Search Results

Search found 15456 results on 619 pages for 'global temporary tables'.

Page 67/619 | < Previous Page | 63 64 65 66 67 68 69 70 71 72 73 74  | Next Page >

  • Why SQL2008 debugger would NOT step into a certain child stored procedure

    - by John Galt
    I'm encountering differences in T-SQL with SQL2008 (vs. SQL2000) that are leading me to dead-ends. I've verified that the technique of sharing #TEMP tables between a caller which CREATES the #TEMP and the child sProc which references it remain valid in SQL2008 See recent SO question. My core problem remains a critical "child" stored procedure that works fine in SQL2000 but fails in SQL2008 (i.e. a FROM clause in the child sProc is coded as: SELECT * FROM #AREAS A) despite #AREAS being created by the calling parent. Rather than post snippets of the code now, here is another symptom that may help you suggest something. I fired up the new debugger in SQL Mgmt Studio: EXEC dbo.AMS1 @S1='06',@C1='037',@StartDate='01/01/2008',@EndDate='07/31/2008',@Type=1,@ACReq = 1,@Output = 0,@NumofLines = 30,@SourceTable = 'P',@LoanPurposeCatg='P' This is a very large sProc and the key snippet that is weird is the following: **create table #Areas ( State char(2) , County char(3) , ZipCode char(5) NULL , CityName varchar(28) NULL , PData varchar(3) NULL , RData varchar(3) NULL , SMSA_CD varchar(10) NULL , TypeCounty varchar(50) , StateAbbr char(2) ) EXECUTE dbo.AMS_I_GetAreasV5 -- this child populates #Areas @SMSA = @SMSA , @S1 = @S1 , @C1 = @C1 , @Z1 = @Z1 , @SourceTable = @SourceTable , @CustomID = @CustomID , @UserName = @UserName , @CityName = @CityName , @Debug=0 EXECUTE dbo.AMS_I_GetAreas_FixAC -- this child cannot reference #Areas @StartDate = @StartDate , @EndDate = @EndDate , @SMSA_CD = @SMSA_CD , @S1 = @S1 , @C1 = @C1 , @Z1 = @Z1 , @CityName = @CityName , @CustomID = @CustomID , @Debug=0 -- continuation of the parent sProc** I can step through the execution of the parent stored procedure. When I get to the first child sproc above, I can either STEP INTO dbo.AMS_I_GetAreasV5 or STEP OVER its execution. When I arrive at the invocation of the 2nd child sProc - dbo.AMS_I_GetAreas_FixAC - I try to STEP INTO it (because that is where the problem statement is) and STEP INTO is ignored (i.e. treated like STEP OVER instead; yet I KNOW I pressed F11 not F10). It WAS executed however, because when control is returned to the statement after the EXECUTE, I click Continue to finish execution and the results windows shows the errors in the dbo.AMS_I_GetAreas_FixAC (i.e. the 2nd child) stored procedure. Is there a way to "pre-load" an sProc with the goal of setting a breakpoint on its entry so that I can pursue execution inside it? In summary, I wonder if the inability to step into a given child sproc might be related to the same inability of this particular child to reference a #temp created by its parent (caller).

