Search Results

Search found 31774 results on 1271 pages for 'chris go'.

Page 678/1271 | < Previous Page | 674 675 676 677 678 679 680 681 682 683 684 685  | Next Page >

• Most efficient RAID configuration with 6 disks?

  - by Bob King

  I have a hand-me-down server that I'm setting up at home and it's got 6 72Gb hard disks (as well as 2 18Gb drives that I'm using for the OS). What is the best way to configure those 6 drives? Should I RAID 5 or 6, or go with something simpler, like mirroring? I'm planning to use it to hold a source control repository, and possibly data for a development SQL server. The machine has a hardware raid controller. It is an old IBM server.

  Read the article

• WSUS Updates - Best Practice

  - by What'sTheStoryWishBone

  We have an isolated enviornment of a few hundred servers in which we use WSUS to push updates too. We have thousands of updates which to manage and push to devices testing along the way to ensure the update will not break anything. What are the best practices that you all follow in your enteprise networks to ensure an update does not go out to all the machines that will break something? We currently have ours broken into customized groups for each type of machine. There is one "Test Group" which has one PC of each type which we apply updates to for error checking. Is this a similar procedure others follow or is their an easier safer way to manage the thousands of WSUS updates?

  Read the article

• Putting shortcuts onto user's machines using AD

  - by Rod

  I just handled a small task, which I would like to automate through Active Directory. We’ve written a few Intranet applications which get used a lot here. Occasionally someone will have to go to the front desk and work on something there, while one of the receptionists are away. They’ll always call us to have us put a shortcut onto their desktop linking to these Intranet applications. It’s just a bit of a nuisance, and I’m sure that AD could be used to automate creating shortcuts on user’s desktops pointing to our Intranet applications. The only thing is, I don’t know how to do this, and being a small shop that we are, we don’t have a system administrator at this time. So, how do we automate the creation of desktop shortcuts to websites, using AD in a Windows 2003 Server environment?

  Read the article

• Windows Reformatting

  - by Shimz187

  I recently began formatting a hard drive via USB extenal drive when the power went off. When i powered it up again and connected the drive the drives dont show up under my computer. When i go to disk management, i see the drive but now it says unallocated space. The drive was initialy partitioned into 2 drives. I cant see both drives now. Tried running GetDataBack NTFS recovery tool and it only comes up with errors. There seem to be no information on the drive from the data recovery utility. I know the information is there but how do i find it. HELP!!!!

  Read the article

• How do I get Acrobat Pro X to close files without quitting?

  - by CyberSkull

  Adobe Acrobat Pro X doesn't seem to want to relinquish files after I close them. When working on some PDFs after I save and close them, I then go to move (not copy) them to the appropriate done folder on our server. Then I get a series of errors saying that Windows cannot move the file as Acrobat Pro X has it open. Looking at the Acrobat window, the file is not loaded. Is there a way to get Acrobat Pro X to close the file like normal (without quitting the program) and actually release the file to the OS?

  Read the article

• Redirect audio from laptop to desktop over LAN

  - by Ram Rachum

  I want to be able to play a song on my laptop and have it sound through my desktop's (infinitely better) speakers. If you're familiar with Input Director: I want something that is to audio what Input Director is to mouse/keyboard. I want something that automatically redirects all audio from the laptop to the desktop in real time, and I want that solution to require, like Input Director, minimum maintenance. Beyond the initial setup, I don't want to have to babysit the program that does this. I want something that launches automatically with Windows and just works, and also allows me to cancel it whenever I want. And also doesn't go crazy when the laptop is turned on in a different network where the desktop computer isn't available. Any suggestions for such a program? (I use Windows XP on both computers.)

  Read the article

• Allow Domain Users to install software on their computers

  - by Christa

  How would I go about allowing a 'domain user' to install software on their computer. I have active directory and group policy in place. Is there a setting in group policy that would allow this? I don't really want to make the domain users domain admins as well. There is a way to do this by adding the user to their local admins group under computer management. I need this for about 50 users so that gets to be a long process with that many users. Server: Windows Server 2008 R2 Client Machines: Windows 7

  Read the article

• Windows Server 2003 - Give User Full Admin Privileges

  - by APShredder

  I am running Windows Server 2003. There are a couple of user accounts that I would like to promote to Administrator accounts. I've tried several ways to do so, but I am still relatively new to setting up a server. If anyone has any ideas on how to go about promoting these users, I thank you in advance. EDIT: I should probably mention that this a domain controller. I didn't realize that this changed the answer I was looking for. I apologize, like I said before I am new to the world of servers. EDIT #2: I've added the users to the Administrator group like most of the answer recommended, but the users don't seem to have admin rights yet. I think this might be because they are also in the Domain Users group, which I can't seem to be able to remove them from.

