Search Results

Search found 17407 results on 697 pages for 'static constructor'.

Page 687/697 | < Previous Page | 683 684 685 686 687 688 689 690 691 692 693 694  | Next Page >

  • Why does calling IEnumerable<string>.Count() create an additional assembly dependency ?

    - by Gishu
    Assume this chain of dll references Tests.dll >> Automation.dll >> White.Core.dll with the following line of code in Tests.dll, where everything builds result.MissingPaths Now when I change this to result.MissingPaths.Count() I get the following build error for Tests.dll "White.UIItem is not defined in an assembly that is not referenced. You must add a reference to White.Core.dll." And I don't want to do that because it breaks my layering. Here is the type definition for result, which is in Automation.dll public class HasResult { public HasResult(IEnumerable<string> missingPaths ) { MissingPaths = missingPaths; } public IEnumerable<string> MissingPaths { get; set; } public bool AllExist { get { return !MissingPaths.Any(); } } } Down the call chain the input param to this ctor is created via (The TreeNode class is in White.Core.dll) assetPaths.Where(assetPath => !FindTreeNodeUsingCache(treeHandle, assetPath)); Why does this dependency leak when calling Count() on IEnumerable ? I then suspected that lazy evaluation was causing this (for some reason) - so I slotted in an ToArray() in the above line but didn't work. Update 2011 01 07: Curiouser and Curiouser! it won't build until I add a White.Core reference. So I add a reference and build it (in order to find the elusive dependency source). Open it up in Reflector and the only references listed are Automation, mscorlib, System.core and NUnit. So the compiler threw away the White reference as it was not needed. ILDASM also confirms that there is no White AssemblyRef entry. Any ideas on how to get to the bottom of this thing (primarily for 'now I wanna know why' reasons)? What are the chances that this is an VS2010/MSBuild bug? Update 2011 01 07 #2 As per Shimmy's suggestion, tried calling the method explcitly as an extension method Enumerable.Count(result.MissingPaths) and it stops cribbing (not sure why). However I moved some code around after that and now I'm getting the same issue at a different location using IEnumerable - this time reading and filtering lines out of a file on disk (totally unrelated to White). Seems like it's a 'symptom-fix'. var lines = File.ReadLines(aFilePath).ToArray(); once again, if I remove the ToArray() it compiles again - it seems that any method that causes the enumerable to be evaluated (ToArray, Count, ToList, etc.) causes this. Let me try and get a working tiny-app to demo this issue... Update 2011 01 07 #3 Phew! More information.. It turns out the problem is just in one source file - this file is LINQ-phobic. Any call to an Enumerable extension method has to be explicitly called out. The refactorings that I did caused a new method to be moved into this source file, which had some LINQ :) Still no clue as to why this class dislikes LINQ. using System; using System.Collections.Generic; using System.IO; using System.Linq; using G.S.OurAutomation.Constants; using G.S.OurAutomation.Framework; using NUnit.Framework; namespace G.S.AcceptanceTests { public abstract class ConfigureThingBase : OurTestFixture { .... private static IEnumerable<string> GetExpectedThingsFor(string param) { // even this won't compile - although it compiles fine in an adjoining source file in the same assembly //IEnumerable<string> s = new string[0]; //Console.WriteLine(s.Count()); // this is the line that is now causing a build failure // var expectedInfo = File.ReadLines(someCsvFilePath)) // .Where(line => !line.StartsWith("REM", StringComparison.InvariantCultureIgnoreCase)) // .Select(line => line.Replace("%PLACEHOLDER%", param)) // .ToArray(); // Unrolling the LINQ above removes the build error var expectedInfo = Enumerable.ToArray( Enumerable.Select( Enumerable.Where( File.ReadLines(someCsvFilePath)), line => !line.StartsWith("REM", StringComparison.InvariantCultureIgnoreCase)), line => line.Replace("%PLACEHOLDER%", param)));

    Read the article

  • code for TouchPad works, but not for DPAD ...please help me to fix this..