    Read the article

  • SQL Server CTE referred in self joins slow

    - by Kharlos Dominguez
    Hello, I have written a table-valued UDF that starts by a CTE to return a subset of the rows from a large table. There are several joins in the CTE. A couple of inner and one left join to other tables, which don't contain a lot of rows. The CTE has a where clause that returns the rows within a date range, in order to return only the rows needed. I'm then referencing this CTE in 4 self left joins, in order to build subtotals using different criterias. The query is quite complex but here is a simplified pseudo-version of it WITH DataCTE as ( SELECT [columns] FROM table INNER JOIN table2 ON [...] INNER JOIN table3 ON [...] LEFT JOIN table3 ON [...] ) SELECT [aggregates_columns of each subset] FROM DataCTE Main LEFT JOIN DataCTE BananasSubset ON [...] AND Product = 'Bananas' AND Quality = 100 LEFT JOIN DataCTE DamagedBananasSubset ON [...] AND Product = 'Bananas' AND Quality < 20 LEFT JOIN DataCTE MangosSubset ON [...] GROUP BY [ I have the feeling that SQL Server gets confused and calls the CTE for each self join, which seems confirmed by looking at the execution plan, although I confess not being an expert at reading those. I would have assumed SQL Server to be smart enough to only perform the data retrieval from the CTE only once, rather than do it several times. I have tried the same approach but rather than using a CTE to get the subset of the data, I used the same select query as in the CTE, but made it output to a temp table instead. The version referring the CTE version takes 40 seconds. The version referring the temp table takes between 1 and 2 seconds. Why isn't SQL Server smart enough to keep the CTE results in memory? I like CTEs, especially in this case as my UDF is a table-valued one, so it allowed me to keep everything in a single statement. To use a temp table, I would need to write a multi-statement table valued UDF, which I find a slightly less elegant solution. Did some of you had this kind of performance issues with CTE, and if so, how did you get them sorted? Thanks, Kharlos

    Read the article

  • Copying 6000 tables and data from sqlserver to oracle ==> fastest method?

    - by nazer555
    i need to copy the tables and data (about 5 yrs data, 6200 tables) stored in sqlserver, i am using datastage and odbc connection to connect and datstage automatically creates the table with data, but its taking 2-3 hours per table as tables are very large(0.5 gig, 300+columns and about 400k rows). How can i achieve this the fastes as at this rate i am able to only copy 5 tables per day but within 30 days i need move over these 6000 tables.

    Read the article

  • How to setup and teardown temporary django db for unit testing?

    - by blokeley
    I would like to have a python module containing some unit tests that I can pass to hg bisect --command. The unit tests are testing some functionality of a django app, but I don't think I can use hg bisect --command manage.py test mytestapp because mytestapp would have to be enabled in settings.py, and the edits to settings.py would be clobbered when hg bisect updates the working directory. Therefore, I would like to know if something like the following is the best way to go: import functools, os, sys, unittest sys.path.append(path_to_myproject) os.environ['DJANGO_SETTINGS_MODULE'] = 'myapp.settings' def with_test_db(func): """Decorator to setup and teardown test db.""" @functools.wraps def wrapper(*args, **kwargs): try: # Set up temporary django db func(*args, **kwargs) finally: # Tear down temporary django db class TestCase(unittest.TestCase): @with_test_db def test(self): # Do some tests using the temporary django db self.fail('Mark this revision as bad.') if '__main__' == __name__: unittest.main() I should be most grateful if you could advise either: If there is a simpler way, perhaps subclassing django.test.TestCase but not editing settings.py or, if not; What the lines above that say "Set up temporary django db" and "Tear down temporary django db" should be?

    Read the article

  • Oracle SQL Developer Data Modeler: What Tables Aren’t In At Least One SubView?

