Search Results

Search found 40581 results on 1624 pages for 'mysql select db'.

Page 597/1624 | < Previous Page | 593 594 595 596 597 598 599 600 601 602 603 604  | Next Page >

  • Image Magick and Ghostscript

    - by user114671
    I mainly do web design but I host a few client sites on a Centos 5 VPS. A new client has asked me to host their site and I've been given the following configuration requirement: Apache 2.2.3 PHP 5.2.17 MySQL 5.0.77 Image Magick 6.5.1-0 (not as an Apache module) Ghostscript 8.7 Checking php_info() I have: Apache 2.2.3 PHP 5.2.14 MySQL 5.0.90 I don't have IM or GS listed. I expect that my versions of PHP and MySQL are similar enough to work, but how do I get my server set up to work with this client's site as well?

    Read the article

  • Major permission repair needed on Mac Os

    - by Luke1111
    I made the fatal error of copying and pasting a sudo command into my terminal without double checking it, here it is. sudo -R mysql / What this does (for those that don't know) is recursively change the owner every file from the root down to mysql!! obviously not what i was intending This has of course played havoc with my system, the first thing i did was the apple permission repair but that only works for files that it has an idea of though it has changed a lot of file ownerships back to root. It seems that many library files are still owned incorrectly, as a lot of problems don't work. What i propose doing as a temporary fix until i can reinstall mountain lion is to recursively set all ownerships that are mysql to Luke. I'm not sure what they should precisely but this is still better than nothing. Is this possible using a shell script? I realise that this won't fix the problem properly and i will have to reformat but i need the machine in a workable state just for this week.

    Read the article

  • zero downtime during database scheme upgrade on SQL 2008

    - by eject
    I have web application on IIS7 with SQL server 2008 as RDBMS. Need get 0 downtime during future upgrades of ASP.NET code and DB schema as well. I need to get right scenario for this. I have 2 web servers and 2 sql servers and one http load balancer whcih allows to switch web backend server for web requests. Main goal is to make 1st web server and DB server up and running, update code and db schema on 2nd server and then switch all the requests to 2nd server and then main problem - how to copy data from 1st database 2nd (which was changed during upgrade).

    Read the article

  • Can't access Terminal anymore, only shows a cursor

    - by user138304
    I run OS X. Following these directions (Installing MySQL on Mac OS X) I added a file to /usr and the contents were PATH=/usr/local/mysql/bin:$PATH Actually I was trying to get the mysql command to work now I cannot access terminal. All I get is a cursor but no command line. I also cannot find the file I created in the Finder. I used command shift G to find the folder /usr and the file is not there. Edit: I Solved the problem by restarting my computer. I am really not sure what the problem was. I got the idea because Could not open a new pseudo-tty. appeared in my terminal after following slhck directions to remove my .profile file. I then searched google and found this; http://blogs.oreilly.com/digitalmedia/2008/03/fixing-terminal-tty-errors.html. Thanks

    Read the article

  • startup cassandra layout

    - by davidkomer
    We've got a relatively low-traffic site (~1K pageviews/day) hosted on a single server, and expect it to grow significantly over the next few years. I'm thinking of moving over to Rackspace CloudServer or EC2 and firing up 3 nodes (all on CentOS): 2 x Web (Apache) - with loadbalancer 1 x MySQL (for the Wordpress powered part) The question is where to put Cassandra right now... Should it sit on each Web node, or the MySQL node? My thought right now is to put it on Web nodes. It's my understanding that Cassandra has the benefits of fault-tolerance (i.e. if we take a node down, the site is still operational). So even with only 2 nodes, we'd have that benefit as opposed to just putting it on the MySQL node. Also, as we scale up and add another node, a cassandra instance can come along with it and the php can always run its queries on localhost. Is this a good idea?

    Read the article

  • Percona system tables corrupted.

    - by Anand Jeyahar
    I am having problems setting up mysql replication with a percona as server. accidentally, took a full dump from mysql and restored it on percona and then started,the replication. now when i stop slave and start slave, i am getting the error "[ERROR] Failed to open the relay log './s5-bin.000003' (relay_log_pos 2029993) 110103 9:15:59 [ERROR] Could not find target log during relay log initialization " But show local variables shows the relay_log variable as set in the cnf file.. But the relay-log variable is set to slave-relay-bin alright. I am able to start mysql as a service. But mysqld_safe fails with error "110103 9:19:39 [ERROR] /usr/sbin/mysqld: Can't create/write to file '/var/run/mysqld/mysqld.pid' (Errcode: 2) 110103 9:19:39 [ERROR] Can't start server: can't create PID file: No such file or directory " Am now lost as to what is the problem.

