Search Results

Search found 55552 results on 2223 pages for 'system variable'.

Page 579/2223 | < Previous Page | 575 576 577 578 579 580 581 582 583 584 585 586  | Next Page >

  • Send file by webservice

    - by phenevo
    Hi, I have webservice, wwith method: [WebMethod] public byte[] GetFile(string FName) { System.IO.FileStream fs1 = null; fs1 = System.IO.File.Open(FName, FileMode.Open, FileAccess.Read); byte[] b1 = new byte[fs1.Length]; fs1.Read(b1, 0, (int)fs1.Length); fs1.Close(); return b1; } and it works with small file like 1mb, but when it comes to photoshop's file (about 1,5gb) I get: System.OutOfMemoryException The idea is I have winforms application which get this file and saving it on local disc.

    Read the article

  • Difference of two 'uint'

    - by vanslly
    When you attempt to declare an unsigned variable in C#.NET with a value outside its value range it is flagged as a compiler error, but if you produce a negative value at runtime and assign it to that variable at runtime the value wraps. uint z = -1; // Will not compile uint a = 5; uint b = 6; uint c = a - b; // Will result in uint.MaxValue Is there a good reason why unsigned variables wrap in such a situation instead of throwing an exception? Thanks.

    Read the article

  • Sending the files (At least 11 files) from folder through web service to android app.

    - by Shashank_Itmaster
    Hello All, I stuck in middle of this situation,Please help me out. My question is that I want to send files (Total 11 PDF Files) to android app using web service. I tried it with below code.Main Class from which web service is created public class MultipleFilesImpl implements MultipleFiles { public FileData[] sendPDFs() { FileData fileData = null; // List<FileData> filesDetails = new ArrayList<FileData>(); File fileFolder = new File( "C:/eclipse/workspace/AIPWebService/src/pdfs/"); // File fileTwo = new File( // "C:/eclipse/workspace/AIPWebService/src/simple.pdf"); File sendFiles[] = fileFolder.listFiles(); // sendFiles[0] = fileOne; // sendFiles[1] = fileTwo; DataHandler handler = null; char[] readLine = null; byte[] data = null; int offset = 0; int numRead = 0; InputStream stream = null; FileOutputStream outputStream = null; FileData[] filesData = null; try { System.out.println("Web Service Called Successfully"); for (int i = 0; i < sendFiles.length; i++) { handler = new DataHandler(new FileDataSource(sendFiles[i])); fileData = new FileData(); data = new byte[(int) sendFiles[i].length()]; stream = handler.getInputStream(); while (offset < data.length && (numRead = stream.read(data, offset, data.length - offset)) >= 0) { offset += numRead; } readLine = Base64Coder.encode(data); offset = 0; numRead = 0; System.out.println("'Reading File............................"); System.out.println("\n"); System.out.println(readLine); System.out.println("Data Reading Successful"); fileData.setFileName(sendFiles[i].getName()); fileData.setFileData(String.valueOf(readLine)); readLine = null; System.out.println("Data from bean " + fileData.getFileData()); outputStream = new FileOutputStream("D:/" + sendFiles[i].getName()); outputStream.write(Base64Coder.decode(fileData.getFileData())); outputStream.flush(); outputStream.close(); stream.close(); // FileData fileDetails = new FileData(); // fileDetails = fileData; // filesDetails.add(fileData); filesData = new FileData[(int) sendFiles[i].length()]; } // return fileData; } catch (FileNotFoundException e) { e.printStackTrace(); } catch (IOException e) { e.printStackTrace(); } catch (Exception e) { e.printStackTrace(); } return filesData; } } Also The Interface MultipleFiles:- public interface MultipleFiles extends Remote { public FileData[] sendPDFs() throws FileNotFoundException, IOException, Exception; } Here I am sending an array of bean "File Data",having properties viz. FileData & FileName. FileData- contains file data in encoded. FileName- encoded file name. The Bean:- (FileData) public class FileData { private String fileName; private String fileData; public String getFileName() { return fileName; } public void setFileName(String fileName) { this.fileName = fileName; } public String getFileData() { return fileData; } public void setFileData(String string) { this.fileData = string; } } The android DDMS gives out of memory exception when tried below code & when i tried to send two files then only first file is created. public class PDFActivity extends Activity { private final String METHOD_NAME = "sendPDFs"; private final String NAMESPACE = "http://webservice.uks.com/"; private final String SOAP_ACTION = NAMESPACE + METHOD_NAME; private final String URL = "http://192.168.1.123:8080/AIPWebService/services/MultipleFilesImpl"; /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); TextView textViewOne = (TextView) findViewById(R.id.textViewOne); try { SoapObject soapObject = new SoapObject(NAMESPACE, METHOD_NAME); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope( SoapEnvelope.VER11); envelope.setOutputSoapObject(soapObject); textViewOne.setText("Web Service Started"); AndroidHttpTransport httpTransport = new AndroidHttpTransport(URL); httpTransport.call(SOAP_ACTION, envelope); // SoapObject result = (SoapObject) envelope.getResponse(); Object result = envelope.getResponse(); Log.i("Result", result.toString()); // String fileName = result.getProperty("fileName").toString(); // String fileData = result.getProperty("fileData").toString(); // Log.i("File Name", fileName); // Log.i("File Data", fileData); // File pdfFile = new File(fileName); // FileOutputStream outputStream = // openFileOutput(pdfFile.toString(), // MODE_PRIVATE); // outputStream.write(Base64Coder.decode(fileData)); Log.i("File", "File Created"); // textViewTwo.setText(result); // Object result = envelope.getResponse(); // FileOutputStream outputStream = openFileOutput(name, mode) } catch (Exception e) { e.printStackTrace(); } } } Please help with some explanation or changes in my code. Thanks in Advance.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Bypassing "Found New Hardware Wizard" / Setting Windows to Install Drivers Automatically