    - by thatjeffsmith
    Organizing your data model makes the information easier to consume. One of the organizational tools provided by Oracle SQL Developer Data Modeler is the ‘SubView.’ In a nutshell, a SubView is a subset of your model. The Challenge: I’ve just created a model which represents my entire ____________ application. We’ll call it ‘residential lending.’ Instead of having all 100+ tables in a single model diagram, I want to break out the tables by module, e.g. appraisals, credit reports, work histories, customers, etc. I’ve spent several hours breaking out the tables to one or more SubViews, but I think i may have missed a few. Is there an easy way to see what tables aren’t in at least ONE subview? The Answer Yes, mostly. The mostly comes about from the way I’m going to accomplish this task. It involves querying the SQL Developer Data Modeler Reporting Schema. So if you don’t have the Reporting Schema setup, you’ll need to do so. Got it? Good, let’s proceed. Before you start querying your Reporting Schema, you might need a data model for the actual reporting schema…meta-meta data! You could reverse engineer the data modeler reporting schema to a new data model, or you could just reference the PDFs in \datamodeler\reports\Reporting Schema diagrams directory. Here’s a hint, it’s THIS one The Query Well, it’s actually going to be at least 2 queries. We need to get a list of distinct designs stored in your repository. For giggles, I’m going to get a listing including each version of the model. So I can query based on design and version, or in this case, timestamp of when it was added to the repository. We’ll get that from the DMRS_DESIGNS table: SELECT DISTINCT design_name, design_ovid, date_published FROM DMRS_designs Then I’m going to feed the design_ovid, down to a subquery for my child report. select name, count(distinct diagram_id) from DMRS_DIAGRAM_ELEMENTS where design_ovid = :dESIGN_OVID and type = 'Table' group by name having count(distinct diagram_id) < 2 order by count(distinct diagram_id) desc Each diagram element has an entry in this table, so I need to filter on type=’Table.’ Each design has AT LEAST one diagram, the master diagram. So any relational table in this table, only having one listing means it’s not in any SubViews. If you have overloaded object names, which is VERY possible, you’ll want to do the report off of ‘OBJECT_ID’, but then you’ll need to correlate that to the NAME, as I doubt you’re so intimate with your designs that you recognize the GUIDs So I’m going to cheat and just stick with names, but I think you get the gist. My Model Of my almost 90 tables, how many of those have I not added to at least one SubView? Now let’s run my report! Voila! My ‘BEER2′ table isn’t in any SubView! It says ’1′ because the main model diagram counts as a view. So if the count came back as ’2′, that would mean the table was in the main model diagram and in 1 SubView diagram. And I know what you’re thinking, what kind of residential lending program would have a table called ‘BEER2?’ Let’s just say, that my business model has some kinks to work out!

    Read the article

  • Database structure for ecommerce site

    - by imanc
    Hey Guys, I have been tasked with designing an ecommerce solution. The aspect that is causing me the most problems is the database. Currently the site consists of 10+ country based shops each with their own database (all residing on the same mysql instance). For the new site I'd rather all these shop databases be merged into one database so that all tables (products, orders, customers etc.) have a shop_id field. From a programming perspective this seems to make the most sense as we won't have to manage data across multiple databases. Currently the entire site generates about 120k orders a year, but is experiencing fairly heavy growth and we need to design a solution that will scale. In 5 years there may be more than a million orders per year and a database that contains 5 years order history (archiving maybe a solution here). The question is - do we use a single database, or do we keep the database-per-shop structure? I am currently trying to find supporting evidence for either avenue. The company I am designing the solution for prefer the per-shop database structure because they believe it will allow the sites to scale. But my argument is that the shop's database probably won't get that busy over the next few years that they exceed the capacity of a mysql database and a "no expenses spared" hardware set-up. I am wondering if anyone has any advice either way? Does anyone have experience with websites / ecommerce sites that have tables containing millions of records? I know there is probably not a clear answer here, but at what stage do we have too many records or too large table files to have a fast loading site? Also, if anyone has any advice on sources of information - books, websites, etc. where I can do further research, it would be highly appreciated! Cheers, imanc

    Read the article

  • How can I create a custom OpenOffice / LibreOffice Writer table AutoFormat scheme?

    - by Merlyn Morgan-Graham
    None of the basic table AutoFormat schemes in LibreOffice Writer have both an alternation style defined and no sum column/row style defined. If they have alternation, they always seem to have sums. Because of this I'd like to define my own table scheme. What is the easiest way to accomplish this? A WYSIWYG isn't totally necessary. I am not scared of editing simple XML files as long as I have examples to work from, and if I don't have to edit base install files. If I can place them in a custom area or my user profile directory then that would be best. If there is a way to get the GUI Add functionality to properly recognize an alternation then that would also be helpful.

    Read the article

  • How to set robots.txt globally in nginx for all virtual hosts

    - by anup
    I am trying to set robots.txt for all virtual hosts under nginx http server. I was able to do it in Apache by putting the following in main httpd.conf: <Location "/robots.txt"> SetHandler None </Location> Alias /robots.txt /var/www/html/robots.txt I tried doing something similar with nginx by adding the lines given below (a) within nginx.conf and (b) as include conf.d/robots.conf location ^~ /robots.txt { alias /var/www/html/robots.txt; } I have tried with '=' and even put it in one of the virtual host to test it. Nothing seemed to work. What am I missing here? Is there another way to achieve this?