    Read the article

  • How do you launch an SSH connection with port forwarding without interrupting your screen access?

    - by vfclists
    I want to make an SSH connection to another server with forwarding, but without having to log on to the remote server, nor interfere with the screen I am working on. I also need to access the connection to terminate it when I finish with it. eg. say I want to do a mysql backup on a remote server so I use the command ssh user@remote -L 1234:localhost:3306 but after issuing the password I want to run the mysql command in the session, but be able to access the SSH connection when I finish with mysql and terminate it. Is there some way this can be done?

    Read the article

  • Is allowing remote Sql Server Management Studio safe?

    - by dave thieben
    I administer a website that runs on IIS on one box, and SQL Server 2008 Workgroup on another box. typically I remote into the DB box and run SSMS to work on the db, but I would like to be able to access the db directly with SSMS on my local box. I've seen the other questions about allowing remote access to the database, but my question is, is this safe? I'm concerned that I'm opening a hole in the firewall and potential for hack attempts. Is this just a bad idea in general?

    Read the article

  • htaccess not found

    - by clarkk
    I have installed a Apache 2 (from webmin) server on Debian 6.. I have setup a virtual host db.domain.com on the server which works fine, but .htaccess doesn't work if you get access from the ip address and the directory is listed if no index.php is found? db.domain.com -> 403 forbidden xxx.xxx.xxx.xxx -> gets access to the server Why is .htaccess omitted when you get access from the servers ip address? httpd.conf <Directory *> Options -Indexes FollowSymLinks </Directory> <VirtualHost *:80> ServerName db.domain.com DocumentRoot /var/www </VirtualHost> htaccess order deny,allow deny from all

    Read the article

  • cPanel IPTables custom rules

    - by James Haigh
    Hi, I'm trying to allow a host access to port 3306 by IP. I've added the rule and ran an iptables-save and also service iptables save. These commands show as "OK" with no reported errors. And this works absolutely fine. Now, the server hasn't been restarted at all since I've been having this problem, but every day when I start developing on the server that needs mySQL access, it reports that the connection is refused. Back on the mySQL server, all I need to do is service iptables restart and everything then works as normal. The mySQL server is a CentOS cPanel VPS running on OpenVZ. Anyone know how I can make these rules persist? Is it something cPanel is doing overnight that is messing with my config? Thanks.

    Read the article

  • XAMPP on windows 7 not working

    - by 404Error
    Hey there, I just installed XAMPP lite on Windows 7. I have two drives - C: for the OS and regular files, and an external drive E:. I insatlled XAMPP lite on E: (on the root), and its been giving me problems. Apache works well enough, but MySQL doesn't work. When I go to http://localhost/phpmyadmin/, it gives me the following error: Error MySQL said: #2003 - Can't connect to MySQL server on 'localhost' (10061) Connection for controluser as defined in your configuration failed. Any ideas as to what could be the problem? I used the zip file for XAMPP lite, the 32 bit version. This is on Windows 7 Home premium. Thanks!

    Read the article

  • How to create launch icons on Ubuntu Desktop?

    - by MattSlay
    I installed Ubuntu in a VM using VirtualBox, and after a few hours of Googling all the things I had to install and configure for the rest of the environment, I am finally up and running with a Ruby on Rails IDE and have MySql up and running. After I start up the Ubuntu VM, I have to go to a terminal window and do this to start MySql: /etc/init.d/mysql start So that works fine, but, since I am such a GUI person, I’m wondering how I can create an icon on the Ubuntu Desktop that I can click on to launch this command. Can you tell me how to do that?

    Read the article

  • MS Access 2007 end user access

    - by LtDan
    I need some good advise. I have used Access for many years and I use Sharepoint but never the two combined. My newly created Access db needs to be shared with many users across the organization. The back end is SQL and the old way to distribute the database would be placing the db on a shared drive, connecting their PC ODBC connections to the SQL db and then they would open the database and have at it. This has become the OLD way. What is the best (and simpliest) way to allow the end users to utilize a frontend for data entry/edit reporting etc. Can I create a link through SharePoint and the user just open it from there. Your good advise is greatly approciated.

