOOL)containsTouchLocation:(UITouch *)touch { return CGRectContainsPoint(self.rect, [self convertTouchToNodeSpaceAR:touch]); } - (void)onEnter { [[CCTouchDispatcher sharedDispatcher] addTargetedDelegate:self priority:0 swallowsTouches:YES]; [super onEnter]; } - (void)onExit { [[CCTouchDispatcher sharedDispatcher] removeDelegate:self]; [super onExit]; } - (BOOL)ccTouchBegan:(UITouch *)touch withEvent:(UIEvent *)event { CGPoint touchPoint = [touch locationInView:[touch view]]; touchPoint = [[CCDirector sharedDirector] convertToGL:touchPoint]; if ( ![self containsTouchLocation:touch] ) return NO; NSLog(@"Button touch event was called returning yes. "); //this is where we change the life to each selected player NSLog(@"Test1"); NSMutableArray *tempArray = [[[UIApplication sharedApplication] delegate] selectedPlayerObjects]; NSLog(@"Test2"); for (CustomCCNode *aPlayer in tempArray) { NSLog(@"we change the life by %d.", [lifeChange intValue]); [aPlayer changeLife:[lifeChange intValue]]; } NSLog(@"Test3"); return YES; } - (void)ccTouchMoved:(UITouch *)touch withEvent:(UIEvent *)event { CGPoint touchPoint = [touch locationInView:[touch view]]; touchPoint = [[CCDirector sharedDirector] convertToGL:touchPoint]; NSLog(@"You moved in a button!"); } - (void)ccTouchEnded:(UITouch *)touch withEvent:(UIEvent *)event { NSLog(@"You touched up in a button"); } @end Now, This function: - (BOOL)ccTouchBegan:(UITouch *)touch withEvent:(UIEvent *)event Is where all the shit goes down. It works for all of the buttons except the -5 one. And then, it gets to: NSLog(@"we change the life by %d.", [lifeChange integerValue]); And it crashes at that statement. It only crashes when given anything less than -1. -1 works, but nothing smaller does. Here is the code in the CustomCCNode Class, "changeLife" that is being called. - (void)changeLife:(int)lifeChange { NSLog(@"change life in Custom Class was called"); NSLog(@"wtf is lifechange: %d", lifeChange); life += lifeChange; lifeString = [[NSString alloc] initWithFormat:@"%d",life]; [text setString:lifeString]; } Straight forward, but when the NSnumber is -5, it doesn't even get called, it crashes at the NSlog statement. So... what's up with that?

    Read the article

  • serving files using django - is this a security vulnerability

    - by Tom Tom
    I'm using the following code to serve uploaded files from a login secured view in a django app. Do you think that there is a security vulnerability in this code? I'm a bit concerned about that the user could place arbitrary strings in the url after the upload/ and this is directly mapped to the local filesystem. Actually I don't think that it is a vulnerability issue, since the access to the filesystem is restricted to the files in the folder defined with the UPLOAD_LOCATION setting. UPLOAD_LOCATION = is set to a not publicly available folder on the webserver url(r'^upload/(?P<file_url>[/,.,\s,_,\-,\w]+)', 'aeon_infrastructure.views.serve_upload_files', name='project_detail'), @login_required def serve_upload_files(request, file_url): import os.path import mimetypes mimetypes.init() try: file_path = settings.UPLOAD_LOCATION + '/' + file_url fsock = open(file_path,"r") file_name = os.path.basename(file_path) file_size = os.path.getsize(file_path) print "file size is: " + str(file_size) mime_type_guess = mimetypes.guess_type(file_name) if mime_type_guess is not None: response = HttpResponse(fsock, mimetype=mime_type_guess[0]) response['Content-Disposition'] = 'attachment; filename=' + file_name #response.write(file) except IOError: response = HttpResponseNotFound() return response

    Read the article

  • Maven eclipse does not add a dependency

    - by Calm Storm
    I have the following snippet in my pom.xml <dependency> <groupId>aspectj</groupId> <artifactId>aspectjrt</artifactId> <version>1.5.3</version> </dependency> and in one of my Java files I refer a class org.aspectj.lang.ProceedingJoinPoint. When I do a "mvn clean install" it compiles and builds fine but when I do an eclipse:eclipse, and import the project in eclipse it gives me an error The import org.aspectj cannot be resolved. I checked the .classpath file that was generated and it does not have an entry to this file. I tried a "mvn dependency:tree" and it lists this fine. Can someone tell me what is going wrong here?