    Read the article

  • Interactive console based CSV editor

    - by Penguin Nurse
    Although spreadsheet applications for editing CSV files on the console used to be one of the earliest killer applications for personal computers, only few of them and even less documentation about them is still actively maintained. After having done extensive search on the web, manpages and source code, I ended up with the following three applications that all have fundamental drawbacks: sc: abbrev. for spreadsheet calculator; nice tool with vi keybings, but it does not put strings containing the delimiter into quotas when exporting to delimiter separated format and can't import csv files correctly, i.e. all numbers are interpreted as strings GNU oleo: doesn't seem to be actively maintained any longer since 2001 and there are therefore no packages for major linux distributions teapot: offers packages for various operating systems, but uses for example counter-intuitive naming for cells (numbers for row and column, i.e. 11 seems to be intended to be row 1, column 1) and superfluous code for FLTK GUI Various Emacs modes also do not quote strings containing the delimiter well or are require much more typing for entering the scaffold of a table. Therefore I would be very grateful for overcoming one of theses drawbacks or any hints towards another console based CSV editor. It actually needn't do any calculations just editing cells or column- and rowise.

    Read the article

  • How to add a footer to a table in Microsoft Word?

    - by dewalla
    I have a table that is longer than one page. I have found the option to make the header of the table to be added to the second portion of the table after the page break. Is there a way to do the same thing but with a footer on the table? I want to add a footer so that if my table was 1000 entries long (12 pages), that the first and last row of each page would be consistant; a header and footer for the table. If I edit the rest of the document (above the table) the table will shift up/down and I want to header and footer of the table to remain at the pagge breaks. Any Ideas? PAGE BREAK HEADER OF TABLE TBL TBL TBL TBL TBL TBL TBL TBL TBL TBL TBL TBL FOOTER OF TABLE PAGE BREAK HEADER OF TABLE TBL TBL TBL TBL TBL TBL FOOTER OF TABLE TEXT TEXT TEXT TEXT TEXT TEXT PAGE BREAK

    Read the article

  • Excel or OpenOffice Table Summary: how to reconstruct a table from another, with "missing" values

    - by Gilberto
    I have a table of values (partial) with 3 columns: month (from 1 to 12), code and value. E.g., MONTH | CODE | VALUE 1 | aaa | 111 1 | bbb | 222 1 | ccc | 333 2 | aaa | 1111 2 | ccc | 2222 The codes are clients and the values are sales volumes. Each row represents the sales for one month for one client. So I have three clients, namely aaa, bbb, and ccc. For month=1 their sales volumes are: aaa-111, bbb-222, and ccc-333. A client may or may not have sales for every month; for example, for the month 2, the client bbb has no sales. I have to construct a completed summary table for all the MONTH / CODE pairs with their corresponding VALUE (using the value from the "partial" table, if present, otherwise print a string "missing"). MONTH | CODE | VALUE 1 | aaa | 111 1 | bbb | 222 1 | ccc | 333 2 | aaa | 1111 2 | bbb | missing 2 | ccc | 2222 Or, to put it another way, the table is a linear representation of a matrix:                                 and I want to identify the cells for which no value was provided. How can I do that?

    Read the article

  • Creating Routes using the second NIC in the box

    - by Aditya Sehgal
    OS: Linux I need some advice on how to set up the routing table. I have a box with two physical NIC cards eth0 & eth1 with two associated IPs IP1 & IP2 (both of the same subnet). I need to setup a route which will force all messages from IP1 towards IP3 (of the same subnet) to go via IP2. I have a raw socket capture program listening on IP2 (This is not for malicious use). I have set up the routing table as Destination Gateway Genmask Flags Metric Ref Use Iface IP3 IP2 255.255.255.255 UGH 0 0 0 eth1 If I try to specify eth0 while adding the above rule, I get an error "SIOCADDRT: Network is unreachable". I understand from the manpage of route that if the GW specified is a local interface, then that would be use as the outgoing interface. After setting up this rule, if i do a traceroute (-i eth0), the packet goes first to the default gateway and then to IP3. How do I force the packet originating from eth0 towards IP3 to first come to IP2. I cannot make changes to the routing table of the gateway. Please suggest.