    Read the article

  • elastix cdr stop working

    - by dreddko
    CDR was working before 19 march. Unfortunately i dont remember what kind of changes i made to configuration, but this exactly not changes to CDR config. elastix 2.4.0 asterisk 11.7.0 mysql 5.0.95 elastix*CLI> cdr show status Call Detail Record (CDR) settings ---------------------------------- Logging: Disabled Mode: Simple /etc/asterisk/cdr.conf [general] enable=yes unanswered = yes /etc/asterisk/cdr_mysql.conf [global] hostname = localhost dbname=asteriskcdrdb password = *MYPASSWROD* user = asteriskcdruser userfield=1 ;port=3306 ;sock=/tmp/mysql.sock loguniqueid=yes mysql> SHOW GRANTS FOR 'asteriskcdruser'@'localhost'; +-----------------------------------------------------------------------------------------------+ | Grants for asteriskcdruser@localhost | +-----------------------------------------------------------------------------------------------+ | GRANT USAGE ON *.* TO 'asteriskcdruser'@'localhost' IDENTIFIED BY PASSWORD 'HASHHERE' | | GRANT ALL PRIVILEGES ON `asteriskcdrdb`.* TO 'asteriskcdruser'@'localhost' | +-----------------------------------------------------------------------------------------------+ 2 rows in set (0.00 sec)

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • centos server shared files

    - by Kyle Hudson
    Hi, I am wanting to implement a multi-server specialised hosting environment. I currently have a cloud solution comprising of 3 centos boxes (2 lamp web servers, 1 mysql). What I am wanting to do is, implement a 5 server solution where they is 3 web servers, 1 mysql box and a fileshare. Basically I want the fileshare to host all the web files for the servers, the caching will remain on the individual servers and the sessions will be stored in mysql. So what I am asking is how do I map the servers to share the same "docroot"? Is it NFS? if so whats the best way about doing this? Thanks in advance.

    Read the article

  • sql server: losing identity column on export/import

    - by Y.G.J
    Recently I started dealing with SQL Server, my previous experience was in MS-Access. When I'm doing an import/export of a db, from the server to my computer or even in the server, all column with primary key loose the key. Identity is set to false and even bit is not set to the default. How can I can I use an import/export job to make an exact copy of the db and its data? I don't want to have to perform a backup and restore every time I want the same db somewhere else, for another project, etc. I have read about "edit mapping" and the checkbox but that did not helped with the identity specification... and what about the primary key of the tables and the rest of the things?

    Read the article

  • Linux, PHP, and mysqlnd?

    - by bob-the-destroyer
    Looks like most common distros build their PHP packages without mysqlnd, instead relying on the old libmysql library. Are there any distros that do include the new mysql native driver even as an option in any of their officially supported repositories? If not, is it possible (and if so, how) to rebuild these three (mysql, mysqli, & pdo_mysql) extensions without having to rebuild the entire PHP install? In my case, there are several PHP functions I need that are available only if these Mysql extenstions are built against mysqlnd. So I'd be fine installing a new OS to get these if the OS offers and supports it.

    Read the article

  • RewriteMap syntax Regex

    - by ienabellamy
    in my .htaccess i've tons of directives, with same syntax: RewriteRule ^(.*)/PRODUCT_1.aspx http://www.site.com/product.php?id_product=2891 RewriteRule ^(.*)/PRODUCT_2.aspx http://www.site.com/product.php?id_product=2896 and everything works. Now, i created a RewriteMap in my because i need to increase velocity (20.000 redirect 301 in htaccess no good), so: RewriteEngine On RewriteMap redirects dbm=db:/var/www/html/presta152/prestashop/redirects.db RewriteCond ${redirects:$1} !="" RewriteRule ^(.*)$ ${redirects:$1} [redirect=permanent,last] and my redirects.db is created by redirects.txt, that contains: /PRODUCT_1.aspx http://www.site.com/product.php?id_product=2891 /PRODUCT_2.aspx http://www.site.com/product.php?id_product=2896 this works if i try to call for example: www.site.com/PRODUCT_1.aspx i'm redirected... but if i try to call www.site.com/everythingpossibileinside/PRODUCT_1.aspx the redirect doesn't work. So, in my .htaccess this rule: RewriteRule ^(.*)/PRODUCT_1.aspx http://www.site.com/product.php?id_product=2891 works, but in my RewriteMap no. I think i must change this directive: RewriteRule ^(.*)$ ${redirects:$1} [redirect=permanent,last] i tried, but unsuccessful. Thanks to all.