    - by Chandan
    package org.coe.twoD; import android.app.Activity; import android.content.Context; import android.graphics.Canvas; import android.graphics.Color; import android.graphics.Paint; //import android.graphics.Path; import android.graphics.Rect; //import android.graphics.RectF; import android.os.Bundle; //import android.util.Log; import android.util.Log; import android.view.KeyEvent; import android.view.MotionEvent; import android.view.View; import android.view.View.OnClickListener; public class TwoD extends Activity implements OnClickListener { /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); View draw2d = findViewById(R.id.draw_button); draw2d.setOnClickListener(this); } public void onClick(View v) { if (R.id.draw_button == v.getId()) { setContentView(new draw2D(this)); } } public class draw2D extends View { private static final String TAG = "Sudoku"; private float width; // width of one tile private float height; // height of one tile private int selX; // X index of selection private int selY; // Y index of selection private final Rect selRect = new Rect(); public draw2D(Context context) { super(context); } @Override protected void onSizeChanged(int w, int h, int oldw, int oldh) { width = w / 9f; height = h / 9f; getRect(selX, selY, selRect); Log.d(TAG, "onSizeChanged: width " + width + ", height " + height); super.onSizeChanged(w, h, oldw, oldh); } @Override protected void onDraw(Canvas canvas) { // Draw the background... Paint background = new Paint(); background.setColor(getResources().getColor(R.color.background)); canvas.drawRect(0, 0, getWidth(), getHeight(), background); // Draw the board... // Define colors for the grid lines Paint dark = new Paint(); dark.setColor(getResources().getColor(R.color.dark)); Paint hilite = new Paint(); hilite.setColor(getResources().getColor(R.color.hilite)); Paint light = new Paint(); light.setColor(getResources().getColor(R.color.light)); // Draw the minor grid lines for (int i = 0; i < 9; i++) { canvas.drawLine(0, i * height, getWidth(), i * height, light); canvas.drawLine(0, i * height + 1, getWidth(), i * height + 1, hilite); canvas.drawLine(i * width, 0, i * width, getHeight(), light); canvas.drawLine(i * width + 1, 0, i * width + 1, getHeight(), hilite); } // Draw the major grid lines for (int i = 0; i < 9; i++) { if (i % 3 != 0) continue; canvas.drawLine(0, i * height, getWidth(), i * height, dark); canvas.drawLine(0, i * height + 1, getWidth(), i * height + 1, hilite); canvas.drawLine(i * width, 0, i * width, getHeight(), dark); canvas.drawLine(i * width + 1, 0, i * width + 1, getHeight(), hilite); } /* * dark.setColor(Color.MAGENTA); Path circle= new Path(); * circle.addCircle(150, 150, 100, Path.Direction.CW); * canvas.drawPath(circle, dark); * * * Path rect=new Path(); * * RectF rectf= new RectF(150,200,250,300); rect.addRect(rectf, * Path.Direction.CW); canvas.drawPath(rect, dark); * * * canvas.drawRect(0, 0,250, 250, dark); * * * canvas.drawText("Hello", 200,200, dark); */ Paint selected = new Paint(); selected.setColor(Color.GREEN); canvas.drawRect(selRect, selected); } /* * public boolean onTouchEvent(MotionEvent event){ * if(event.getAction()!=MotionEvent.ACTION_DOWN) return * super.onTouchEvent(event); * select((int)(event.getX()/width),(int)(event.getY()/height)); * * * return true; } */ private void select(int x, int y) { invalidate(selRect); selX = Math.min(Math.max(x, 0), 8); selY = Math.min(Math.max(y, 0), 8); getRect(selX, selY, selRect); invalidate(selRect); } @Override public boolean onKeyUp(int keyCode, KeyEvent event) { return super.onKeyUp(keyCode, event); } @Override public boolean onTouchEvent(MotionEvent event) { if (event.getAction() != MotionEvent.ACTION_DOWN) return super.onTouchEvent(event); select((int) (event.getX() / width), (int) (event.getY() / height)); // game.showKeypadOrError(selX, selY); Log.d(TAG, "onTouchEvent: x " + selX + ", y " + selY); return true; } @Override public boolean onKeyDown(int keyCode, KeyEvent event) { Log.d(TAG, "onKeyDown: keycode=" + keyCode + ", event=" + event); switch (keyCode) { case KeyEvent.KEYCODE_DPAD_UP: select(selX, selY - 1); break; case KeyEvent.KEYCODE_DPAD_DOWN: select(selX, selY + 1); break; case KeyEvent.KEYCODE_DPAD_LEFT: select(selX - 1, selY); break; case KeyEvent.KEYCODE_DPAD_RIGHT: select(selX + 1, selY); break; default: return super.onKeyDown(keyCode, event); } return true; } private void getRect(int x, int y, Rect rect) { rect.set((int) (x * width), (int) (y * height), (int) (x * width + width), (int) (y * height + height)); } } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • iphone - UIViewController header view errors