    Read the article

  • Cannot instantiate abstract class or interface : problem while persisting

    - by sammy
    i have a class campaign that maintains a list of AdGroupInterfaces. im going to persist its implementation @Entity @Table(name = "campaigns") public class Campaign implements Serializable,Comparable<Object>,CampaignInterface { private static final long serialVersionUID = 1L; @Id @GeneratedValue(strategy = GenerationType.IDENTITY) private Long id; @OneToMany ( cascade = {CascadeType.ALL}, fetch = FetchType.EAGER, targetEntity=AdGroupInterface.class ) @org.hibernate.annotations.Cascade( value = org.hibernate.annotations.CascadeType.DELETE_ORPHAN ) @org.hibernate.annotations.IndexColumn(name = "CHOICE_POSITION") private List<AdGroupInterface> AdGroup; public Campaign() { super(); } public List<AdGroupInterface> getAdGroup() { return AdGroup; } public void setAdGroup(List<AdGroupInterface> adGroup) { AdGroup = adGroup; } public void set1AdGroup(AdGroupInterface adGroup) { if(AdGroup==null) AdGroup=new LinkedList<AdGroupInterface>(); AdGroup.add(adGroup); } } AdGroupInterface's implementation is AdGroups. when i add an adgroup to the list in campaign, campaign c; c.getAdGroupList().add(new AdGroups()), etc and save campaign it says"Cannot instantiate abstract class or interface :" AdGroupInterface its not recognizing the implementation just before persisting... Whereas Persisting adGroups separately works. when it is a member of another entity, it doesnt get persisted. import java.io.Serializable; import java.util.List; import javax.persistence.*; @Entity @DiscriminatorValue("1") @Table(name = "AdGroups") public class AdGroups implements Serializable,Comparable,AdGroupInterface{ /** * */ private static final long serialVersionUID = 1L; private Long Id; private String Name; private CampaignInterface Campaign; private MonetaryValue DefaultBid; public AdGroups(){ super(); } public AdGroups( String name, CampaignInterface campaign) { super(); this.Campaign=new Campaign(); Name = name; this.Campaign = campaign; DefaultBid = defaultBid; AdList=adList; } @Id @GeneratedValue(strategy = GenerationType.IDENTITY) @Column(name="AdGroup_Id") public Long getId() { return Id; } public void setId(Long id) { Id = id; } @Column(name="AdGroup_Name") public String getName() { return Name; } public void setName(String name) { Name = name; } @ManyToOne @JoinColumn (name="Cam_ID", nullable = true,insertable = false) public CampaignInterface getCampaign() { return Campaign; } public void setCampaign(CampaignInterface campaign) { this.Campaign = campaign; } } what am i missing?? please look into it ...

    Read the article

  • Relative paths in spring classpath resource

    - by Mike Q
    Hi all, I have a bunch of spring config files, all of which live under the META-INF directory in various subpackages. I have been using import like the following... <import resource="../database/schema.xml"/> So a relative path from the source file. This works fine when I am working with a local build outside of a jar file. But when I package everything up in a jar then I get an error that it cannot resolve the URL resource. If I change the above to an absolute path (with classpath:) then it works fine. Is there any way to use relative paths with ".." in when the configs are packaged in a jar or am I restricted to descending relative paths and absolute paths only? Thanks.