    Read the article

  • Two way replication

    - by Nidzaaaa
    I have a little problem... I have this case: -2 server instances -2 Databases -1 Table (5 columns) From server 1 I created publication to replicate all columns of table I have in 1. DB From server 2 I created subscription to pull all columns from table which is in server 1 DB But now, I need to publicate one columns of same table from server 2 to server 1 and also it has to be in same DB... I tried with using logic and creating publication for server 2 and subscription on server 1 but there is error appearing "You have selected the Publisher as a Subscriber and entered a subscription database that is the same as the publishing database. Select another subscription database." I hope someone understood my problem and have an answer for me, thanks in advance... p.s. Ask for more info if you need ...

    Read the article

  • Passing integer lists in a sql query, best practices

    - by Artiom Chilaru
    I'm currently looking at ways to pass lists of integers in a SQL query, and try to decide which of them is best in which situation, what are the benefots of each, and what are the pitfalls, what should be avoided :) Right now I know of 3 ways that we currently use in our application. 1) Table valued parameter: Create a new Table Valued Parameter in sql server: CREATE TYPE [dbo].[TVP_INT] AS TABLE( [ID] [int] NOT NULL ) Then run the query against it: using (var conn = new SqlConnection(DataContext.GetDefaultConnectionString)) { var comm = conn.CreateCommand(); comm.CommandType = CommandType.Text; comm.CommandText = @" UPDATE DA SET [tsLastImportAttempt] = CURRENT_TIMESTAMP FROM [Account] DA JOIN @values IDs ON DA.ID = IDs.ID"; comm.Parameters.Add(new SqlParameter("values", downloadResults.Select(d => d.ID).ToDataTable()) { TypeName = "TVP_INT" }); conn.Open(); comm.ExecuteScalar(); } The major disadvantages of this method is the fact that Linq doesn't support table valued params (if you create an SP with a TVP param, linq won't be able to run it) :( 2) Convert the list to Binary and use it in Linq! This is a bit better.. Create an SP, and you can run it within linq :) To do this, the SP will have an IMAGE parameter, and we'll be using a user defined function (udf) to convert this to a table.. We currently have implementations of this function written in C++ and in assembly, both have pretty much the same performance :) Basically, each integer is represented by 4 bytes, and passed to the SP. In .NET we have an extension method that convers an IEnumerable to a byte array The extension method: public static Byte[] ToBinary(this IEnumerable intList) { return ToBinaryEnum(intList).ToArray(); } private static IEnumerable<Byte> ToBinaryEnum(IEnumerable<Int32> intList) { IEnumerator<Int32> marker = intList.GetEnumerator(); while (marker.MoveNext()) { Byte[] result = BitConverter.GetBytes(marker.Current); Array.Reverse(result); foreach (byte b in result) yield return b; } } The SP: CREATE PROCEDURE [Accounts-UpdateImportAttempts] @values IMAGE AS BEGIN UPDATE DA SET [tsLastImportAttempt] = CURRENT_TIMESTAMP FROM [Account] DA JOIN dbo.udfIntegerArray(@values, 4) IDs ON DA.ID = IDs.Value4 END And we can use it by running the SP directly, or in any linq query we need using (var db = new DataContext()) { db.Accounts_UpdateImportAttempts(downloadResults.Select(d => d.ID).ToBinary()); // or var accounts = db.Accounts .Where(a => db.udfIntegerArray(downloadResults.Select(d => d.ID).ToBinary(), 4) .Select(i => i.Value4) .Contains(a.ID)); } This method has the benefit of using compiled queries in linq (which will have the same sql definition, and query plan, so will also be cached), and can be used in SPs as well. Both these methods are theoretically unlimited, so you can pass millions of ints at a time :) 3) The simple linq .Contains() It's a more simple approach, and is perfect in simple scenarios. But is of course limited by this. using (var db = new DataContext()) { var accounts = db.Accounts .Where(a => downloadResults.Select(d => d.ID).Contains(a.ID)); } The biggest drawback of this method is that each integer in the downloadResults variable will be passed as a separate int.. In this case, the query is limited by sql (max allowed parameters in a sql query, which is a couple of thousand, if I remember right). So I'd like to ask.. What do you think is the best of these, and what other methods and approaches have I missed?

    Read the article

  • Does anyone know how to appropriately deal with user timezones in rails 2.3?