    - by Fiona
    Hi there, So to give a little background: I've an app that has a UITableViewController- (ContactDetailViewController) In this view at the top, I require a few labels and buttons, followed by a group style tableview. So I've created a nib file containing these elements. (ContactHeaderView.xib) Then in the viewDidLoad of ContactDetailViewController I've loaded this nib as the headerView. See implementation file below: #import "ContactDetailViewController.h" #import "DisplayInfoViewController.h" #import "ActionViewController.h" @implementation ContactDetailViewController @synthesize name; @synthesize date; @synthesize nextAction; @synthesize nameLabel; @synthesize usernameLabel; @synthesize nextActionTextField; @synthesize dateLabel; @synthesize contactInfoButton; @synthesize backgroundInfoButton; @synthesize actionDoneButton; - (void)viewDidLoad { [super viewDidLoad]; } - (void)didReceiveMemoryWarning { // Releases the view if it doesn't have a superview. [super didReceiveMemoryWarning]; // Release any cached data, images, etc that aren't in use. } - (void)viewDidUnload { // Release any retained subviews of the main view. // e.g. self.myOutlet = nil; } #pragma mark Table view methods - (NSInteger)numberOfSectionsInTableView:(UITableView *)tableView { return 1; } // Customize the number of rows in the table view. - (NSInteger)tableView:(UITableView *)tableView numberOfRowsInSection:(NSInteger)section { return 3; } - (UIView *) tableView:(UITableView *)tableView viewForHeaderInSection:(NSInteger)section { if (section == 0){ UIViewController *chv = [[[UIViewController alloc] initWithNibName:@"ContactHeaderView" bundle:nil] autorelease]; // self.nameLabel.text = self.name; return chv.view; }else{ return nil; } } - (CGFloat)tableView:(UITableView *)tableView heightForHeaderInSection:(NSInteger)section{ return 300.0; } // Customize the appearance of table view cells. - (UITableViewCell *)tableView:(UITableView *)tableView cellForRowAtIndexPath:(NSIndexPath *)indexPath { static NSString *CellIdentifier = @"Cell"; UITableViewCell *cell = [tableView dequeueReusableCellWithIdentifier:CellIdentifier]; if (cell == nil) { cell = [[[UITableViewCell alloc] initWithStyle:UITableViewCellStyleDefault reuseIdentifier:CellIdentifier] autorelease]; } // Set up the cell... return cell; } - (void)tableView:(UITableView *)tableView didSelectRowAtIndexPath:(NSIndexPath *)indexPath { // Navigation logic may go here. Create and push another view controller. // AnotherViewController *anotherViewController = [[AnotherViewController alloc] initWithNibName:@"AnotherView" bundle:nil]; // [self.navigationController pushViewController:anotherViewController]; // [anotherViewController release]; } /* // Override to support conditional editing of the table view. - (BOOL)tableView:(UITableView *)tableView canEditRowAtIndexPath:(NSIndexPath *)indexPath { // Return NO if you do not want the specified item to be editable. return YES; } */ - (void)dealloc { [name release]; [date release]; [nextAction release]; [nameLabel release]; [usernameLabel release]; [nextActionTextField release]; [dateLabel release]; [contactInfoButton release]; [backgroundInfoButton release]; [actionDoneButton release]; [super dealloc]; } -(IBAction)displayContactInfo:(id)sender{ DisplayInfoViewController *divc = [[DisplayInfoViewController alloc] init]; divc.textView = self.nextAction; divc.title = @"Contact Info"; [self.navigationController pushViewController:divc animated:YES]; [divc release]; } -(IBAction)displayBackgroundInfo:(id)sender{ DisplayInfoViewController *divc = [[DisplayInfoViewController alloc] init]; divc.textView = self.nextAction; divc.title = @"Background Info"; [self.navigationController pushViewController:divc animated:YES]; [divc release]; } -(IBAction)actionDone:(id)sender{ ActionViewController *avc = [[ActionViewController alloc] init]; avc.title = @"Action"; avc.nextAction = self.nextAction; [self.navigationController pushViewController:avc animated:YES]; [avc release]; } @end Here's the Header File: #import <UIKit/UIKit.h> @interface ContactDetailViewController : UITableViewController { NSString *name; NSString *date; NSString *nextAction; IBOutlet UILabel *nameLabel; IBOutlet UILabel *usernameLabel; IBOutlet UITextField *nextActionTextField; IBOutlet UILabel *dateLabel; IBOutlet UIButton *contactInfoButton; IBOutlet UIButton *backgroundInfoButton; IBOutlet UIButton *actionDoneButton; } @property (nonatomic, retain) NSString *name; @property (nonatomic, retain) NSString *date; @property (nonatomic, retain) NSString *nextAction; @property (nonatomic, retain) IBOutlet UILabel *nameLabel; @property (nonatomic, retain) IBOutlet UILabel *usernameLabel; @property (nonatomic, retain) IBOutlet UITextField *nextActionTextField; @property (nonatomic, retain) IBOutlet UILabel *dateLabel; @property (nonatomic, retain) IBOutlet UIButton *contactInfoButton; @property (nonatomic, retain) IBOutlet UIButton *backgroundInfoButton; @property (nonatomic, retain) IBOutlet UIButton *actionDoneButton; -(IBAction)displayContactInfo: (id)sender; -(IBAction)displayBackgroundInfo: (id)sender; -(IBAction)actionDone: (id)sender; @end However when I run it, I get the following error message: * Terminating app due to uncaught exception 'NSUnknownKeyException', reason: '[ setValue:forUndefinedKey:]: this class is not key value coding-compliant for the key nameLabel.' In IB I've hooked up the labels/buttons/textbox to the File's Owner (set the File's Owner Class to: ContactDetailViewController) Anyone any idea what I'm doing wrong? Regards, Fiona