    - by Synetech inc.
    Hi, My motherboard finally died after the better part of a decade, so I bought a used system. I put my old hard-drive and sound-card in the new system, and connected my old keyboard and mouse (the rest of the components—CPU, RAM, mobo, video card—are from the new system). I knew beforehand that it would be a challenge to get Windows to boot and install drivers for the new hardware (particularly since the foundational components are new), but I am completely unable to even attempt to get through the work of installing drivers for things like the video card because the keyboard and mouse won't work (they do work, in the BIOS screen, in DOS mode, in Windows 7, in XP's boot menu, etc., just not in Windows XP itself). Whenever I try to boot XP (in normal or safe mode), I get a bunch of balloons popping up for all the new hardware detected, and a New Hardware Found Wizard for Processor (obviously it has to install drivers for the lowest-level components on up). Unfortunately I cannot click Next since the keyboard and mouse won't work yet because the motherboard drivers (for the PS/2 or USB ports) are not yet installed. I even tried a serial mouse, but to no avail—again, it does work in DOS, 7, etc., but not XP because it doesn't have the serial port driver installed. I tried mounting the SOFTWARE and SYSTEM hives under Windows 7 in order to manually set the "unsigned drivers warning" to ignore (using both of the driver-signing policy settings that I found references to). That didn't work; I still get the wizard. They are not even fancy, proprietary, third-party, or unsigned drivers. They are drivers that come with Windows—as the drivers for CPU, RAM, IDE controller, etc. tend to be. And the keyboard and mouse drivers are the generic ones at that (but like I said, those are irrelevant since the drivers for the ports that they are connected to are not yet installed). Obviously at some point in time over the past several years, a setting got changed to make Windows always prompt me when it detects new hardware. (It was also configured to show the Shutdown Event Tracker on abnormal shutdowns, so I had to turn that off so that I could even see the desktop.) Oh, and I tried deleting all of the PNF files so that they get regenerated, but that too did not help. Does anyone know how I can reset Windows to at least try to automatically install drivers for new hardware before prompting me if it fails? Conversely, does anyone know how exactly one turns off automatic driver installation (and prompt with the wizard)? Thanks a lot.