    - by Amazing Jay
    We're building a rails app that needs to display dates (and more importantly, calculate them) in multiple timezones. Can anyone point me towards how to work with user timezones in rails 2.3(.5 or .8) The most inclusive article I've seen detailing how user time zones are supposed to work is here: http://wiki.rubyonrails.org/howtos/time-zones... although it is unclear when this was written or for what version of rails. Specifically it states that: "Time.zone - The time zone that is actually used for display purposes. This may be set manually to override config.time_zone on a per-request basis." Keys terms being "display purposes" and "per-request basis". Locally on my machine, this is true. However on production, neither are true. Setting Time.zone persists past the end of the request (to all subsequent requests) and also affects the way AR saves to the DB (basically treating any date as if it were already in UTC even when its not), thus saving completely inappropriate values. We run Ruby Enterprise Edition on production with passenger. If this is my problem, do we need to switch to JRuby or something else? To illustrate the problem I put the following actions in my ApplicationController right now: def test p_time = Time.now.utc s_time = Time.utc(p_time.year, p_time.month, p_time.day, p_time.hour) logger.error "TIME.ZONE" + Time.zone.inspect logger.error ENV['TZ'].inspect logger.error p_time.inspect logger.error s_time.inspect jl = JunkLead.create! jl.date_at = s_time logger.error s_time.inspect logger.error jl.date_at.inspect jl.save! logger.error s_time.inspect logger.error jl.date_at.inspect render :nothing => true, :status => 200 end def test2 Time.zone = 'Mountain Time (US & Canada)' logger.error "TIME.ZONE" + Time.zone.inspect logger.error ENV['TZ'].inspect render :nothing => true, :status => 200 end def test3 Time.zone = 'UTC' logger.error "TIME.ZONE" + Time.zone.inspect logger.error ENV['TZ'].inspect render :nothing => true, :status => 200 end and they yield the following: Processing ApplicationController#test (for 98.202.196.203 at 2010-12-24 22:15:50) [GET] TIME.ZONE#<ActiveSupport::TimeZone:0x2c57a68 @tzinfo=#<TZInfo::DataTimezone: Etc/UTC>, @name="UTC", @utc_offset=0> nil Fri Dec 24 22:15:50 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 22:00:00 UTC +00:00 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 22:00:00 UTC +00:00 Completed in 21ms (View: 0, DB: 4) | 200 OK [http://www.dealsthatmatter.com/test] Processing ApplicationController#test2 (for 98.202.196.203 at 2010-12-24 22:15:53) [GET] TIME.ZONE#<ActiveSupport::TimeZone:0x2c580a8 @tzinfo=#<TZInfo::DataTimezone: America/Denver>, @name="Mountain Time (US & Canada)", @utc_offset=-25200> nil Completed in 143ms (View: 1, DB: 3) | 200 OK [http://www.dealsthatmatter.com/test2] Processing ApplicationController#test (for 98.202.196.203 at 2010-12-24 22:15:59) [GET] TIME.ZONE#<ActiveSupport::TimeZone:0x2c580a8 @tzinfo=#<TZInfo::DataTimezone: America/Denver>, @name="Mountain Time (US & Canada)", @utc_offset=-25200> nil Fri Dec 24 22:15:59 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 15:00:00 MST -07:00 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 15:00:00 MST -07:00 Completed in 20ms (View: 0, DB: 4) | 200 OK [http://www.dealsthatmatter.com/test] Processing ApplicationController#test3 (for 98.202.196.203 at 2010-12-24 22:16:03) [GET] TIME.ZONE#<ActiveSupport::TimeZone:0x2c57a68 @tzinfo=#<TZInfo::DataTimezone: Etc/UTC>, @name="UTC", @utc_offset=0> nil Completed in 17ms (View: 0, DB: 2) | 200 OK [http://www.dealsthatmatter.com/test3] Processing ApplicationController#test (for 98.202.196.203 at 2010-12-24 22:16:04) [GET] TIME.ZONE#<ActiveSupport::TimeZone:0x2c57a68 @tzinfo=#<TZInfo::DataTimezone: Etc/UTC>, @name="UTC", @utc_offset=0> nil Fri Dec 24 22:16:05 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 22:00:00 UTC +00:00 Fri Dec 24 22:00:00 UTC 2010 Fri, 24 Dec 2010 22:00:00 UTC +00:00 Completed in 151ms (View: 0, DB: 4) | 200 OK [http://www.dealsthatmatter.com/test] It should be clear above that the 2nd call to /test shows Time.zone set to Mountain, even though it shouldn't. Additionally, checking the database reveals that the test action when run after test2 saved a JunkLead record with a date of 2010-12-22 15:00:00, which is clearly wrong.

