Search Results

Search found 3513 results on 141 pages for 'raw sockets'.

Page 65/141 | < Previous Page | 61 62 63 64 65 66 67 68 69 70 71 72  | Next Page >

  • Socket throughput on localhost?

    - by gct
    I've got an app that's using sockets to push data, and I'm currently testing it on my localhost (so that the sender and receiver are on the same computer). I'm seeing between 36 and 66MB/s of throughput, which seems somewhat slow to me. What are normal throughput ranges for binary data on a local socket connection?

    Read the article

  • Software to capture the packets in an MPEG Transport Stream

    - by Crippledsmurf
    I have a DVB-T capture card and would like to capture the packets from the MPEG stream it receives so i can analyse them just for a bit of fun and learning I've googled and found a lot of converters and software to capture the video from these streams but very little in the area of capturing raw data from a stream. What software exists that can capture and dump the MPEG stream from a tuner?

    Read the article

  • Why does 'localhost' in web references cause SocketExceptions?

    - by Sam
    I have two .net web services deployed to the same IIS server using SSL, one that references the other. If I set that web reference to 'localhost', some calls fail with this exception: System.Web.Services.Protocols.SoapException: Server was unable to process request. --- System.Net.WebException: Unable to connect to the remote server --- System.Net.Sockets.SocketException: No connection could be made because the target machine actively refused it If I set it to the actual machine name, it works. Why?

    Read the article

  • Stop duplicate icmp echo replies when bridging to a dummy interface?