    Read the article

  • How can I allow undefined options when parsing args with Getopt

    - by Ross Rogers
    If I have a command line like: my_script.pl -foo -WHATEVER My script knows about --foo, and I want Getopt to set variable $opt_foo, but I don't know anything about -WHATEVER. How can I tell Getopt to parse out the options that I've told it about, and then get the rest of the arguments in a string variable or a list. An example: use strict; use warnings; use Getopt::Long; my $foo; GetOptions('foo' => \$foo); print 'remaining options: ', @ARGV; Then, issuing perl getopttest.pl -foo -WHATEVER gives Unknown option: whatever remaining options:

    Read the article

  • EBS with RAID0 (striping) and restoring snapshots

    - by grourk
    We have a MySQL database on EC2 and are looking at the disk IO performance there. Currently we have a single EBS volume with XFS and take snapshots for backup. It seems that a lot of people have seen significant performance gains by striping across multiple EBS volumes with software RAID. If this is done, how does one take snapshots and ensure the consistency of the file system? It seems to me that restoring the file system from multiple snapshots could be tricky.

    Read the article

  • Lookahead regex produces unexpected group

    - by Ivan Yatskevich
    I'm trying to extract a page name and query string from a URL which should not contain .html Here is an example code in Java: public class TestRegex { public static void main(String[] args) { Pattern pattern = Pattern.compile("/test/(((?!\\.html).)+)\\?(.+)"); Matcher matcher = pattern.matcher("/test/page?param=value"); System.out.println(matcher.matches()); System.out.println(matcher.group(1)); System.out.println(matcher.group(2)); } } By running this code one can get the following output: true page e What's wrong with my regex so the second group contains the letter e instead of param=value?

    Read the article

  • Changing text depending on rounded total from database

    - by NeonBlue Bliss
    On a website I have a number of small PHP scripts to automate changes to the text of the site, depending on a figure that's calculated from a MySQL database. The site is for a fundraising group, and the text in question on the home page gives the total amount raised. The amount raised is pulled from the database and rounded to the nearest thousand. This is the PHP I use to round the figure and find the last three digits of the total: $query4 = mysql_query("SELECT SUM(amountraised) AS full_total FROM fundraisingtotal;"); $result4 = mysql_fetch_array($query4); $fulltotal = $result4["full_total"]; $num = $fulltotal + 30000; $ftotalr = round($num,-3); $roundnum = round($num); $string = $roundnum; $length = strlen($string); $characters = 3; $start = $length - $characters; $string = substr($string , $start ,$characters); $figure = $string; (£30,000 is the amount that had been raised by the previous fundraising team from when the project first started, which is why I've added 30000 to $fulltotal for the $num variable) Currently the text reads: the bookstall and other fundraising events have raised more than &pound;<? echo number_format($ftotalr); ?> I've just realised though that because the PHP is rounding to the nearest thousand, if the total's for example £39,200 and it's rounded to £40,000, to say it's more than £40,000 is incorrect, and in that case I'd need it to say 'almost £40,000' or something similar. I obviously need to replace the 'more than' with a variable. Obviously I need to test whether the last three digits of the total are nearer to 0 or 1000, so that if the total was for example £39,2000, the text would read 'just over', if it was between £39,250 and £39,400 something like 'over', between £39,400 and £39,700 something like 'well over', and between £39,700 and £39,999, 'almost.' I've managed to get the last three digits of the total as a variable, and I think I need some sort of an if/else/elseif code block (not sure if that would be the right approach, or whether to use case/break), and obviously I'm going to have to check whether the figure meets each of the criteria, but I can't figure out how to do that. Could anyone suggest what would be the best way to do this please?