    Read the article

  • Dropdownlist post in ASP.NET MVC3 and Entity Framework Model

    - by Josh Blade
    I have 3 tables: RateProfile RateProfileID ProfileName Rate RateID RateProfileID PanelID Other stuff to update Panel PanelID PanelName I have models for each of these. I have an edit page using the RateProfile model. I display the information for RateProfile and also all of the Rates associated with it. This works fine and I can update it fine. However, I also added a dropdown so that I can filter Rates by PanelID. I need it to post back on change so that it can display the filtered rates. I'm using @Html.DropDownList("PanelID", (SelectList)ViewData["PanelDropDown"], new { onchange = "$('#RateForm').submit()" }) for my dropdownlist. Whenever it posts back to my HttpPost Edit method though, it seems to be missing all information about the Rates navigation property. It's weird because I thought it would do exactly what the input/submit button that I have in the form does (which actually passes the entire model back to my HttpPost Edit action and does what I want it to do). The panelID is properly being passed to my HttpPost Edit method and on to the next view, but when I try to query the Model.Rates navigation property is null (only when the post comes from the dropdown. Everything works fine when the post comes from my submit input). Get Edit: public ActionResult Edit(int id, int panelID = 1) { RateProfile rateprofile = db.RateProfiles.Single(r => r.RateProfileID == id); var panels = db.Panels; ViewData["PanelDropDown"] = new SelectList(panels, "PanelID", "PanelName", panelID); ViewBag.PanelID = panelID; return View(rateprofile); } HttpPost Edit: [HttpPost] public ActionResult Edit(RateProfile rateprofile, int panelID) { var panels = db.Panels; ViewData["PanelDropDown"] = new SelectList(panels, "PanelID", "PanelName", panelID); ViewBag.PanelID = panelID; if (ModelState.IsValid) { db.Entry(rateprofile).State = EntityState.Modified; foreach (Rate dimerate in rateprofile.Rates) { db.Entry(dimerate).State = EntityState.Modified; } db.SaveChanges(); return View(rateprofile); } return View(rateprofile); } View: @model PDR.Models.RateProfile @using (Html.BeginForm(null,null,FormMethod.Post, new {id="RateForm"})) { <div> @Html.Label("Panel") @Html.DropDownList("PanelID", (SelectList)ViewData["PanelDropDown"], new { onchange = "$('#RateForm').submit()" }) </div> @{var rates= Model.Rates.Where(a => a.PanelID == ViewBag.PanelID).OrderBy(a => a.minCount).ToList();} @for (int i = 0; i < rates.Count; i++) { <tr> <td> @Html.HiddenFor(modelItem => rates[i].RateProfileID) @Html.HiddenFor(modelItem => rates[i].RateID) @Html.HiddenFor(modelItem => rates[i].PanelID) @Html.EditorFor(modelItem => rates[i].minCount) @Html.ValidationMessageFor(model => rates[i].minCount) </td> <td> @Html.EditorFor(modelItem => rates[i].maxCount) @Html.ValidationMessageFor(model => rates[i].maxCount) </td> <td> @Html.EditorFor(modelItem => rates[i].Amount) @Html.ValidationMessageFor(model => rates[i].Amount) </td> </tr> } <input type="submit" value="Save" /> } To summarize my problem, the below query in my view only works when the post comes from the submit button and not when it comes from my dropdownlist. @{var rates= Model.Rates.Where(a => a.PanelID == ViewBag.PanelID).OrderBy(a => a.minCount).ToList();}

