Search Results

Search found 55552 results on 2223 pages for 'system variable'.

Page 575/2223 | < Previous Page | 571 572 573 574 575 576 577 578 579 580 581 582  | Next Page >

  • what the true nature of @ in Transct-SQL

    - by Richard77
    Hello, I reading some old ScottGu's blogs on Linq2SQL. Now I'm doing the SPROC part. I'd like to know what's the exact meaning of @variable. See this from ScottGu's Blog ALTER PROCEDURE dbo.GetCustomersDetails ( @customerID nchar(5), @companyName nvarchar(40) output ) AS SELECT @companyName = CompanyName FROM Customers WHERE CustomerID = @customerID SELECT * FROM Orders WHERE CustomerID = @customerID ORDER BY OrderID I'm kind of lost as, so far, I've though of anything preceded by a '@' as a placeholder for user input. But, in the example above, it looks like '@companyName' is used as a regular variable like in C# for instance (SELECT @companyName = ...). But, @companyName is not known yet. So, what the true nature a something preceded by a '@' like above? a vriable? a simple placeholder to accommodate user entered value? Thanks for helping

    Read the article

  • Doing extra initialisations on a MFC Dialog in Visual Studio 2008 Pro

    - by theunanonim
    How do I make extra initializations on a modal dialog before calling DoModal(); ? I have a main Dialog (the one that is created automatically when I select new MFC Application in Visual Studio 2008 Professional). When I click a button on this dialog I want to open another dialog and set a CString value into a CEdit control. my code: ... void OnClickedButtonX(){ SecondDialogClass Dlg2; Dlg2.asocVar2Cedit.SetWindowTextW(L"my text"); Dlg2.DoModal(); } //asocVar2Cedit is the associeted control variable to the //CEdit control on the second Dialog (Right Click > Add Variable.. in VSC++) ... this code generates a "Debug Assertion" error in winocc... Any ideas ? Thank you in advance.

    Read the article

  • Problem regarding listShuttle component in richFaces ?

    - by Hari
    I am a newbee for Richfaces components, When i am using the <rich:listShuttle> the Arraylist specified in the targetValue is now getting updated with the latest data? Kindly help MyJSF File <a4j:region> <rich:listShuttle sourceValue="#{bean.selectItems}" id="one" targetValue="#{bean.selectItemsone}" var="items" listsHeight="150" sourceListWidth="130" targetListWidth="130" sourceCaptionLabel="Intial Items" targetCaptionLabel="Selected Items" converter="Listconverter"> <rich:column> <h:outputText value="#{items.value}"></h:outputText> </rich:column> </rich:listShuttle> </a4j:region> <a4j:region> <a4j:commandButton value="Submit" action="#{bean.action}" /> </a4j:region> My Managed Bean enter code here private List<String> selectedData; private List<BeanItems> selectItems; private List<BeanItems> selectItemsone; public String action() { System.out.println(selectItems); System.out.println(selectItemsone); System.out.println("Select Item List"); Iterator<BeanItems> iterator = selectItems.iterator(); while (iterator.hasNext()) { BeanItems item = (BeanItems) iterator.next(); System.out.println(item.getValue()); } System.out.println("/nSelect Item one list "); Iterator<BeanItems> iterator2 = selectItemsone.iterator(); while (iterator2.hasNext()) { BeanItems item = (BeanItems) iterator2.next(); System.out.println(item.getValue()); } return ""; } public void setSelectedData(List<String> selectedData) { this.selectedData = selectedData; } public List<String> getSelectedData() { return selectedData; } /** * @return the selectItems */ public List<BeanItems> getSelectItems() { if (selectItems == null) { selectItems = new ArrayList<BeanItems>(); selectItems.add(new BeanItems("value4", "label4")); selectItems.add(new BeanItems("value5", "label5")); selectItems.add(new BeanItems("value6", "label6")); selectItems.add(new BeanItems("value7", "label7")); selectItems.add(new BeanItems("value8", "label8")); selectItems.add(new BeanItems("value9", "label9")); selectItems.add(new BeanItems("value10", "label10")); } return selectItems; } /** * @return the selectItemsone */ public List<BeanItems> getSelectItemsone() { if (selectItemsone == null) { selectItemsone = new ArrayList<BeanItems>(); selectItemsone.add(new BeanItems("value1", "label1")); selectItemsone.add(new BeanItems("value2", "label2")); selectItemsone.add(new BeanItems("value3", "label3")); } return selectItemsone; } My Converter Class enter code here public Object getAsObject(FacesContext context, UIComponent component,String value) { int index = value.indexOf(':'); return new BeanItems(value.substring(0, index), value.substring(index + 1)); } public String getAsString(FacesContext context, UIComponent component,Object value) { BeanItems beanItems = (BeanItems) value; return beanItems.getValue() + ":" + beanItems.getData(); } My BeanItems Class enter code here private String data; //Getter & setter private String value; //Getter & setter public BeanItems() { } public BeanItems(String value, String data) { this.value = value; this.data = data; } public int hashCode() { final int prime = 31; int result = 1; result = prime * result + ((data == null) ? 0 : data.hashCode()); result = prime * result + ((value == null) ? 0 : value.hashCode()); return result; } public boolean equals(Object obj) { if (this == obj) return true; if (obj == null) return false; if (getClass() != obj.getClass()) return false; final BeanItems other = (BeanItems) obj; if (data == null) { if (other.data != null) return false; } else if (!data.equals(other.data)) return false; if (value == null) { if (other.value != null) return false; } else if (!value.equals(other.value)) return false; return true; }