    Read the article

  • How to increase Java heap space for a tomcat app

    - by Ankur
    There are lots of questions that ask this or a similar question. They all give the command that has to be executed, what I don't understand is where do I write this command. I want to permanently increase the heap space for my tomcat apps. I read this page http://javahowto.blogspot.com/2006/06/6-common-errors-in-setting-java-heap.html and it says under the Tomcat section Stop Tomcat server, set environment variable CATALINA_OPTS, and then restart Tomcat. Look at the file tomcat-install/bin/catalina.sh or catalina.bat for how this variable is used. For example, set CATALINA_OPTS=-Xms512m -Xmx512m (Windows, no "" around the value) export CATALINA_OPTS="-Xms512m -Xmx512m" (ksh/bash, "" around the value) setenv CATALINA_OPTS "-Xms512m -Xmx512m" (tcsh/csh, "" around the value) So I replaced the line set CATALINA_OPTS= with set CATALINA_OPTS=-Xms512m -Xmx512m But I still get the error.

    Read the article

  • Linq to SQL gives NotSupportedException when using local variables

    - by zwanz0r
    It appears to me that it matters whether you use a variable to temporary store an IQueryable or not. See the simplified example below: This works: List<string> jobNames = new List<string> { "ICT" }; var ictPeops = from p in dataContext.Persons where ( from j in dataContext.Jobs where jobNames.Contains(j.Name) select j.ID).Contains(p.JobID) select p; But when I use a variable to temporary store the subquery I get an exception: List<string> jobNames = new List<string> { "ICT" }; var jobs = from j in dataContext.Jobs where jobNames.Contains(j.Name) select j.ID; var ictPeops = from p in dataContext.Persons where jobs.Contains(p.JobID) select p; "System.NotSupportedException: Queries with local collections are not supported" I don't see what the problem is. Isn't this logic that is supposed to work in LINQ?

    Read the article

  • How to Programmatically Identify a PI Font (a Dingbat) under OS X

    - by Glenn Howes
    There is a class of fonts called Pi fonts whose glyphs, under OS X, get mapped to the private Unicode space 0xF021-0xF0FF such that if you subtract 0xF000 from each unicode character to retrieve the 8-bit version of the character and be able to draw that character as if it were a standard Roman character. My question is how do I recognize these fonts? It's obvious the system can do so because there is a category on the Special Characters palette called "Pi Fonts" which apparently has the various such fonts installed on my system. In my case they are BookshelSymbolSeven, MSReferenceSpeciality, MT-Extras, Marlett, MonotypeSorts, Webdings, and various Wingdings. If I use the old fashioned QuickDraw routines to ask for the TextEncoding of these fonts, I get a value of 0x20000 which I do not see in the system header file TextCommon.h. Am I supposed to treat any font with a TextEncoding of 0x20000 as a Pi Font? And I'd rather not use any QuickDraw font handling routines for obvious reasons.

    Read the article

  • Extracting init script from bult-in intrfs into Linux bzImage

    - by Maciej Piechotka
    I have following problem - I damaged my system (Gentoo - by rebuilding using gcc 4.5) beyond repair. I unmounted /home, copied /etc + other important files and I've started reinstalling system. However I forgot to copy init script. It is still present in kernel image that I have. How to extract it? Please note that initrd is not a separate file but is in the kernel image.

    Read the article

  • File private variables in PHP

    - by kayahr
    Is it possible to define private variables in a PHP script so these variables are only visible in this single PHP script and nowhere else? I want to have an include file which does something without polluting the global namespace. It must work with PHP 5.2 so PHP namespaces are not an option. And no OOP is used here so I'm not searching for private class members. I'm searching for "somewhat-global" variables which are global in the current script but nowhere else. In C I could do it with the static keyword but is there something similar in PHP? Here is a short example of a "common.php" script: $dir = dirname(__FILE__); set_include_path($dir . PATH_SEPARATOR . get_include_path()); // Do more stuff with the $dir variable When I include this file in some script then the $dir variable is visible in all other scripts as well and I don't want that. So how can I prevent this?

    Read the article

  • Debugging F# code and functional style

    - by Roger Alsing
    I'm new to funcctional programming and have some questions regarding coding style and debugging. I'm under the impression that one should avoid storing results from funcction calls in a temp variable and then return that variable e.g. let someFunc foo = let result = match foo with | x -> ... | y -> ... result And instead do it like this (I might be way off?): let someFunc foo = match foo with | x -> ... | y -> ... Which works fine from a functionallity perspective, but it makes it way harder to debug. I have no way to examine the result if the right hand side of - does some funky stuff. So how should I deal with this kind of scenarios?