    - by mbrownnyc
    I recently configured a bridge br0 with members as eth0 (real if) and dummy0 (dummy.ko if). When I ping this machine, I receive duplicate replies as: # ping SERVERA PING SERVERA.domain.local (192.168.100.115) 56(84) bytes of data. 64 bytes from SERVERA.domain.local (192.168.100.115): icmp_seq=1 ttl=62 time=113 ms 64 bytes from SERVERA.domain.local (192.168.100.115): icmp_seq=1 ttl=62 time=114 ms (DUP!) 64 bytes from SERVERA.domain.local (192.168.100.115): icmp_seq=2 ttl=62 time=113 ms 64 bytes from SERVERA.domain.local (192.168.100.115): icmp_seq=2 ttl=62 time=113 ms (DUP!) Using tcpdump on SERVERA, I was able to see icmp echo replies being sent from eth0 and br0 itself as follows (oddly two echo request packets arrive "from" my Windows box myhost): 23:19:05.324192 IP myhost.domain.local > SERVERA.domain.local: ICMP echo request, id 512, seq 43781, length 40 23:19:05.324212 IP SERVERA.domain.local > myhost.domain.local: ICMP echo reply, id 512, seq 43781, length 40 23:19:05.324217 IP myhost.domain.local > SERVERA.domain.local: ICMP echo request, id 512, seq 43781, length 40 23:19:05.324221 IP SERVERA.domain.local > myhost.domain.local: ICMP echo reply, id 512, seq 43781, length 40 23:19:05.324264 IP SERVERA.domain.local > myhost.domain.local: ICMP echo reply, id 512, seq 43781, length 40 23:19:05.324272 IP SERVERA.domain.local > myhost.domain.local: ICMP echo reply, id 512, seq 43781, length 40 It's worth noting, testing reveals that hosts on the same physical switch do not see DUP icmp echo responses (a host on the same VLAN on another switch does see a dup icmp echo response). I've read that this could be due to the ARP table of a switch, but I can't find any info directly related to bridges, just bonds. I have a feeling my problem lay in the stack on linux, not the switch, but am opened to any suggestions. The system is running centos6/el6 kernel 2.6.32-71.29.1.el6.i686. How do I stop ICMP echo replies from being sent in duplicate when dealing with a bridge interface/bridged interfaces? Thanks, Matt [edit] Quick note: It was recommended in #linux to: [08:53] == mbrownnyc [gateway/web/freenode/] has joined ##linux [08:57] <lkeijser> mbrownnyc: what happens if you set arp_ignore to 1 for the dummy interface? [08:59] <lkeijser> also set arp_announce to 2 for that interface [09:24] <mbrownnyc> lkeijser: I set arp_annouce to 2, arp_ignore to 2 in /etc/sysctl.conf and rebooted the machine... verifying that the bits are set after boot... the problem is still present I did this and came up empty. Same dup problem. I will be moving away from including the dummy interface in the bridge as: [09:31] == mbrownnyc [gateway/web/freenode/] has joined #Netfilter [09:31] <mbrownnyc> Hello all... I'm wondering, is it correct that even with an interface in PROMISC that the kernel will drop /some/ packets before they reach applications? [09:31] <whaffle> What would you make think so? [09:32] <mbrownnyc> I ask because I am receiving ICMP echo replies after configuring a bridge with a dummy interface in order for ipt_netflow to see all packets, only as reported in it's documentation: http://ipt-netflow.git.sourceforge.net/git/gitweb.cgi?p=ipt-netflow/ipt-netflow;a=blob;f=README.promisc [09:32] <mbrownnyc> but I do not know if PROMISC will do the same job [09:33] <mbrownnyc> I was referred here from #linux. any assistance is appreciated [09:33] <whaffle> The following conditions need to be met: PROMISC is enabled (bridges and applications like tcpdump will do this automatically, otherwise they won't function). [09:34] <whaffle> If an interface is part of a bridge, then all packets that enter the bridge should already be visible in the raw table. [09:35] <mbrownnyc> thanks whaffle PROMISC must be set manually for ipt_netflow to function, but [09:36] <whaffle> promisc does not need to be set manually, because the bridge will do it for you. [09:36] <whaffle> When you do not have a bridge, you can easily create one, thereby rendering any kernel patches moot. [09:36] <mbrownnyc> whaffle: I speak without the bridge [09:36] <whaffle> It is perfectly valid to have a "half-bridge" with only a single interface in it. [09:36] <mbrownnyc> whaffle: I am unfamiliar with the raw table, does this mean that PROMISC allows the raw table to be populated with packets the same as if the interface was part of a bridge? [09:37] <whaffle> Promisc mode will cause packets with {a dst MAC address that does not equal the interface's MAC address} to be delivered from the NIC into the kernel nevertheless. [09:37] <mbrownnyc> whaffle: I suppose I mean to clearly ask: what benefit would creating a bridge have over setting an interface PROMISC? [09:38] <mbrownnyc> whaffle: from your last answer I feel that the answer to my question is "none," is this correct? [09:39] <whaffle> Furthermore, the linux kernel itself has a check for {packets with a non-local MAC address}, so that packets that will not enter a bridge will be discarded as well, even in the face of PROMISC. [09:46] <mbrownnyc> whaffle: so, this last bit of information is quite clearly why I would need and want a bridge in my situation [09:46] <mbrownnyc> okay, the ICMP echo reply duplicate issue is likely out of the realm of this channel, but I sincerely appreciate the info on the kernels inner-workings [09:52] <whaffle> mbrownnyc: either the kernel patch, or a bridge with an interface. Since the latter is quicker, yes [09:54] <mbrownnyc> thanks whaffle [edit2] After removing the bridge, and removing the dummy kernel module, I only had a single interface chilling out, lonely. I still received duplicate icmp echo replies... in fact I received a random amount: http://pastebin.com/2LNs0GM8 The same thing doesn't happen on a few other hosts on the same switch, so it has to do with the linux box itself. I'll likely end up rebuilding it next week. Then... you know... this same thing will occur again. [edit3] Guess what? I rebuilt the box, and I'm still receiving duplicate ICMP echo replies. Must be the network infrastructure, although the ARP tables do not contain multiple entries. [edit4] How ridiculous. The machine was a network probe, so I was (ingress and egress) mirroring an uplink port to a node that was the NIC. So, the flow (must have) gone like this: ICMP echo request comes in through the mirrored uplink port. (the real) ICMP echo request is received by the NIC (the mirrored) ICMP echo request is received by the NIC ICMP echo reply is sent for both. I'm ashamed of myself, but now I know. It was suggested on #networking to either isolate the mirrored traffic to an interface that does not have IP enabled, or tag the mirrored packets with dot1q.