    Read the article

  • C++ 'mutable' keyword

    - by Rob
    A while ago I came across some code that marked a member variable of a class with the 'mutable' keyword. As far as I can see it simply allows you to modify a variable in a 'const' method: class Foo { private: mutable bool done_; public: void doSomething() const { ...; done_ = true; } }; Is this the only use of this keyword or is there more to it than meets the eye? I have since used this technique in a class, marking a boost::mutex as mutable allowing const functions to lock it for thread-safety reasons, but, to be honest, it feels like a bit of a hack.

    Read the article

  • building mono from svn - android target

    - by Jeremy Bell
    There were patches made to mono on trunk svn to support android. My understanding is that essentially instead of Koush's system which builds mono using the android NDK build system directly, these patches add support for the android NDK using the regular mono configure.sh process. I'd like to play around with this patch, but not being an expert in the mono build system, I have no idea how to tell it to target the android NDK, or even where to look. I've been able to build mono from SVN using the default target (linux) on Ubuntu, but no documentation on how to target android was given with the patches. Since anyone not submitting or reviewing a patch is generally ignored on the mono mailing list, I figured I'd post the question here.

    Read the article

  • NDepend: How to not display 'tier' assemblies in dependency graph?

    - by Edward Buatois
    I was able to do this in an earlier version of nDepend by going to tools-options and setting which assemblies would be part of the analysis (and ignore the rest). The latest version of the trial version of nDepend lets me set it, but it seems to ignore the setting and always analyze all assemblies whether I want it to or not. I tried to delete the "tier" assemblies by moving them over to the "application assemblies" list, but when I delete them out of there, they just get added back to the "tier" list, which I can't ignore. I don't want my dependency graph to contain assemblies like "system," "system.xml," and "system.serialization!" I want only MY assemblies in the dependency graph! Or is that a paid-version feature now? Is there a way to do what I'm talking about?

    Read the article

  • Problem with running c# application on another PC

    - by draghia-aurelian
    I wrote a Windows Form Application in C# and it works well for my computer. But on another PC, an error occurs when i try to do some stuff. code 1 private void rUNToolStripMenuItem_Click(object sender, EventArgs e) { MessageBox.Show("I'm in rUNToolStripMenuItem_Click!"); ... } code 2 private void dataPositionToolStripMenuItem_Click(object sender, EventArgs e) { MessageBox.Show("I'm in dataPositionToolStripMenuItem_Click!"); ... } Running on my computer: code1: MessageBox appears! code2: MessageBox appears! Running on another computer: code1: MessageBox doesn't appear and the error happens! code2: MessageBox appears! The error is: Method not found: "Void Microsoft.CSharp.RuntimeBinder.CSharpGetMemberBider..ctor(System.String.System.Type, System.Collections.Generic.IEnumerable'1)'. This is the PrintScreen with error: Please help me to solve the problem!

    Read the article

  • missing entry in launchctl after restart

    - by Nobik
    I have a deamon which is registered with launchctl to run as system-wide-daemon and to load automatically with every system startup or if the daemon crashes. I have registered this daemon with: sudo launchctl load -w /Library/LaunchDaemons/plist.file Everything works fine. My daemon is registered and with sudo launchctl list I can find the entry at launchctl But on some Macs after the user restarts the system, my daemon is not running. And with the command sudo launchctl list I can't find the entry anymore. Any ideas, why the entry is missing???