    Read the article

  • Looking for Reachability (2.0) Use Case Validation

    - by user350243
    There is so much info out there on using Apple's Reachability example, and so much is conflicting. I'm trying to find out of I'm using it (Reachability 2.0) correctly below. My App use case is this: If an internet connection is available through any means (wifi, LAN, Edge, 3G, etc.) a UIButton ("See More") is visible on various views. If no connection, the button is not visible. The "See More" part is NOT critical in any way to the app, it's just an add-on feature. "See More" could be visible or not anytime during the application lifecycle as connection is established or lost. Here's how I did it - Is this correct and/or is there a better way? Any help is Greatly Appreciated! lq // AppDelegate.h #import "RootViewController.h" @class Reachability; @interface AppDelegate : NSObject <UIApplicationDelegate> { UIWindow *window; UINavigationController *navigationController; RootViewController *rootViewController; Reachability* hostReach; // NOT USED: Reachability* internetReach; // NOT USED: Reachability* wifiReach; } @property (nonatomic, retain) IBOutlet UIWindow *window; @property (nonatomic, retain) IBOutlet UINavigationController *navigationController; @property (nonatomic, retain) IBOutlet RootViewController *rootViewController; @end // AppDelegate.m #import "AppDelegate.h" #import "Reachability.h" #define kHostName @"www.somewebsite.com" @implementation AppDelegate @synthesize window; @synthesize navigationController; @synthesize rootViewController; - (void) updateInterfaceWithReachability: (Reachability*) curReach { if(curReach == hostReach) { NetworkStatus netStatus = [curReach currentReachabilityStatus]; BOOL connectionRequired = [curReach connectionRequired]; // Set a Reachability BOOL value flag in rootViewController // to be referenced when opening various views if ((netStatus != ReachableViaWiFi) && (netStatus != ReachableViaWWAN)) { rootViewController.bConnection = (BOOL *)0; } else { rootViewController.bConnection = (BOOL *)1; } } } - (void) reachabilityChanged: (NSNotification* )note { Reachability* curReach = [note object]; NSParameterAssert([curReach isKindOfClass: [Reachability class]]); [self updateInterfaceWithReachability: curReach]; } - (void)applicationDidFinishLaunching:(UIApplication *)application { // NOTE: #DEFINE in Reachability.h: // #define kReachabilityChangedNotification @"kNetworkReachabilityChangedNotification" [[NSNotificationCenter defaultCenter] addObserver: self selector: @selector(reachabilityChanged:) name: kReachabilityChangedNotification object: nil]; hostReach = [[Reachability reachabilityWithHostName: kHostName] retain]; [hostReach startNotifer]; [self updateInterfaceWithReachability: hostReach]; [window addSubview:[navigationController view]]; [window makeKeyAndVisible]; } - (void)dealloc { [navigationController release]; [rootViewController release]; [window release]; [super dealloc]; } @end

    Read the article

  • Should I update an application when a used framework release a new version?

    - by Alex
    I have an application that use several libraries and frameworks, should I update my application to use the latest version of those frameworks when a new stable version is available? For example, migrate from python 2.x to python 3.x, or from spring 2.5 to spring 3.0, but the question es very general, not language specific. If I keep the application updated to use the latest stable frameworks versions then I will have new features available in case I need them. If I don't, then may be in a future I will need to do the update and it will be a lot of work to update the application. Is there any best practice about this?

    Read the article

  • Video with QML Video plays choppy on Mac OS X

    - by avida
    I’m trying to create simple video player with QML. I have QtSdk installed and QtMobility compiled and installed from source. Then I put this simple video playing code to main qml file: import QtQuick 1.0 import QtMultimediaKit 1.1 Item{ width: 400; height: 300 Video { id: video source: "d:/Projects/Serenity - HD DVD Trailer.mp4" anchors.fill: parent MouseArea { anchors.fill: parent onClicked: { video.play() } } } } After compiling and running application, video plays choppy and on exiting application it puts this in log: 2011-06-07 11:13:44.055 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x10225ea60 of class NSCFNumber autoreleased with no pool in place - just leaking 2011-06-07 11:13:45.007 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x10264f030 of class __NSCFDate autoreleased with no pool in place - just leaking 2011-06-07 11:13:45.007 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x11a409000 of class NSCFTimer autoreleased with no pool in place - just leaking 2011-06-07 11:13:45.008 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x11a43e550 of class NSCFArray autoreleased with no pool in place - just leaking 2011-06-07 11:13:45.008 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x11a462560 of class __NSFastEnumerationEnumerator autoreleased with no pool in place - just leaking If any way to make it playing smoothly and to prevent memory?