    Read the article

  • Changing a limited user account in XP fails

    - by javamonkey79
    I have the following: using System; using System.DirectoryServices.AccountManagement; public class ChangePassword { public static void Main() { PrincipalContext context = new PrincipalContext(ContextType.Machine); UserPrincipal user = UserPrincipal.FindByIdentity(context, "someLimitedAccount"); user.ChangePassword( "xxx", "zzz" ); } } This works just fine with administrator accounts, but seems to crash like so when I try to change limited accounts in XP: Unhandled Exception: System.NullReferenceException: Object reference not set to an instance of an object. at ChangePassword.Main() Is what I am trying to do possible? If so, how? EDIT #1: I added the following: Console.WriteLine( "user: " + user ); Below this line: UserPrincipal user = UserPrincipal.FindByIdentity(context, "someLimitedAccount"); And I get this: user: It doesn't look like user is null when I print it, but then again I'm not really a .Net guy - I seem to remember this being expected behavior.

    Read the article

  • ASP.net error message when using REST starter kit

    - by jonhobbs
    Hi all, I've written some code using the REST starter kit and it works fine on my development machine. However, when I upload it to our server the page gives me the following error message... CS1684: Warning as Error: Reference to type 'System.Runtime.Serialization.Json.DataContractJsonSerializer' claims it is defined in 'c:\WINNT\assembly\GAC_MSIL\System.ServiceModel.Web\3.5.0.0__31bf3856ad364e35\System.ServiceModel.Web.dll', but it could not be found I've removed code line by line and it appears that the following line of code is triggering the error... HttpContent newOrganizationContent = HttpContentExtensions.CreateXmlSerializable(newOrganizationXml); Really haven't got a clue how to fix it. I assumed it might be because it needs a newer version of the framework to run, but looking in IIS it says it's running version 2.0.50727 which I think is the lates version because it says that even when we're using framework 3.5 Very confused, any ideas? Jon