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Make a Phone ring from BASH through a HUAWEI e220

    - by microspino
    Hello, I have a Debian Linux system with a HUAWEI e220 on /dev/ttyUSB0. I'd like to make It ring a generic GSM phone for just one time. I'm doing this because I'd like to build an embedded system that fires some special behavior by a single GSM phone ring. How can I do It? I've tried wvdial but I receive always a "NO CARRIER" answer when I try to send It an "ATDT XXX-phone-number-to-dial-XXX" command.

    Read the article

  • iphone build error that makes me want to buy a nail gun

    - by sol
    I'm just trying to build a simple update (which I have done before) for an iphone app, but now for some reason I'm getting this error. Can anyone tell me what it means? Command/Developer/Library/Xcode/Plug-ins/CoreBuildTasks.xcplugin/Contents/Resources/copyplist failed with exit code 127 sh: plutil: command not found Here are the Build Results: CopyPNGFile /Users/me/path/build/Dist-iphoneos/MyApp.app/img_000.png images/img_000.png cd /Users/me/ setenv COPY_COMMAND /Developer/Library/PrivateFrameworks/DevToolsCore.framework/Resources/pbxcp setenv PATH "/Developer/Platforms/iPhoneOS.platform/Developer/usr/bin:/Developer/usr/bin:/System/Library/Frameworks/JavaVM.frameworK/Versions/1.6/Home/" "/Developer/Platforms/iPhoneOS.platform/Developer/Library/Xcode/Plug-ins/iPhoneOS Build System Support.xcplugin/Contents/Resources/copypng" -compress "" /Users/path/images/img_000.png /Users/me/path/build/Dist-iphoneos/MyApp.app/img_000.png sh: dirname: command not found CopyPlistFile /Users/me/path/build/Dist-iphoneos/MyApp.app/Entitlements.plist Entitlements.plist cd /Users/me/ setenv PATH "/Developer/Platforms/iPhoneOS.platform/Developer/usr/bin:/Developer/usr/bin:/System/Library/Frameworks/JavaVM.frameworK/Versions/1.6/Home/" /Developer/Library/Xcode/Plug-ins/CoreBuildTasks.xcplugin/Contents/Resources/copyplist --convert binary1 Entitlements.plist --outdir /Users/me/path/build/Dist-iphoneos/MyApp.app sh: plutil: command not found

    Read the article

  • Enable access for assistive device programmatically

    - by Dheeraj
    Hi All, I want to enable Access for assistive devices in System Preferences programmatically. But Problem is that my application is not running as root user and i do not want my application to be as root user and also should not ask for any authentication in between. I want to tap all keyboard events globally. I am using CGEventTapCreate() for the same.In the documentation of CGEventTapCreate() API it is mentioned that, Event taps receive key up and key down events if one of the following conditions is true: The current process is running as the root user. Access for assistive devices is enabled. In Mac OS X v10.4 & later, you can enable this feature using System Preferences, Universal Access panel, Keyboard view. I tried manually by checking the Enable Access for assistive devices from System Preference and it gives me expected output. So is there any way to do the same via program without asking for authentication and also application is not running as root user? Thanks, Dheeraj.

    Read the article

  • SSH Advanced Logging

    - by Radek Šimko
    I've installed OpenSUSE on my server and want to set ssh to log every command, which is send to system over it. I've found this in my sshd_config: # Logging # obsoletes QuietMode and FascistLogging #SyslogFacility AUTH #LogLevel INFO I guess that both of those directives has to be uncommented, but I'd like to log every command, not only authorization (login/logout via SSH). I just want to know, if someone breaks into my system, what did he do.

    Read the article

  • What is the Worst Depiction of Computer Use in a Movie

    - by Robert Cartaino
    You know the type: "It's a Unix system. I know this" -- in Jurassic park where a computer-genius girl sees a computer and quickly takes over like a 3-D video game, flying through the file system to shut down the park. [video link to the scene] So what's your favorite movie gaff that shows Hollywood can be completely clueless when it comes to portraying technology?