    Read the article

  • .NET Application broken on one PC, unhandleable exception

    - by Bobby
    Hello people. I have a .NET 2.0 application with nothing fancy in it. It worked until yesterday on every PC I installed or copied it to, no matter if 2.0, 3.0, 3.5 or 3.5 SP1 was installed, no matter if it was Win2000, XP or even Win7 (in total 100+ machines). Yesterday I did my normal installation procedure and wanted to start it one time to check if everything is working...and it wasn't. The program crashed hard leaving me with the uninformative "Do you wanna report this error?" dialog. The problem is an exception in the Main(String[] args) routine of my application. The event viewer is showing the following entry: Event Type: ErrorEvent Source: .NET Runtime 2.0 Error Reporting Event Category: None Event ID: 5000 Date: 05/05/2010 Time: 16:09:09 User: N/A Computer: myClientPC Description: EventType clr20r3, P1 apomenu.exe, P2 1.4.90.53, P3 4bdedea4, P4 system.configuration, P5 2.0.0.0, P6 4889de74, P7 1a6, P8 136, P9 ioibmurhynrxkw0zxkyrvfn0boyyufow, P10 NIL. Well...great information. After a lot of searching I finally was able to get further information about this exception (by adding a handler for UnhandledExceptions directly in My.MyApplication.New(), Application.Designer.vb): System.Configuration.ConfigurationErrorsException Configuration system failed to initialize at System.Configuration.ClientConfigurationSystem.EnsureInit(String configKey) at System.Configuration.ClientConfigurationSystem.PrepareClientConfigSystem(String sectionName) at System.Configuration.ClientConfigurationSystem.System.Configuration.Internal.IInternalConfigSystem.GetSection(String sectionName) at System.Configuration.ConfigurationManager.GetSection(String sectionName) at System.Configuration.PrivilegedConfigurationManager.GetSection(String sectionName) at System.Net.Configuration.SettingsSectionInternal.get_Section() at System.Net.Sockets.Socket.InitializeSockets() at System.Net.Sockets.Socket.get_SupportsIPv4() at Microsoft.VisualBasic.ApplicationServices.WindowsFormsApplicationBase.get_HostName() at Microsoft.VisualBasic.ApplicationServices.WindowsFormsApplicationBase.RegisterChannel(Boolean SecureChannel) at Microsoft.VisualBasic.ApplicationServices.WindowsFormsApplicationBase.Run(String[] commandLine) at MyAppNameHere.My.MyApplication.Main(String[] Args) in 17d14f5c-a337-4978-8281-53493378c1071.vb:Line 81. And at this point I'm stuck...I'm out of ideas. I'm not using any kind of configuration system from the framework (no reference to System.Configuration, and there never was a MyAppnameHere.exe.config generated or distributed, nor have I seen this error before). I also found a bug report at Microsoft (Google Cache) about this bug (in another context, though). But as it seems, they won't even look at it. Every help is greatly appreciated! Edit: I'm using Visual Studio 2008 Prof.. Crash happens in Release- and Debug-Build on the client machine. Debugging the application directly on this machine is out of question I fear, 300+ Miles and they only have two computers to work with.

    Read the article

  • How to communicate between Client and Server in a Client-Server Application?

    - by Sanoj
    I would like to implement an Client-Server Application, where the business-logic, security validations and a database are at the server and the user interface are at the client. I would like to implement clients in different languages i.e. one in WPF/.NET, one Swing/Java , one in Android/Java and maybe one HTML/JavaScript client. The server will be on Internet, so I would like to be able to have encrypted communication. The client will send some lists of items to be added to the database, or update items, and do some transactions. The server will check if the items are already updated by another client, or update the item, add new items or delete items. How do I solve the communication between clients and the server in such a system? I have been thinking about: http/https webserver, and sending messages in JSON or XML and use Web Sockets for bi-directional communication. Use http in a RESTful way, except when WebSockets are needed. But I guess there are better solutions for native desktop applications than http? CORBA - I have just heard about it, and it's old and complex. Not much talk about it these days. XMPP/Jabber - I have just heard about it and I don't know if it fits me at all. EJabberd seams to be a popular implementation. AMQP - I have just heard about it and I don't know if it fits me at all. RabbitMQ seams to be a popular implementation. Windows Communication Foundation, Java RMI, Java Message Service - but are they language independent? I guess some of these alternatives are on different levels, maybe I can have i.e xmpp or amqp in web sockets over https? What technologys are used for this problem in companies today? and what is recommended to use? I have no experience of them other than webservers and http. Please give me some guidance in this jungle. What are the pros and cons of these technologies in my situation?

    Read the article

  • Is is possible to use IOCP (or other API) in reactor stle operations?