    Read the article

  • How to implement an EventHandler to update controls

    - by Bill
    May I ask for help with the following? I am attempting to connect and control three pieces of household electronic equipment by computer through a GlobalCache GC-100 and iTach. As you will see in the following code, I created a class-instance of GlobalCacheAdapter that communicates with each piece of equipment. Although the code seems to work well in controlling the equipment, I am having trouble updating controls with the feedback from the equipment. The procedure "ReaderThreadProc" captures the feedback; however I don't know how to update the associated TextBox with the feedback. I believe that I need to create an EventHandler to notify the TextBox of the available update; however I am uncertain as to how an EventHandler like this would be implemented. Any help wold be greatly appreciated. using System; using System.IO; using System.Net; using System.Net.Sockets; using System.Threading; using System.Windows.Forms; namespace WindowsFormsApplication1 { public partial class Form1 : Form { // Create three new instances of GlobalCacheAdaptor and connect. // GC-100 (Elan) 192.168.1.70 4998 // GC-100 (TuneSuite) 192.168.1.70 5000 // GC iTach (Lighting) 192.168.1.71 4999 private GlobalCacheAdaptor elanGlobalCacheAdaptor; private GlobalCacheAdaptor tuneSuiteGlobalCacheAdaptor; private GlobalCacheAdaptor lutronGlobalCacheAdaptor; public Form1() { InitializeComponent(); elanGlobalCacheAdaptor = new GlobalCacheAdaptor(); elanGlobalCacheAdaptor.ConnectToDevice(IPAddress.Parse("192.168.1.70"), 4998); tuneSuiteGlobalCacheAdaptor = new GlobalCacheAdaptor(); tuneSuiteGlobalCacheAdaptor.ConnectToDevice(IPAddress.Parse("192.168.1.70"), 5000); lutronGlobalCacheAdaptor = new GlobalCacheAdaptor(); lutronGlobalCacheAdaptor.ConnectToDevice(IPAddress.Parse("192.168.1.71"), 4999); elanTextBox.Text = elanGlobalCacheAdaptor._line; tuneSuiteTextBox.Text = tuneSuiteGlobalCacheAdaptor._line; lutronTextBox.Text = lutronGlobalCacheAdaptor._line; } private void btnZoneOnOff_Click(object sender, EventArgs e) { elanGlobalCacheAdaptor.SendMessage("sendir,4:3,1,40000,4,1,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,800" + Environment.NewLine); } private void btnSourceInput1_Click(object sender, EventArgs e) { elanGlobalCacheAdaptor.SendMessage("sendir,4:3,1,40000,1,1,20,179,20,179,20,179,20,179,20,179,20,179,20,179,20,278,20,179,20,179,20,179,20,780" + Environment.NewLine); } private void btnSystemOff_Click(object sender, EventArgs e) { elanGlobalCacheAdaptor.SendMessage("sendir,4:3,1,40000,1,1,20,184,20,184,20,184,20,184,20,184,20,286,20,286,20,286,20,184,20,184,20,184,20,820" + Environment.NewLine); } private void btnLightOff_Click(object sender, EventArgs e) { lutronGlobalCacheAdaptor.SendMessage("sdl,14,0,0,S2\x0d"); } private void btnLightOn_Click(object sender, EventArgs e) { lutronGlobalCacheAdaptor.SendMessage("sdl,14,100,0,S2\x0d"); } private void btnChannel31_Click(object sender, EventArgs e) { tuneSuiteGlobalCacheAdaptor.SendMessage("\xB8\x4D\xB5\x33\x31\x00\x30\x21\xB8\x0D"); } private void btnChannel30_Click(object sender, EventArgs e) { tuneSuiteGlobalCacheAdaptor.SendMessage("\xB8\x4D\xB5\x33\x30\x00\x30\x21\xB8\x0D"); } } } public class GlobalCacheAdaptor { public Socket _multicastListener; public string _preferredDeviceID; public IPAddress _deviceAddress; public Socket _deviceSocket; public StreamWriter _deviceWriter; public bool _isConnected; public int _port; public IPAddress _address; public string _line; public GlobalCacheAdaptor() { } public static readonly GlobalCacheAdaptor Instance = new GlobalCacheAdaptor(); public bool IsListening { get { return _multicastListener != null; } } public GlobalCacheAdaptor ConnectToDevice(IPAddress address, int port) { if (_deviceSocket != null) _deviceSocket.Close(); try { _port = port; _address = address; _deviceSocket = new Socket(AddressFamily.InterNetwork, SocketType.Stream, ProtocolType.Tcp); _deviceSocket.Connect(new IPEndPoint(address, port)); ; _deviceAddress = address; var stream = new NetworkStream(_deviceSocket); var reader = new StreamReader(stream); var writer = new StreamWriter(stream) { NewLine = "\r", AutoFlush = true }; _deviceWriter = writer; writer.WriteLine("getdevices"); var readerThread = new Thread(ReaderThreadProc) { IsBackground = true }; readerThread.Start(reader); _isConnected = true; return Instance; } catch { DisconnectFromDevice(); MessageBox.Show("ConnectToDevice Error."); throw; } } public void SendMessage(string message) { try { var stream = new NetworkStream(_deviceSocket); var reader = new StreamReader(stream); var writer = new StreamWriter(stream) { NewLine = "\r", AutoFlush = true }; _deviceWriter = writer; writer.WriteLine(message); var readerThread = new Thread(ReaderThreadProc) { IsBackground = true }; readerThread.Start(reader); } catch { MessageBox.Show("SendMessage() Error."); } } public void DisconnectFromDevice() { if (_deviceSocket != null) { try { _deviceSocket.Close(); _isConnected = false; } catch { MessageBox.Show("DisconnectFromDevice Error."); } _deviceSocket = null; } _deviceWriter = null; _deviceAddress = null; } private void ReaderThreadProc(object state) { var reader = (StreamReader)state; try { while (true) { var line = reader.ReadLine(); if (line == null) break; _line = _line + line + Environment.NewLine; } // Need to create EventHandler to notify the TextBoxes to update with _line } catch { MessageBox.Show("ReaderThreadProc Error."); } } }