    Read the article

  • Thread 1: Program received signal:"Sigbart"

    - by user813678
    When i try to run my app on my iPhone, I get " Thread 1: Program received signal:"Sigbart" xCode say that points to [self.navigationController pushViewController:detailViewController animated:YES]; import "RootViewController.h" import "global.h" import "golfbaner.h" @implementation RootViewController @synthesize banenavn; (void)viewDidLoad { [super viewDidLoad]; NSArray *temp = [[NSArray alloc] initWithObjects: @"Alsten Golfklubb", @"Arendal og Omegn Golfklubb", @"Asker Golfklubb", @"Askim Golfklubb", @"Atlungstad Golfklubb", @"Aurskog Golfpark", @"Ballerud Golfklubb", @"Bamble Golfklubb", @"Bergen Golfklubb", @"Bjorli Golfklubb", @"Bjørnefjorden Golfklubb", @"Bjaavann Golfklubb", @"Bodø Golfbane", @"Borre Golfbane", @"Borregaard Golfklubb", @"Brønnøysund Golfklubb", @"Byneset Golfklubb", @"Bærum Golfklubb", @"Drammen Golfklubb", @"Drøbak Golfklubb", @"Egersund Golfklubb", @"Eidskog Golfklubb", @"Eiker Golfklubb", @"Ekholt Golfklubb", @"Elverum Golfklubb", @"Fana Golfklubb", @"Fet Golfklubb", @"Frosta Golfklubb", @"Geilo Golfklubb", @"Giske Golfklubb", @"Gjerdrum Golfpark", @"Gjersjøen Golfklubb", @"Gjøvik og Toten Golfklubb", @"Gran Golfklubb", @"Grenland Golfklubb", @"Grimstad Golfklubb", @"Grini Golfklubb", @"Groruddalen Golfklubb", @"Grønmo Golfklubb", @"Hafjell Golfklubb", @"Haga Golfpark", @"Hakadal Golfklubb", @"Halden Golfklubb", @"Hallingdal Golfklubb", @"Hammerfest og Kvalsund Golfklubb", @"Hardanger Golfklubb", @"Harstad Golfklubb", @"Haugaland Golfklubb", @"Hauger Golf", @"Haugesund Golfklubb", @"Helgeland Golfklubb", @"Hemsedal Golfklubb", @"Herdla Golfklubb", @"Hitra Golfklubb", @"Hof Golfklubb", @"Holtsmark Golfklubb", @"Hovden Golfklubb", @"Hurum Golfklubb", @"Huseby og Hankø Golfklubb", @"Hvaler Golfklubb", @"Hvam Golfklubb", @"Jæren Golfklubb", @"Karasjok Golfklubb", @"Karmøy Golfklubb", @"Kjekstad Golfklubb", @"Klæbu Golfklubb", @"Kongsberg Golfklubb", @"Kongsvinger Golfklubb", @"Kragerø Golfklubb", @"Kristiansand Golfklubb", @"Kristiansund og Omegn Golfklubb", @"Krokhol Golfklubb", @"Kvinesdal og Omegn Golfklubb", @"Kvinnherad Golfklubb", @"Kvitfjell", @"Larvik Golfklubb", @"Lillehammer Golf Park", @"Lillestrøm Golfklubb", @"Lofoten Golf Links", @"Lommedalen Golfklubb", @"Losby Golfklubb", @"Lærdal Golfklubb", @"Lønne Golfklubb", @"Mandal Golfklubb", @"Meland Golfklubb", @"Midt-Troms Golfklubb", @"Miklagard Golfklubb", @"Mjøsen Golfklubb", @"Moa Golfklubb", @"Modum Golfklubb", @"Molde Golfklubb", @"Moss og Rygge Golfklubb", @"Mørk Golfklubb", @"Namdal