    Read the article

  • Delphi - COM/OLE starting example needed

    - by durumdara
    Hi! 10 years have ellapsed since I used COM/OLE, and I forget 90% of them. Now we need to make a COM object to access some data from PHP/Python (this is specific thing, the php ODBC don't access the output params of a DataBase - like stored proc output), and my idea the I realize a minimal object with one method, and PHP/Python can call this to get the output... procedure ExecSQL(Config, IP, Port, DBName, SQL, IDFieldName : variant) : output output is [IDValue, ErrorMsg, HResult] Please help me a very little example, how to start it? I need only this, but I'm confused by many ActiveX/COM in the palette. What I need to use to make a simple COM DLL, and how to register my COM object with this DLL? Thanks: dd

    Read the article

  • How can I handle template dependencies in Template Toolkit?

    - by Smack my batch up
    My static web pages are built from a huge bunch of templates which are inter-included using Template Toolkit's "import" and "include", so page.html looks like this: [% INCLUDE top %] [% IMPORT middle %] Then top might have even more files included. I have very many of these files, and they have to be run through to create the web pages in various languages (English, French, etc., not computer languages). This is a very complicated process and when one file is updated I would like to be able to automatically remake only the necessary files, using a makefile or something similar. Are there any tools like makedepend for C files which can parse template toolkit templates and create a dependency list for use in a makefile? Or are there better ways to automate this process?

    Read the article

  • Read entire file in Scala?

    - by Brendan OConnor
    What's a simple and canonical way to read an entire file into memory in Scala? (Ideally, with control over character encoding.) The best I can come up with is: scala.io.Source.fromPath("file.txt").getLines.reduceLeft(_+_) or am I supposed to use one of Java's god-awful idioms, the best of which (without using an external library) seems to be: import java.util.Scanner import java.io.File new Scanner(new File("file.txt")).useDelimiter("\\Z").next() From reading mailing list discussions, it's not clear to me that scala.io.Source is even supposed to be the canonical I/O library. I don't understand what its intended purpose is, exactly. ... I'd like something dead-simple and easy to remember. For example, in these languages it's very hard to forget the idiom ... Ruby open("file.txt").read Ruby File.read("file.txt") Python open("file.txt").read()

    Read the article

  • Java: conditional initialization?

    - by HH
    Ruby has conditional initialization. Apparently, Java does not or does it? I try to write more succintly, to limit the range as small as possible. import java.io.*; import java.util.*; public class InitFor{ public static void main(String[] args){ for(int i=7,k=999;i+((String h="hello").size())<10;i++){} System.out.println("It should be: hello = "+h); } } Errors Press ENTER or type command to continue InitFor.java:8: ')' expected for(int i=7,k=999;i+((String h="hello").size())<10;i++){} ^

    Read the article

  • Places to start for system programmer transitioning to web programming

    - by Sean Ochoa
    So here's where I'm coming from: My background is in C#, C++, VB Script, php, javascript, PowerShell, T-SQL, and VB 6. I have some experience with python, and a brief introduction to Ruby On Rails. At work, we're transitioning to a web based UI in the next year or so, but in asp.net & SilverLight. I would like to, if possible, learn more open source web technologies on the side. And, hopefully, in a year and a half or so, I would like to transition to a more open source web technology position. I found that I do really like python, but I'm open to pretty much anything. And yes, I do know Linux (ubuntu and gentoo), as well. And, here's my question: What technologies, frameworks, IDEs, or systems should I be highly proficient in to become a prime candidate for a position doing web application development using non-Microsoft technologies?

    Read the article

< Previous Page | 560 561 562 563 564 565 566 567 568 569 570 571  | Next Page >