    Read the article

  • Core dump utility for .NET

    - by Dave
    In my past life as a COBOL mainframe developer I made extensive use of a tool called Abendaid which, in the event of an exception, would give me a complete memory dump including a formatted list of every variable in memory as well as a complete stack trace of the program with the offending statement highlighted. This made pinpointing the cause of an error much simpler and saved a lot of step-through debugging and/or trace statements. Now I've made the transition to C# and .NET web development I find that the information provided by ASP.NET only tells half the story, giving me a stack trace, but not any of the variable or class information. This makes debugging more difficult as you then have to run the process again with the debugger to try and reproduce the error, not easy with intermittent errors or with assemblies that run under the likes of SQL Server or CRM. I've looked around quite a lot for something that does this but I can't find anything obvious. Does anyone have any idea if there is one, or if not, what I'd need to start with in order to write one?

    Read the article

  • How to grant su access to wheel without asking for password on FreeBSD?

    - by cstamas
    I would like to grant users of the wheel group (other sysadmins) su access without being asked for password. I know how to do it with pam in linux, but the question now is for FreeBSD. I am not familiar with the syntax for FreeBSD's PAM subsystem. What shall I enter in /etc/pam.d/su instead of the default: auth sufficient pam_rootok.so no_warn auth sufficient pam_self.so no_warn auth requisite pam_group.so no_warn group=wheel root_only fail_safe ruser auth include system # account account include system # session session required pam_permit.so

    Read the article

  • Using java.util.logging, is it possible to restart logs after a certain period of time?

    - by Fry
    I have some java code that will be running as an importer for data for a much larger project. The initial logging code was done with the java.util.logging classes, so I'd like to keep it if possible, but it seems to be a little inadequate now given he amount of data passing through the importer. Often times in the system, the importer will get data that the main system doesn't have information for or doesn't match the system's data so it is ignored but a message is written to the log about what information was dropped and why it wasn't imported. The problem is that this tends to grow in size very quickly, so we'd like to be able to start a fresh log daily or weekly. Does anybody have an idea if this can be done in the logging classes or would I have to switch to log4j or custom? Thanks for any help!

    Read the article

  • Passing Byte (VB.NET)

    - by yae
    Hi I need to pass encoded string to php page. To convert string to iso: Dim result As Byte() = Encoding.Convert(Encoding.UTF8, Encoding.GetEncoding("iso-8859-1"), input) I have this code to pass string, but how I must do it to pass Byte (variable result) instead of the string (variable MyVarString)? Dim client As WebClient Dim data As Stream Dim reader As StreamReader Dim baseurl As String baseurl = "http://example.com/api/mypage2.php" client = New WebClient client.Headers.Add("user-agent", "Mozilla/4.0 (compatible; MSIE 6.0; Windows NT 5.2; .NET CLR 1.0.3705;)") client.QueryString.Add("mensaje", MyVarString) data = client.OpenRead(baseurl) reader = New StreamReader(data) s = reader.ReadToEnd() data.Close() reader.Close() Etc.

    Read the article

  • A specific string format with a number and character together represeting a certain item

    - by sil3nt
    Hello there, I have a string which looks like this "a 3e,6s,1d,3g,22r,7c 3g,5r,9c 19.3", how do I go through it and extract the integers and assign them to its corresponding letter variable?. (i have integer variables d,r,e,g,s and c). The first letter in the string represents a function, "3e,6s,1d,3g,22r,7c" and "3g,5r,9c" are two separate containers . And the last decimal value represents a number which needs to be broken down into those variable numbers. my problem is extracting those integers with the letters after it and assigning them into there corresponding letter. and any number with a negative sign or a space in between the number and the letter is invalid. How on earth do i do this?

    Read the article

< Previous Page | 575 576 577 578 579 580 581 582 583 584 585 586  | Next Page >