  Read the article

• Problem starting X in unbuntu 10.10

  - by xain

  Hi, I recently installed ubuntu 10.10 on my old toshiba a100 (where I've been running XP with no problems for ages). The installation went fine, I can log in with my user account, but after that the screen has only the wallpaper (and the mouse is enabled). Any hints on how to troubleshoot it ? These are the Xorg and the messages log files. Thanks When booted in safe graphics mode it worked just fine. Is there a way to set that configuration as the default so I don't have to go through those menus every time I boot ?

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Backup folder on sometimes attached external usb harddrive

  - by ctrler

  My girlfriend no longer has space her laptops drive to store her photos. The drive she has now is 750GB, so to go to a bigger drive would be expensive, as there isn't many 1.5tb 2.5 inch 9.5mm hdd on the market (as of now, there is only one). Because of that, I am thinking of moving her pictures to a cheap external usb hdd. As of now, I'm automatically backing up her important folders (My Documents, Pictures, etc.) using Windows 7 default backup software to a network drive. My problem is that I don't know of a good solution to automatically backup a folder residing on an usb disk. The usb disk won't be attached to the computer all the time, so I can't just treat it as a normal backup folder. Sometimes the backup would run and the folder would not be there! Anyone knows any software or methodology to backup folders on external usb hard drives that are not always present? Thanks

  Read the article

• Is SQL Express 2008 subject to the same 5 connection limitation as file sharing on Windows XP?

  - by RichieACC

  File sharing on Windows XP has a 5 client limitation. Our solution uses both file sharing and SQL Express. The way I see it, we have 2 options here: -Reload the machine that they want to use as a server with Windows Server, or; -Supply them with a dedicated NAS server, and keep their server machine on Windows XP The second option is the preferred one, for reasons I'm not going to go into. I just need to confirm that the 5 client limitation applies to the file sharing only.

  Read the article

• SSRS report font problem on deployed reports

  - by Cylindric

  I have created several reports for my SQL Server Reporting Services 2008 SP2 server, using Visual Studio 2008 on my machine. The reports objects all use Arial as their font, in various sizes and weights. When I test them in VS, all looks fine, and I can print them and export them okay. When I deploy them to the server though, they look fine on-screen and if exported to PDF, but when printed directly from the web viewer, the fonts seem to go 'missing' - all the characters are squashed together as if there was a slight negative character-offset.

  Read the article

• Cant Add Columns to a AD Task pad except for the top level of the domain

  - by Darktux

  We are working on Active Directory taskpads application for user management in our organization and facing stange issue. When we create a taskpad, and when we are at top level of the domain, i can click view - Add/Remove Columns and add "Pre Windows Name" (and lots of other properties) to the taskpad as columns, but when i just go 1 level down , i can only see "Operating System" and "Service Pack" ; why is it happening , isnt "Domain Admins" supposed to god access to all the things in AD domain , atleast of objects they own? It is important to have "Pre Windows 2000" Name as a column begause with out that our "Shell Command" task wont show up in taskpads, since its bound to parameter "Col<9" (which is pre qindows name). Please do let me know if any additions questions to clarify my problem.

  Read the article

• When does a cached website refresh?

  - by user142485

  If i go to example.com [placeholder for different website] it creates the numerous cache entries in the browser for different items on the page and two entries for example.com. One of which expires in 1.5hrs and the other has 'No expiration time.' What I am wondering is: when does the browser display the cached page and when does it get the newest version from the server (when re-visiting the site)? What do the two different expiration times for the top level domain mean? A web page I went to was temporarily redirecting to a different page. After it was back up, I was still getting redirected to the temp page even though the correct page was up. Would this have eventually resolved itself based on expiration times or does the cache need to be cleared?

  Read the article

• Import PST into Gmail

  - by John

  I'm in the process of moving my email to Gmail. I used to use Outlook and I have a massive amount of email stored in various PST files (about 7GB worth). Ultimately I'd like to store this all in Gmail so I have my entire email archive available. I imported my first PST file using Outlook's IMAP feature - dragging the folders in one by one. This worked, but was quite slow and laborious (since I had to check on it every few minutes and set the next folder going). Is there any way I can do the import - either without using Outlook, or by somehow just setting it to go and leaving it overnight without any intervention? I did look at using Google Sync for Outlook, but it looks like this will also pull down all of the email I've already uploaded, which ideally I'd like to avoid (although if this is the only option I'll do that!)

  Read the article

• Multiple Java Apps on single Server

  - by kdssea

  What is the best way to host potentially dozens of fairly trivial Java web applications on a single machine? These will be for different clients, and so having them isolated from each other is important, so that if one goes down, they don't all go down. I realize Tomcat can handle multiple apps on its own, but having them all run in a single tomcat instance sounds a little scary to me. An instance of tomcat per app also seems silly, since these apps are likely to be fairly basic. Any thoughts?

  Read the article

• Data unaccessible from WHS drive

  - by Eakraly

  Hi all, I had a Windows Home server machine that crashed. Before doing anything I decided to get data out of it. So I took the hard drive and connected it to Windows7 pc. What I get is that I cannot access almost any file! I do see directory structure, I can open small files like .txt and .ini but bigger files like .iso and video - no go. Same goes for Ubuntu and OS X - I can see files and even copy them - but they are corrupted. Any ideas for what the problem is?