    - by Artyom
    Hello, Is there any scalable Win32 API (like IOCP not like select) that gives you reactor style operations on sockets? AFAIK IOCP allows you to receive notification on completed operations like data read or written (proactor) but I'm looking for reactor style of operations: I need to get notification when the socket is readable or writable (reactor). Something similar to epoll, kqueue, /dev/poll ? Is there such API in Win32? If so where can I find a manual on it?

    Read the article

  • My pivot chart has the wrong Y axis values but correct data point values

    - by Mark Harnett
    I created a pivot chart based on some raw data for the x axis (dates) and 4 calculated fields for the Y values. The values on resulting lines are correct (see the data label at the end of the line) but the Y axis is off by about 100, but not off by any consistent amount. I have played with auto axis on and off, turn log scale on and off. All to no avail. Does anybody have any thoughts? Image link

    Read the article

  • Problems connecting Clariion LUNS to Solaris 10

    - by vialde
    I've got a Clariion San and a Solaris 10 server with an emulex HBA. The Thin LUNS are visible in Solaris and I can happily format the raw devices. Unfortunately that's all I can do. All other operations result in I/O errors. I'm running current versions of PowerPath and Solaris is patched as high as it'll go. Anyone have any similar experiences?

    Read the article

  • exim4, avoid emails end up in spam folder

    - by MultiformeIngegno
    I have a VPS: I set up exim, problem is emails always go in the spam folder.. this is a sample header: http://pastebin.com/raw.php?i=4NJ2ZaUs As you can see it PASSes SPF test but still emails don't pass spam filters (I tried with Gmail).. Here's my exim config: dc_eximconfig_configtype='internet' dc_other_hostnames='MY_DOMAIN' dc_local_interfaces='' dc_readhost='MY_DOMAIN' dc_relay_domains='MY_DOMAIN' dc_minimaldns='false' dc_relay_nets='' dc_smarthost='MY_DOMAIN' CFILEMODE='644' dc_use_split_config='false' dc_hide_mailname='' dc_mailname_in_oh='true' dc_localdelivery='mail_spool' Why does this happen?

    Read the article

  • port allocation in remoting

    - by user158182
    in remoting is it possible to connect a particular port(client) to a remote server, i can specify the server port,is there any posibilitis to specify a client port example if server runs in x machine and server port is 8085 and client runs in y where itconnects the server exactly with the specified port ,but the client is connected using a random port(can ispecify a client port),ican do it in basic sockets

    Read the article

  • how to disable these logs on the screen?

    - by user62367
    using Fedora 14: http://pastebin.com/raw.php?i=jUvcfugw i mount an anonym Samba share [checks it in every 5 sec] it's working, ok, great! But: when i shut down my Fedora box, i can see the lines containing this scripts lines! Many times, about ~50x on the screen. How could i disable these lines when shutting down? I [and other people] don't want to see those lines for about ~ 5 sec Thank you!

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • What's the right way to communicate between 2 or more .Net applications running on a same computer w

    - by Ivan
    If my applications run on a same computer or even on different computers in a same LAN and need intense and quick communication, it seems illogical for me to use text-encoded web services and HTTP. I could possibly use IP/TCP/UDP sockets and invent my own protocols, but believe there is a standard way for .Net applications to send/receive object instances (and, maybe, even sharing an object by reference?). Can you tell me what's that standard way? I am only interested in .Net Framework 4 applications and don't need to support legacy frameworks.

    Read the article

  • monitoring unix resources from inside a process

    - by kamziro
    I've had a bunch of EAGAIN's from trying to fork() or spawning threads, which lead me to believe that I'm leaking resources somewhere. Is it possible, in POSIX, to get the following from inside the process itself: number of active pthreads number of active child processes number of active pipes number of active sockets (or maybe this and pipes would be counted as file descriptors?) Or do these have to be counted manually? There's already counters for them, but I think one of them are leaking.

    Read the article

  • How to keep group-writeable shares on Samba with OSX clients?