    Read the article

  • CakePHP access indirectly related model - beginner's question

    - by user325077
    Hi everyone, I am writing a CakePHP application to log the work I do for various clients, but after trying for days I seem unable to get it to do what I want. I have read most of the book CakePHP's website. and googled for all I'm worth, so I presume I am missing something obvious! Every 'log item' belongs to a 'sub-project, which in turn belongs to a 'project', which in turn belongs to a 'sub-client' which finally belongs to a client. These are the 5 MySQL tables I am using: mysql> DESCRIBE log_items; +-----------------+--------------+------+-----+---------+----------------+ | Field | Type | Null | Key | Default | Extra | +-----------------+--------------+------+-----+---------+----------------+ | id | int(11) | NO | PRI | NULL | auto_increment | | date | date | NO | | NULL | | | time | time | NO | | NULL | | | time_spent | int(11) | NO | | NULL | | | sub_projects_id | int(11) | NO | MUL | NULL | | | title | varchar(100) | NO | | NULL | | | description | text | YES | | NULL | | | created | datetime | YES | | NULL | | | modified | datetime | YES | | NULL | | +-----------------+--------------+------+-----+---------+----------------+ mysql> DESCRIBE sub_projects; +-------------+--------------+------+-----+---------+----------------+ | Field | Type | Null | Key | Default | Extra | +-------------+--------------+------+-----+---------+----------------+ | id | int(11) | NO | PRI | NULL | auto_increment | | name | varchar(100) | NO | | NULL | | | projects_id | int(11) | NO | MUL | NULL | | | created | datetime | YES | | NULL | | | modified | datetime | YES | | NULL | | +-------------+--------------+------+-----+---------+----------------+ mysql> DESCRIBE projects; +----------------+--------------+------+-----+---------+----------------+ | Field | Type | Null | Key | Default | Extra | +----------------+--------------+------+-----+---------+----------------+ | id | int(11) | NO | PRI | NULL | auto_increment | | name | varchar(100) | NO | | NULL | | | sub_clients_id | int(11) | NO | MUL | NULL | | | created | datetime | YES | | NULL | | | modified | datetime | YES | | NULL | | +----------------+--------------+------+-----+---------+----------------+ mysql> DESCRIBE sub_clients; +------------+--------------+------+-----+---------+----------------+ | Field | Type | Null | Key | Default | Extra | +------------+--------------+------+-----+---------+----------------+ | id | int(11) | NO | PRI | NULL | auto_increment | | name | varchar(100) | NO | | NULL | | | clients_id | int(11) | NO | MUL | NULL | | | created | datetime | YES | | NULL | | | modified | datetime | YES | | NULL | | +------------+--------------+------+-----+---------+----------------+ mysql> DESCRIBE clients; +----------+--------------+------+-----+---------+----------------+ | Field | Type | Null | Key | Default | Extra | +----------+--------------+------+-----+---------+----------------+ | id | int(11) | NO | PRI | NULL | auto_increment | | name | varchar(100) | NO | | NULL | | | created | datetime | YES | | NULL | | | modified | datetime | YES | | NULL | | +----------+--------------+------+-----+---------+----------------+ I have set up the following associations in CakePHP: LogItem belongsTo SubProjects SubProject belongsTo Projects Project belongsTo SubClients SubClient belongsTo Clients Client hasMany SubClients SubClient hasMany Projects Project hasMany SubProjects SubProject hasMany LogItems Using 'cake bake' I have created the models, controllers (index, view add, edit and delete) and views, and things seem to function - as in I am able to perform simple CRUD operations successfully. The Question When editing a 'log item' at www.mydomain/log_items/edit I am presented with the view you would all suspect; namely the columns of the log_items table with the appropriate textfields/select boxes etc. I would also like to incorporate select boxes to choose the client, sub-client, project and sub-project in the 'log_items' edit view. Ideally the 'sub-client' select box should populate itself depending upon the 'client' chosen, the 'project' select box should also populate itself depending on the 'sub-client' selected etc, etc. I guess the way to go about populating the select boxes with relevant options is Ajax, but I am unsure of how to go about actually accessing a model from the child view of a indirectly related model, for example how to create a 'sub-client' select box in the 'log_items' edit view. I have have found this example: http://forum.phpsitesolutions.com/php-frameworks/cakephp/ajax-cakephp-dynamically-populate-html-select-dropdown-box-t29.html where someone achieves something similar for US states, counties and cities. However, I noticed in the database schema - which is downloadable from the site above link - that the database tables don't have any foreign keys, so now I'm wondering if I'm going about things in the correct manner. Any pointers and advice would be very much appreciated. Kind regards, Chris