  Read the article

• Data unaccessible from WHS drive

  - by Eakraly

  Hi all, I had a Windows Home server machine that crashed. Before doing anything I decided to get data out of it. So I took the hard drive and connected it to Windows7 pc. What I get is that I cannot access almost any file! I do see directory structure, I can open small files like .txt and .ini but bigger files like .iso and video - no go. Same goes for Ubuntu and OS X - I can see files and even copy them - but they are corrupted. Any ideas for what the problem is?

  Read the article

• First Linux - Ubuntu - should I change anything right away?

  - by Cyrcle

  I'm going to be getting a new system next week. I'm finally going to take the leap and run Linux as the native OS on it. Seems like a standard install of Ubuntu is the way to go for a newbie. I'm planning on 10.04 LTS. Is there anything that I should change right away that will cause me problems down the road? I'll be using this system for web development, mainly programming PHP. I'll be using my old laptop for testing with IE and Safari, at least until I either use Wine or VirtualBox to run them on the new machine. I think I'm going to force myself to learn Vim while I'm at it.

  Read the article

• Upgrading Fedora on Amazon to 12 but getting libssl.so.* & libcrypto.so.* are missing

  - by bateman_ap

  I am upgrading to Fedora 12 on a Amazon EC2 using help here: http://www.ioncannon.net/system-administration/894/fedora-12-bootable-root-ebs-on-ec2/ I managed to do a 64 bit instance OK, however facing some problems with a standard one. On the final bit of the install from 11 to 12 I am getting an error: Error: Missing Dependency: libcrypto.so.8 is needed by package httpd-tools-2.2.1.5-1.fc11.1.i586 (installed) Error: Missing Dependency: libssl.so.8 is needed by package httpd-tools-2.2.1.5-1.fc11.1.i586 (installed) This is referenced in the comments from the link above but all it says is: Q: Apache failed, or libssl.so.* & libcrypto.so.* are missing A: These versions are mssing the symlinks they require. Easy fix, go symlink them to the newest versions in /lib However I am afraid I don't know how to do this. If it is any help I tried running the command locate libssl.so and got: /lib/libssl.so.0.9.8b /lib/libssl.so.6

  Read the article

• unable to format external drive to HFS+ for Mac

  - by dtlussier

  I have an external hard drive (1 TB Western Digital) that is currently formatted as FAT32 and I want to reformat it to a single partition of HFS+ for my Mac. I realize that I can read FAT32 from my Mac but want HFS as it has other feathers like permissions that I'd like to have. I have tried using Disk Utility to format the drive as I have done in the past, but when I go through the process it fails and throws out an error stating that it is unable to reformat the drive to HFS. What might be the reasons that this could happen? Are there any diagnostics I could run on the physical disk to check if it is running well?

  Read the article

• WAMP - phpmyadmin 403 error from localhost, but not from IP 127.0.0.1?

  - by kdub

  I was wondering if anyone can explain this to me. I installed WAMP 2.2. I opened up the dashboard menu, and clicked localhost. I was brought to the WAMP localhost home page. I clicked on phpmyadmin and get a 403 access is denied error message. However, if I type in the ip address 127.0.0.1/phpmyadmin in the address bar, then VOILA, I am in (however, I am not prompted to login to phpmyadmin, I am instantly brought to the phpmyadmin homepage) Please note, I have found the solution to get rid of the 403 error message when entering phpmyadmin from the the localhost extension (change the Deny all setting to Allow all); so I am not asking how to solve that, but my question is: Why if localhost and 127.0.0.1 go to the same spot, will when using the IP addres, I am granted access to subsequent applications and with localhost I am not? Any feedback would be greatly appreciated.

  Read the article

• Excel Document Size is at 0KB, can't be opened

  - by Bassam

  After I saved an Excel document, I remembered that I needed to change something in it, so I go back to open it and it said Excel cannot open the file, because the file format or the file extension is not valid. Verify that the file has not been corrupted and that the file extension matches the format of the file. I know when I saved before, around 2hours ago, it worked just fine. The document size is at 0KB now. How do I recover this document? Its crucial for my business!

  Read the article

• How Do I Parse a String?

  - by Russ

  I am new to bash, and I am creating a script that loops through the files in a directory and based on part of the filename, does something with the file, so far I have this: #!/bin/bash DIR="/Users/me/Documents/import/*" for f in "$DIR" do $t=?????? echo "Loading $f int $t..." done so $f will output something like this: /Users/me/Documents/import/time_dim-1272037430173 out of this, I want time_dim, the directory can be variable length and -1272037430173 is a fixed length (it's the unix timestamp btw). What is the best way to go about this?

  Read the article

< Previous Page | 674 675 676 677 678 679 680 681 682 683 684 685  | Next Page >