    - by Oliver Salzburg
    I have a FreeNAS server on a network with OSX and Windows clients. When the OSX clients interact with SMB/CIFS shares on the server, they are causing permission problems for all other clients. Update: I can no longer verify any answers because we abandoned the project, but feel free to post any help for future visitors. The details of this behavior seem to also be dependent on the version of OSX the client is running. For this question, let's assume a client running 10.8.2. When I mount the CIFS share on an OSX client and create a new directory on it, the directory will be created with drwxr-x-rx permissions. This is undesirable because it will not allow anyone but me to write to the directory. There are other users in my group which should have write permissions as well. This behavior happens even though the following settings are present in smb.conf on the server: [global] create mask= 0666 directory mask= 0777 [share] force directory mode= 0775 force create mode= 0660 I was under the impression that these settings should make sure that directories are at least created with rwxrwxr-x permissions. But, I guess, that doesn't stop the client from changing the permissions after creating the directory. When I create a folder on the same share from a Windows client, the new folder will have the desired access permissions (rwxrwxrwx), so I'm currently assuming that the problem lies with the OSX client. I guess this wouldn't be such an issue if you could easily change the permissions of the directories you've created, but you can't. When opening the directory info in Finder, I get the old "You have custom access" notice with no ability to make any changes. I'm assuming that this is caused because we're using Windows ACLs on the share, but that's just a wild guess. Changing the write permissions for the group through the terminal works fine, but this is unpractical for the deployment and unreasonable to expect from anyone to do. This is the complete smb.conf: [global] encrypt passwords = yes dns proxy = no strict locking = no read raw = yes write raw = yes oplocks = yes max xmit = 65535 deadtime = 15 display charset = LOCALE max log size = 10 syslog only = yes syslog = 1 load printers = no printing = bsd printcap name = /dev/null disable spoolss = yes smb passwd file = /var/etc/private/smbpasswd private dir = /var/etc/private getwd cache = yes guest account = nobody map to guest = Bad Password obey pam restrictions = Yes # NOTE: read smb.conf. directory name cache size = 0 max protocol = SMB2 netbios name = freenas workgroup = COMPANY server string = FreeNAS Server store dos attributes = yes hostname lookups = yes security = user passdb backend = ldapsam:ldap://ldap.company.local ldap admin dn = cn=admin,dc=company,dc=local ldap suffix = dc=company,dc=local ldap user suffix = ou=Users ldap group suffix = ou=Groups ldap machine suffix = ou=Computers ldap ssl = off ldap replication sleep = 1000 ldap passwd sync = yes #ldap debug level = 1 #ldap debug threshold = 1 ldapsam:trusted = yes idmap uid = 10000-39999 idmap gid = 10000-39999 create mask = 0666 directory mask = 0777 client ntlmv2 auth = yes dos charset = CP437 unix charset = UTF-8 log level = 1 [share] path = /mnt/zfs0 printable = no veto files = /.snap/.windows/.zfs/ writeable = yes browseable = yes inherit owner = no inherit permissions = no vfs objects = zfsacl guest ok = no inherit acls = Yes map archive = No map readonly = no nfs4:mode = special nfs4:acedup = merge nfs4:chown = yes hide dot files force directory mode = 0775 force create mode = 0660

    Read the article

  • How can I compress a movie to a specific file size in Windows 7's Live Movie Maker?

    - by Nathan Fellman
    In previous versions of Windows Movie Maker I could take a raw video file and specify the file size to compress it to, and Movie Maker would compress it accordingly (with the appropriate loss in quality). Live Movie Maker, which comes with Windows 7, doesn't seem to have this option. I can only set specify the requested quality. Is there any way to specify the size of the target file for Windows Live Movie Maker?

    Read the article

  • Descending list ordered by file modification time

    - by LanceBaynes
    How can I generate a list of files in a directory [for example, "/mnt/hdd/PUB/"] ordered by the files modification time? [in descending order, the oldest modified file is at the lists end] ls -A -lRt would be great: https://pastebin.com/raw.php?i=AzuSVmrJ But if a file is changed in a directory, it lists the full directory, so the pastebined link isn't good [I don't want a list ordered by "directories", I need a "per file" ordered list] OS: OpenWrt [no Perl - not enough space for it :( + no "stat", or "file" command].