    Read the article

  • SQL SERVER – Introduction to Extended Events – Finding Long Running Queries

    - by pinaldave
    The job of an SQL Consultant is very interesting as always. The month before, I was busy doing query optimization and performance tuning projects for our clients, and this month, I am busy delivering my performance in Microsoft SQL Server 2005/2008 Query Optimization and & Performance Tuning Course. I recently read white paper about Extended Event by SQL Server MVP Jonathan Kehayias. You can read the white paper here: Using SQL Server 2008 Extended Events. I also read another appealing chapter by Jonathan in the book, SQLAuthority Book Review – Professional SQL Server 2008 Internals and Troubleshooting. After reading these excellent notes by Jonathan, I decided to upgrade my course and include Extended Event as one of the modules. This week, I have delivered Extended Events session two times and attendees really liked the said course. They really think Extended Events is one of the most powerful tools available. Extended Events can do many things. I suggest that you read the white paper I mentioned to learn more about this tool. Instead of writing a long theory, I am going to write a very quick script for Extended Events. This event session captures all the longest running queries ever since the event session was started. One of the many advantages of the Extended Events is that it can be configured very easily and it is a robust method to collect necessary information in terms of troubleshooting. There are many targets where you can store the information, which include XML file target, which I really like. In the following Events, we are writing the details of the event at two locations: 1) Ringer Buffer; and 2) XML file. It is not necessary to write at both places, either of the two will do. -- Extended Event for finding *long running query* IF EXISTS(SELECT * FROM sys.server_event_sessions WHERE name='LongRunningQuery') DROP EVENT SESSION LongRunningQuery ON SERVER GO -- Create Event CREATE EVENT SESSION LongRunningQuery ON SERVER -- Add event to capture event ADD EVENT sqlserver.sql_statement_completed ( -- Add action - event property ACTION (sqlserver.sql_text, sqlserver.tsql_stack) -- Predicate - time 1000 milisecond WHERE sqlserver.sql_statement_completed.duration > 1000 ) -- Add target for capturing the data - XML File ADD TARGET package0.asynchronous_file_target( SET filename='c:\LongRunningQuery.xet', metadatafile='c:\LongRunningQuery.xem'), -- Add target for capturing the data - Ring Bugger ADD TARGET package0.ring_buffer (SET max_memory = 4096) WITH (max_dispatch_latency = 1 seconds) GO -- Enable Event ALTER EVENT SESSION LongRunningQuery ON SERVER STATE=START GO -- Run long query (longer than 1000 ms) SELECT * FROM AdventureWorks.Sales.SalesOrderDetail ORDER BY UnitPriceDiscount DESC GO -- Stop the event ALTER EVENT SESSION LongRunningQuery ON SERVER STATE=STOP GO -- Read the data from Ring Buffer SELECT CAST(dt.target_data AS XML) AS xmlLockData FROM sys.dm_xe_session_targets dt JOIN sys.dm_xe_sessions ds ON ds.Address = dt.event_session_address JOIN sys.server_event_sessions ss ON ds.Name = ss.Name WHERE dt.target_name = 'ring_buffer' AND ds.Name = 'LongRunningQuery' GO -- Read the data from XML File SELECT event_data_XML.value('(event/data[1])[1]','VARCHAR(100)') AS Database_ID, event_data_XML.value('(event/data[2])[1]','INT') AS OBJECT_ID, event_data_XML.value('(event/data[3])[1]','INT') AS object_type, event_data_XML.value('(event/data[4])[1]','INT') AS cpu, event_data_XML.value('(event/data[5])[1]','INT') AS duration, event_data_XML.value('(event/data[6])[1]','INT') AS reads, event_data_XML.value('(event/data[7])[1]','INT') AS writes, event_data_XML.value('(event/action[1])[1]','VARCHAR(512)') AS sql_text, event_data_XML.value('(event/action[2])[1]','VARCHAR(512)') AS tsql_stack, CAST(event_data_XML.value('(event/action[2])[1]','VARCHAR(512)') AS XML).value('(frame/@handle)[1]','VARCHAR(50)') AS handle FROM ( SELECT CAST(event_data AS XML) event_data_XML, * FROM sys.fn_xe_file_target_read_file ('c:\LongRunningQuery*.xet', 'c:\LongRunningQuery*.xem', NULL, NULL)) T GO -- Clean up. Drop the event DROP EVENT SESSION LongRunningQuery ON SERVER GO Just run the above query, afterwards you will find following result set. This result set contains the query that was running over 1000 ms. In our example, I used the XML file, and it does not reset when SQL services or computers restarts (if you are using DMV, it will reset when SQL services restarts). This event session can be very helpful for troubleshooting. Let me know if you want me to write more about Extended Events. I am totally fascinated with this feature, so I’m planning to acquire more knowledge about it so I can determine its other usages. Reference : Pinal Dave (http://blog.SQLAuthority.com) Filed under: Pinal Dave, SQL, SQL Authority, SQL Optimization, SQL Performance, SQL Query, SQL Scripts, SQL Server, SQL Tips and Tricks, SQL Training, SQLServer, T SQL, Technology Tagged: SQL Extended Events

    Read the article

< Previous Page | 593 594 595 596 597 598 599 600 601 602 603 604  | Next Page >