Golfklubb", @"Namsos Golfklubb", @"Narvik Golfklubb", @"Nes Golfklubb", @"Nittedal Golfklubb", @"Nordfjord Golfklubb", @"Nordvegen Golfklubb", @"Norefjell Golfklubb", @"Norsjø og Omegn Golfklubb", @"North Cape Golf Club", @"Nærøysund Golfklubb", @"Nøtterøy Golfklubb", @"Odda Golfklubb", @"Ogna Golfklubb", @"Onsøy Golfklubb", @"Oppdal Golfklubb", @"Oppegård Golfklubb", @"Oslo Golfklubb", @"Oustøen Country Club", @"Polarsirkelen Golf", @"Preikestolen Golfklubb", @"Randaberg Golfklubb", @"Randsfjorden Golfklubb", @"Rauma Golfklubb", @"Re Golfklubb", @"Ringerike Golfklubb", @"Rygge Flystasjon Golf Club", @"Røros Golfklubb", @"Salten Golfklubb", @"Sandane Golfklubb", @"Sande Golfklubb", @"Sandefjord Golfklubb", @"Sandnes Golfklubb", @"Sauda Golfklubb", @"Selbu Golfklubb", @"Selje Golfklubb", @"Setesdal Golfklubb", @"Skei Golfklubb", @"Ski Golfklubb", @"Skjeberg Golfklubb", @"Smøla Golfklubb", @"Sola Golfklubb", @"Solastranden Golfklubb", @"Solum Golfklubb", @"Soon Golfklubb", @"Sorknes Golfklubb", @"Sotra Golfklubb", @"Stavanger Golfklubb", @"Steinkjer Golfklubb", @"Stiklestad Golfklubb", @"Stjørdal Golfklubb", @"Stord Golfklubb", @"Stranda Golfklubb", @"Stryn Golfklubb", @"Sunndal Golfklubb", @"Sunnfjord Golfklubb", @"Sunnmøre Golfklubb", @"Surnadal Golfklubb", @"Tjøme Golfklubb", @"Tromsø Golfklubb", @"Trondheim Golfklubb", @"Trysil Golfklubb", @"Tyrifjord Golfklubb", @"Ullensaker Golfklubb", @"Valdres Golfklubb", @"Vanylven Golfklubb", @"Varanger Golfklubb", @"Vesterålen Golfklubb", @"Vestfold Golfklubb", @"Vildmarken Golfklubb", @"Volda Golfklubb", @"Voss Golfklubb", @"Vrådal Golfklubb", @"Østmarka Golfklubb", @"Øya Golfpark", @"Ålesund Golfklubb", nil]; self.banenavn = temp; [temp release]; self.title = @"Golfbaner i Norge"; self.navigationController.navigationBar.barStyle = UIBarStyleBlackTranslucent; } (void)viewWillAppear:(BOOL)animated { [super viewWillAppear:animated]; } (void)viewDidAppear:(BOOL)animated { [super viewDidAppear:animated]; } (void)viewWillDisappear:(BOOL)animated { [super viewWillDisappear:animated]; } (void)viewDidDisappear:(BOOL)animated { [super viewDidDisappear:animated]; } /* // Override to allow orientations other than the default portrait orientation. - (BOOL)shouldAutorotateToInterfaceOrientation:(UIInterfaceOrientation)interfaceOrientation { // Return YES for supported orientations. return (interfaceOrientation == UIInterfaceOrientationPortrait); } */ // Customize the number of sections in the table view. - (NSInteger)numberOfSectionsInTableView:(UITableView *)tableView { return 1; } (NSInteger)tableView:(UITableView *)tableView numberOfRowsInSection:(NSInteger)section { return [banenavn count]; } // Customize the appearance of table view cells. - (UITableViewCell *)tableView:(UITableView *)tableView cellForRowAtIndexPath:(NSIndexPath *)indexPath { static NSString *CellIdentifier = @"Cell"; UITableViewCell *cell = [tableView dequeueReusableCellWithIdentifier:CellIdentifier]; if (cell == nil) { cell = [[[UITableViewCell alloc] initWithStyle:UITableViewCellStyleDefault reuseIdentifier:CellIdentifier] autorelease]; } cell.textLabel.text = [banenavn objectAtIndex:indexPath.row]; return cell; } /* // Override to support conditional editing of the table view. - (BOOL)tableView:(UITableView *)tableView canEditRowAtIndexPath:(NSIndexPath *)indexPath { // Return NO if you do not want the specified item to be editable. return YES; } */ /* // Override to support editing the table view. - (void)tableView:(UITableView *)tableView commitEditingStyle:(UITableViewCellEditingStyle)editingStyle forRowAtIndexPath:(NSIndexPath *)indexPath { if (editingStyle == UITableViewCellEditingStyleDelete) { // Delete the row from the data source. [tableView deleteRowsAtIndexPaths:[NSArray arrayWithObject:indexPath] withRowAnimation:UITableViewRowAnimationFade]; } else if (editingStyle == UITableViewCellEditingStyleInsert) { // Create a new instance of the appropriate class, insert it into the array, and add a new row to the table view. } } */ /* // Override to support rearranging the table view. - (void)tableView:(UITableView *)tableView moveRowAtIndexPath:(NSIndexPath *)fromIndexPath toIndexPath:(NSIndexPath *)toIndexPath { } */ /* // Override to support conditional rearranging of the table view. - (BOOL)tableView:(UITableView *)tableView canMoveRowAtIndexPath:(NSIndexPath *)indexPath { // Return NO if you do not want the item to be re-orderable. return YES; } */ (void)tableView:(UITableView *)tableView didSelectRowAtIndexPath:(NSIndexPath *)indexPath { golf = [banenavn objectAtIndex:indexPath.row]; golfbaner *detailViewController = [[golfbaner alloc] initWithNibName:@"Golfbaner" bundle:nil]; [self.navigationController pushViewController:detailViewController animated:YES]; [detailViewController release]; } (void)didReceiveMemoryWarning { // Releases the view if it doesn't have a superview. [super didReceiveMemoryWarning]; // Relinquish ownership any cached data, images, etc that aren't in use. } (void)viewDidUnload { [super viewDidUnload]; // Relinquish ownership of anything that can be recreated in viewDidLoad or on demand. // For example: self.myOutlet = nil; } (void)dealloc { [super dealloc]; } @end