    Read the article

  • Cumulative average using data from multiple rows in an excel table

    - by Aaron E
    I am trying to calculate a cumulative average column on a table I'm making in excel. I use the totals row for the ending cumulative average, but I would like to add a column that gives a cumulative average for each row up to that point. So, if I have 3 rows I want each row to have a column giving the average up to that row and then the ending cumulative average in the totals row. Right now I can't figure this out because I'd be having to reference in a formula rows above and below the current row and I'm unsure about how to go about it because it's a table and not just cells. If it was just cells then I know how to do the formula and copy it down each row, but being that the formula I need depends on whether or not a new row in the table is added or not I keep thinking that my formula would be something like: (Completion rate row 1/n) where n is the number of rows up to that point, here row 1, then ((Completion rate row 1 + Completion rate row 2)/n) for row 2 so n=2, and so on for each new row added. Please advise.

    Read the article

  • How can I change my mysql user that has all privileges on a database to only have select privileges on one specific table?

    - by Glenn
    I gave my mysql user the "GRANT ALL PRIVILEGES ON database_name.* to my_user@localhost" treatment. Now I would like to be more granular, starting with lowering privileges on a specific table. I am hoping mysql has or can be set to follow a "least amount of privileges" policy, so I can keep the current setup and lower it for the one table. But I have not seen anything like this in the docs or online. Other than removing the DB level grant and re-granting on a table level, is there a way to get the same result by adding another rule?

    Read the article

  • What can cause peaks in pagetables in /proc/meminfo ?

    - by Fuzzy76
    I have a gameserver running Debian Lenny on a VPS host. Even when experiencing a fairly low load, the players start experiencing major lag (ping times rise from 50 ms to 150-500 ms) in bursts of 3 - 10 seconds. I have installed Munin server monitoring, but when looking at the graphs it looks like the server has plenty of CPU, RAM and bandwidth available. The only weird thing I noticed is some peaks in the memory graph attributed to "page_tables" which maps to PageTables in /proc/meminfo but I can't find any good information on what this might mean. Any ideas what might be causing this? If you need any more graps, just let me know. The interrupts/second count is at roughly 400-600 during this period (nearly all from eth0). The drop in committed was caused by me trying to lower the allocated memory for the server from 512MB to 256MB, but that didn't seem to help.

    Read the article

  • Dates not recognized as dates in pivot table pulling directly from SQL Server

    - by Michael K
    My pivot pulls from an external data source with a date column. Excel doesn't see this column as a date and the 'Format Cells' option panel doesn't change how the dates are displayed. The cell data is left-aligned, suggesting a string rather than a date. I have tried cast(myvar as date) and convert(varchar, myvar, 101) and convert(varchar, myvar, 1) in the base table, but none of these have been picked up by Excel as dates. If the column is recognized as a date, I can group by week and month. I understand that if I can't fix this, the next step is to add columns with weeks and months for each date to the table, but I'd like to give formatting the column one more shot before doing that.

    Read the article

  • Use Excel Table Column in ComboBox Input Range property

    - by V7L
    I asked this in StackOverflow and was redirected here. Apologies for redundancy. I have an Excel worksheet with a combo box on Sheet1 that is populated via its Input Range property from a Dynamic Named Range on Sheet2. It works fine and no VBA is required. My data on Sheet2 is actually in an Excel Table (all data is in the XLS file, no external data sources). For clarity, I wanted to use a structured table reference for the combo box's Input Range, but cannot seem to find a syntax that works, e.g. myTable[[#Data],[myColumn3]] I cannot find any indications that the combo box WILL accept structured table references, though I cannot see why it wouldn't. So, two part question: 1. Is is possible to use a table column reference in the combo box input range property (not using VBA) and 2. HOW?

    Read the article

  • How to edit a table in the email reply (in Gmail)?