    Read the article

  • A specific string format with a number and character together represeting a certain item

    - by sil3nt
    Hello there, I have a string which looks like this "a 3e,6s,1d,3g,22r,7c 3g,5r,9c 19.3", how do I go through it and extract the integers and assign them to its corresponding letter variable?. (i have integer variables d,r,e,g,s and c). The first letter in the string represents a function, "3e,6s,1d,3g,22r,7c" and "3g,5r,9c" are two separate containers . And the last decimal value represents a number which needs to be broken down into those variable numbers. my problem is extracting those integers with the letters after it and assigning them into there corresponding letter. and any number with a negative sign or a space in between the number and the letter is invalid. How on earth do i do this?

    Read the article

  • Linking IronPython to WPF

    - by DonnyD
    I just installed VS2010 and the great new IronPython Tools extension. Currently this extension doesn't yet generate event handlers in code upon double-clicking wpf visual controls. Is there anyone that can provide or point me to an example as to how to code wpf event handlers manually in python. I've had no luck finding any and I am new to visual studio. Upon generating a new ipython wpf project the auto-generated code is: import clr clr.AddReference('PresentationFramework') from System.Windows.Markup import XamlReader from System.Windows import Application from System.IO import FileStream, FileMode app = Application() app.Run(XamlReader.Load(FileStream('WpfApplication7.xaml', FileMode.Open))) and the XAML is: <Window xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" Title="WpfApplication7" Height="300" Width="300"> <Button>Click Me</Button> </Window> Any help would be appreciated.

    Read the article

  • How do I set up the Clojure classpath in Emacs after installing with ELPA?

    - by derefed
    I'm trying to add paths to my classpath in the Clojure REPL that I've set up in Emacs using ELPA. Apparently, this isn't the $CLASSPATH environment variable, but rather the swank-clojure-classpath variable that Swank sets up. Because I used ELPA to install Swank, Clojure, etc., there are a ton of .el files that take care of everything instead of my .emacs file. Unfortunately, I can't figure out how to change the classpath now. I've tried using (setq 'swank-clojure-extra-classpaths (list ...)) both before and after the ELPA stuff in my .emacs, and I've tried adding paths directly to swank-clojure-classpath in .emacs, .emacs.d/init.el, and .emacs.d/user/user.el, but nothing works. What I'm ultimately trying to do is to add both the current directory "." and the directory in which I keep my Clojure programs. I'm assuming swank-clojure-classpath is the thing I need to set here. Thanks for your help.

    Read the article

  • WxPython Incompatible With Snow Leopard?

    - by Alex
    Hello all, Recently I upgraded to Snow Leopard, and now I can't run programs built with wxPython. The errors I get are (from Eclipse + PyDev): import wx File "/var/tmp/wxWidgets/wxWidgets-13~231/2.6/DSTROOT/System/Library/Frameworks /Python.framework/Versions/2.6/Extras/lib/ python/wx-2.8-mac-unicode/wx/__init__.py", line 45, in <module> File "/var/tmp/wxWidgets/wxWidgets-13~231/2.6/DSTROOT /System/Library/Frameworks/Python.framework/Versions/2.6/Extras/lib /python/wx-2.8-mac-unicode/wx/_core.py", line 4, in <module> ImportError:/System/Library/Frameworks /Python.framework/Versions/2.6/Extras/lib/python /wx-2.8-mac-unicode/wx/_core_.so: no appropriate 64-bit architecture (see "man python" for running in 32-bit mode) I don't really understand them and would appreciate if you could help me to do so, also, if you do know what's going on, how can I go about fixing them? Maybe this has something to do with the fact that Snow Leopard is 64-bit? Thanks!!

    Read the article

  • In-memory Database in Excel

    - by user329174
    Hello, I am looking for a way to import a datatable from Access into an Excel variable and then run queries through this variable to speed up the process. I am trying to migrate from C# .NET where I read a data table from an access database into memory and then used LINQ to query this dataset. It is MUCH faster than how I have it currently coded in VBA where I must make lots of calls to the actual database, which is slow. I have seen the QueryTable mentioned, but it appears that this requires pasting the data into the excel sheet. I would like to keep everything in memory and minimize the interaction between the Excel Sheet and the VBA code as much as possible. I wish we didn't need to use Excel+VBA to do this, but we're kind of stuck with that for now. Thanks for the help!

    Read the article

  • Location of the fonts on the iPhone?