    Read the article

  • Recover harddrive data

    - by gameshints
    I have a dell laptop that recently "died" (It would get the blue screen of death upon starting) and the hard drive would make a weird cyclic clicking noises. I wanted to see if I could use some tools on my linux machine to recover the data, so I plugged it into there. If I run "fdisk" I get: Disk /dev/sdb: 20.0 GB, 20003880960 bytes 64 heads, 32 sectors/track, 19077 cylinders Units = cylinders of 2048 * 512 = 1048576 bytes Disk identifier: 0x64651a0a Disk /dev/sdb doesn't contain a valid partition table Fine, the partition table is messed up. However if I run "testdisk" in attempt to fix the table, it freezes at this point, making the same cyclical clicking noises: Disk /dev/sdb - 20 GB / 18 GiB - CHS 19078 64 32 Analyse cylinder 158/19077: 00% I don't really care about the hard drive working again, and just the data, so I ran "gpart" to figure out where the partitions used to be. I got this: dev(/dev/sdb) mss(512) chs(19077/64/32)(LBA) #s(39069696) size(19077mb) * Warning: strange partition table magic 0x2A55. Primary partition(1) type: 222(0xDE)(UNKNOWN) size: 15mb #s(31429) s(63-31491) chs: (0/1/1)-(3/126/63)d (0/1/32)-(15/24/4)r hex: 00 01 01 00 DE 7E 3F 03 3F 00 00 00 C5 7A 00 00 Primary partition(2) type: 007(0x07)(OS/2 HPFS, NTFS, QNX or Advanced UNIX) (BOOT) size: 19021mb #s(38956987) s(31492-38988478) chs: (4/0/1)-(895/126/63)d (15/24/5)-(19037/21/31)r hex: 80 00 01 04 07 7E FF 7F 04 7B 00 00 BB 6F 52 02 So I tried to mount just to the old NTFS partition, but got an error: sudo mount -o loop,ro,offset=16123904 -t ntfs /dev/sdb /mnt/usb NTFS signature is missing. Ugh. Okay. But then I tried to get a raw data dump by running dd if=/dev/sdb of=/home/erik/brokenhd skip=31492 count=38956987 But the file got up to 59885568 bytes, and made the same cyclical clicking noises. Obviously there is a bad sector, but I don't know what to do about it! The data is still there... if I view that 57MB file in textpad... I can see raw data from files. How can I get my data back? Thanks for any suggestions, Solution: I was able to recover about 90% of my data: Froze harddrive in freezer Used Ddrescue to make a copy of the drive Since Ddrescue wasn't able to get enough of my drive to use testdisk to recover my partitions/file system, I ended up using photorec to recover most of my files

    Read the article

  • How to Import flip video to Final Cut Pro and edit flip video in Final Cut Pro?

    - by Yinahd
    Final Cut Pro is a professional video editing application for Mac users and it is widely used even by many Hollywood people on professional movie post-production. If you are a flip video fan and you want to give professional editing to your flip videos, Final Cut Pro is a great choice. However, Final Cut Pro does not allow raw flip videos to be imported to Final Cut Pro and you will need to convert flip video to Final Cut Pro supported formats.

    Read the article

  • I need to monitor a physical RS232 port on an appliance?

    - by Kendor
    I need to verify what's being output on an RS232 port of an appliance that's running proprietary software (e.g. NOT Windows or Linux). The port is sending data to a target app on another appliance, but I need to verify/log the actual data raw outside of the appliances. Would appreciate a recommendation on process/software to attach to the physical sending port (I have a straight through RS232 cable) and grab sample output of that port.

    Read the article

  • Grub Error 18 - Solid State Drive

    - by clint
    I recently used Raw Copy to make an image of my 300gb Raptor Hd to a OCZ Vertex SSD 60GB. And When I pluged in the SSD to boot I get a Grub Error 18. I have tried to changed in the BIOS setting to LBA, Large, Auto, trying different combination's. Any advice. thanks, Clint

    Read the article

  • What is the recommended way to pass data back and forth between two threads using C#

    - by kenalex
    I am trying to make an app that will pass data between two servers Connection1 and Conenction2 using sockets.What i would like to do is receive data from Connection1 and pass it to Connection2 and vice-versa.Connection1 and Conenction2 are on different threads. What is the best way to call methods on different threads in order to pass data back and forth between them.Both threads will use the same message object type to communicate in both directions between them. Thanks

    Read the article

  • One-liner to determine who wins in Rock, Paper, Scissors

    - by asmeurer
    So I am writing a simple Rock, Paper, Scissors game in C (it's for an assignment by the way, though the main thing is to learn sockets. Also, I suspect it will be due before I get a good answer). I have it setup as Rock=0, Paper=1, and Scissors=2. Is there an easy one-liner to determine who wins? I tried playing around with it on paper, but I couldn't figure out any patterns.

    Read the article

< Previous Page | 61 62 63 64 65 66 67 68 69 70 71 72  | Next Page >