    - by imz
    I've received an email with an embedded table. I want to put some marks inside that table (i.e., edit the contentof the table) and send it back. Unfortunately, the Gmail interface doesn't seem to have table editing capabilities: after I hit reply, I see the table in the quoted text of the original message, but is not editable... If this is not possible in Gmail, how do I export the HTML source of this messsage and edit in another installed word processor?

    Read the article

  • Problems creating a functioning table

    - by Hoser
    This is a pretty simple SQL query I would assume, but I'm having problems getting it to work. if (object_id('#InfoTable')is not null) Begin Drop Table #InfoTable End create table #InfoTable (NameOfObject varchar(50), NameOfCounter varchar(50), SampledValue float(30), DayStamp datetime) insert into #InfoTable(NameOfObject, NameOfCounter, SampledValue, DayStamp) select vPerformanceRule.ObjectName AS NameOfObject, vPerformanceRule.CounterName AS NameOfCounter, Perf.vPerfRaw.SampleValue AS SampledValue, Perf.vPerfHourly.DateTime AS DayStamp from vPerformanceRule, vPerformanceRuleInstance, Perf.vPerfHourly, Perf.vPerfRaw where (ObjectName like 'Logical Disk' and CounterName like '% Free Space' AND SampleValue > 95 AND SampleValue < 100) order by DayStamp desc select NameOfObject, NameOfCounter, SampledValue, DayStamp from #InfoTable Drop Table #InfoTable I've tried various other forms of syntax, but no matter what I do, I get these error messages. Msg 207, Level 16, State 1, Line 10 Invalid column name 'NameOfObject'. Msg 207, Level 16, State 1, Line 10 Invalid column name 'NameOfCounter'. Msg 207, Level 16, State 1, Line 10 Invalid column name 'SampledValue'. Msg 207, Level 16, State 1, Line 10 Invalid column name 'DayStamp'. Msg 207, Level 16, State 1, Line 22 Invalid column name 'NameOfObject'. Msg 207, Level 16, State 1, Line 22 Invalid column name 'NameOfCounter'. Msg 207, Level 16, State 1, Line 22 Invalid column name 'SampledValue'. Msg 207, Level 16, State 1, Line 22 Invalid column name 'DayStamp'. Line 10 is the first 'insert into' line, and line 22 is the second select line. Any ideas?

    Read the article

  • MySQL: how to convert many MyISAM tables to InnoDB in a production database?

    - by Continuation
    We have a production database that is made up entirely of MyISAM tables. We are considering converting them to InnoDB to gain better concurrency & reliability. Can I just alter the myISAM tables to InnoDB without shutting down MySQL? What are the recommend procedures here? How long will such a conversion take? All the tables have a total size of about 700MB There are quite a large number of tables. Is there any way to apply ALTER TABLE to all the MyISAM tables at once instead of doing it one by one? Any pitfalls I need to be aware of? Thank you

    Read the article

  • OpenVPN + iptables / NAT routing

    - by Mikeage
    Hi, I'm trying to set up an OpenVPN VPN, which will carry some (but not all) traffic from the clients to the internet via the OpenVPN server. My OpenVPN server has a public IP on eth0, and is using tap0 to create a local network, 192.168.2.x. I have a client which connects from local IP 192.168.1.101 and gets VPN IP 192.168.2.3. On the server, I ran: iptables -A INPUT -i tap+ -j ACCEPT iptables -A FORWARD -i tap+ -j ACCEPT iptables -t nat -A POSTROUTING -s 192.168.2.0/24 -o eth0 -j MASQUERADE On the client, the default remains to route via 192.168.1.1. In order to point it to 192.168.2.1 for HTTP, I ran ip rule add fwmark 0x50 table 200 ip route add table 200 default via 192.168.2.1 iptables -t mangle -A OUTPUT -j MARK -p tcp --dport 80 --set-mark 80 Now, if I try accessing a website on the client (say, wget google.com), it just hangs there. On the server, I can see $ sudo tcpdump -n -i tap0 tcpdump: verbose output suppressed, use -v or -vv for full protocol decode listening on tap0, link-type EN10MB (Ethernet), capture size 96 bytes 05:39:07.928358 IP 192.168.1.101.34941 > 74.125.67.100.80: S 4254520618:4254520618(0) win 5840 <mss 1334,sackOK,timestamp 558838 0,nop,wscale 5> 05:39:10.751921 IP 192.168.1.101.34941 > 74.125.67.100.80: S 4254520618:4254520618(0) win 5840 <mss 1334,sackOK,timestamp 559588 0,nop,wscale 5> Where 74.125.67.100 is the IP it gets for google.com . Why isn't the MASQUERADE working? More precisely, I see that the source showing up as 192.168.1.101 -- shouldn't there be something to indicate that it came from the VPN? Edit: Some routes [from the client] $ ip route show table main 192.168.2.0/24 dev tap0 proto kernel scope link src 192.168.2.4 192.168.1.0/24 dev wlan0 proto kernel scope link src 192.168.1.101 metric 2 169.254.0.0/16 dev wlan0 scope link metric 1000 default via 192.168.1.1 dev wlan0 proto static $ ip route show table 200 default via 192.168.2.1 dev tap0