    - by Kyle
    I'm using the FreeType2 library in an iPhone project, and I'm trying to simply load a TTF file from the system, if possible. FT_Library library; FT_Face face; int error; error = FT_Init_FreeType( &library ); if ( error == 0 ) printf("Initialized FreeType2\r\n"); /* Prints */ error = FT_New_Face(library, "/System/Library/Fonts/Helvetica.ttf", 0, &face); if ( error == FT_Err_Cannot_Open_Resource ) printf("Font not found\r\n"); /* Prints */ That error seems to be for file not found. Is /System/Library/Fonts not the location of the fonts? Or, do iPhone apps simply not have any read access at all to that directory. Thanks!

    Read the article

  • What's wrong with this SQL Server query ?

    - by ClixNCash
    What's wrong this T-SQL query : Protected Sub Button1_Click(ByVal sender As Object, ByVal e As System.EventArgs) Handles Button1.Click Dim SQLData As New System.Data.SqlClient.SqlConnection("Data Source=.\SQLEXPRESS;AttachDbFilename=|DataDirectory|\Database.mdf;Integrated Security=True;User Instance=True") Dim cmdSelect As New System.Data.SqlClient.SqlCommand("SELECT COUNT(*) FROM Table1 WHERE Name ='" + TextBox1.Text + "'", SQLData) SQLData.Open() If cmdSelect.ExecuteScalar > 0 Then Label1.Text = "You have already voted this service" Return End If Dim con As New SqlConnection Dim cmd As New SqlCommand con.Open() cmd.Connection = con cmd.CommandText = "INSERT INTO Tabel1 (Name) VALUES('" & Trim(Label1.Text) & "')" cmd.ExecuteNonQuery() Label1.Text = "Thank You !" SQLData.Close() End Sub

    Read the article

  • Chrome won't start - Windows 7 x64 is complaining about compatibility

    - by WooYek
    Suddenly Chrome browser does not start, my Windows 7 x64 is complaining: The version of this file is not compatible with the version of Windows you’re running. Check your computer’s system information to see whether you need an x86 (32-bit) or x64 (64-bit) version of the program, and then contact the software publisher. Reinstalling did not help. The things that changed and I have noticed are system updates and Java update. Any ideas, what to do to resolve the issue or troubleshoot it?

    Read the article

  • Write a function that returns the longest palindrome in a given string. e.g "ccddcc" in the string "

    - by Learner
    I thought of a solution but it runs in O(n^2) time Algo 1: Steps: Its a brute force method Have 2 for loops for i = 1 to i less than array.length -1 for j=i+1 to j less than array.length This way you can get substring of every possible combination from the array Have a palindrome function which checks if a string is palindrome so for every substring (i,j) call this function, if it is a palindrome store it in a string variable If you find next palindrome substring and if it is greater than the current one, replace it with current one. Finally your string variable will have the answer Issues: 1. This algo runs in O(n^2) time. Algo 2: Reverse the string and store it in diferent array Now find the largest matching substring between both the array But this too runs in O(n^2) time Can you guys think of an algo which runs in a better time. If possible O(n) time

    Read the article

  • C# Winform : Deployment Problem after using DataRepeater of MS Visual Basics power pack

    - by Mohsan
    hi. Microsoft Visual Studio 2008 Service pack 1 comes with Visual Basic Powerpacks which has the DataRepeater control. I used this control in my c# winform application. in my system everything is running fine. now i copied the debug folder to other system which has only .Net Framework 3.5 SP1 installed. in this system is giving me error cannot load dependency Microsoft.VisualBasic.PowerPacks.dll even i set the Copy Local to "true" for "Microsoft.VisualBasic.dll" and "Microsoft.VisualBasic.PowerPacks.Vs.dll" please tell me how to solve this problem

    Read the article

  • [Flex Beginner question] String and value object

    - by James
    Hi all, In php we can assign a method name to a variable and then use that variable to call the method. For example: $image_create_func = 'ImageCreateFromGIF'; $newImage = $image_create_func($oldImage); But can we do this in Flex? In flex, I have the string public var key:String = "email" And I also have a value object searchTerm:SearchTermVO which has a public property "email" (searchTerm.email). Now I want to do searchTerm.email by doing something like in php: searchTerm.key but it's not possible. Can anybody help me with this plz? Thank you.

    Read the article

< Previous Page | 571 572 573 574 575 576 577 578 579 580 581 582  | Next Page >