    Read the article

  • Split a table in Word without losing row title

    - by Shane Hsu
    Word has the feature to repeat title row of a table when a table is so long that it spans a bunch of pages. I need to categorize my data into several pages, and I did that by splitting the table and insert page split to put them all in a page of itself. So now I got several page of data, but only the first page has title row. Is there anyway else to do this beside manually adding the title row to all the other pages? Original data: _________________ | Cat. Data | | 1 * | | 1 * | | 1 * | | 1 * | | 1 * | | 1 * | | 2 * | | 2 * | | 2 * | | 2 * | | 3 * | |___3______*______| And then turn it into: _________________ | Cat. Data | | 1 * | | 1 * | | 1 * | | 1 * | | 1 * | |___1______*______| Next page _________________ | Cat. Data | | 2 * | | 2 * | | 2 * | |___2______*______| Next Page _________________ | Cat. Data | | 3 * | |___3______*______|

    Read the article

  • Table Formatting in Excel 2007: How do I remove it?

    - by RocketGoal
    I've used the new Table Formatting option in Excel 2007. Now I can't remove it. I've dragged the little blue square up to the last cell on the top left, but it just won't go any further. In fact it just won't go at all. Clear all doesn't remove it. What does? I want my table back! I'm not a beginner with Excel, but this little annoyance has made me feel like on. Surely there must be some way to remove table format without deleting something or clearing all! Thanks Mike

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Does OSB has any database dependency?

    - by Manoj Neelapu
    Major functionality of OSB is database independent. Most of the internal data-structures that re required by OSB are stored in-memory.Reporting functionality of OSB requires DB tables be accessible.http://download.oracle.com/docs/cd/E14571_01/doc.1111/e15017/before.htm#BABCJHDJ It should hover be noted that we can still run OSB with out creating any tables on database.In such cases the reporting functionality cannot be used where as other functions in OSB will work just as fine.We also see few errors in the log file indicating the absence of these tables which we can ignore.  If reporting function is required we will have to install few tables. http://download.oracle.com/docs/cd/E14571_01/doc.1111/e15017/before.htm#BABBBEHD indicates running RCU recommended. OSB reporting tables are bundled along with SOA schema in RCU. OSB requires two simple tables for reporting functionality and installing complete SOA schema is little far fetched. SOA schema contains lot of tables which OSB doesn't require at all. More over OSB tables are too simple to require a tool like an RCU.Solution to it would be to manually create those tables required for OSB. To make  life easier the definition of tables is available in dbscripts folder under OSB_HOME.eg. D:\Oracle\Middleware\osb\11gPS2\Oracle_OSB1\dbscripts. $OSB_HOME=D:\Oracle\Middleware\osb\11gPS2\Oracle_OSB1If you are not planning to use reporting feature in OSB, then we can also delete the JDBC data sources that comes along with standard OSB domain.WLST script to delete cgDataSources from OSB domain . OSB will work fine with out DB tables and JDBC Datasource.

    Read the article

< Previous Page | 63 64 65 66 67 68 69 70 71 72 73 74  | Next Page >