    Read the article

  • How do implement a breadth first traversal?

    - by not looking for answer
    //This is what I have. I thought pre-order was the same and mixed it up with depth first! import java.util.LinkedList; import java.util.Queue; public class Exercise25_1 { public static void main(String[] args) { BinaryTree tree = new BinaryTree(new Integer[] {10, 5, 15, 12, 4, 8 }); System.out.print("\nInorder: "); tree.inorder(); System.out.print("\nPreorder: "); tree.preorder(); System.out.print("\nPostorder: "); tree.postorder(); //call the breadth method to test it System.out.print("\nBreadthFirst:"); tree.breadth(); } } class BinaryTree { private TreeNode root; /** Create a default binary tree */ public BinaryTree() { } /** Create a binary tree from an array of objects */ public BinaryTree(Object[] objects) { for (int i = 0; i < objects.length; i++) { insert(objects[i]); } } /** Search element o in this binary tree */ public boolean search(Object o) { return search(o, root); } public boolean search(Object o, TreeNode root) { if (root == null) { return false; } if (root.element.equals(o)) { return true; } else { return search(o, root.left) || search(o, root.right); } } /** Return the number of nodes in this binary tree */ public int size() { return size(root); } public int size(TreeNode root) { if (root == null) { return 0; } else { return 1 + size(root.left) + size(root.right); } } /** Return the depth of this binary tree. Depth is the * number of the nodes in the longest path of the tree */ public int depth() { return depth(root); } public int depth(TreeNode root) { if (root == null) { return 0; } else { return 1 + Math.max(depth(root.left), depth(root.right)); } } /** Insert element o into the binary tree * Return true if the element is inserted successfully */ public boolean insert(Object o) { if (root == null) { root = new TreeNode(o); // Create a new root } else { // Locate the parent node TreeNode parent = null; TreeNode current = root; while (current != null) { if (((Comparable)o).compareTo(current.element) < 0) { parent = current; current = current.left; } else if (((Comparable)o).compareTo(current.element) > 0) { parent = current; current = current.right; } else { return false; // Duplicate node not inserted } } // Create the new node and attach it to the parent node if (((Comparable)o).compareTo(parent.element) < 0) { parent.left = new TreeNode(o); } else { parent.right = new TreeNode(o); } } return true; // Element inserted } public void breadth() { breadth(root); } // Implement this method to produce a breadth first // search traversal public void breadth(TreeNode root){ if (root == null) return; System.out.print(root.element + " "); breadth(root.left); breadth(root.right); } /** Inorder traversal */ public void inorder() { inorder(root); } /** Inorder traversal from a subtree */ private void inorder(TreeNode root) { if (root == null) { return; } inorder(root.left); System.out.print(root.element + " "); inorder(root.right); } /** Postorder traversal */ public void postorder() { postorder(root); } /** Postorder traversal from a subtree */ private void postorder(TreeNode root) { if (root == null) { return; } postorder(root.left); postorder(root.right); System.out.print(root.element + " "); } /** Preorder traversal */ public void preorder() { preorder(root); } /** Preorder traversal from a subtree */ private void preorder(TreeNode root) { if (root == null) { return; } System.out.print(root.element + " "); preorder(root.left); preorder(root.right); } /** Inner class tree node */ private class TreeNode { Object element; TreeNode left; TreeNode right; public TreeNode(Object o) { element = o; } } }

    Read the article

  • adjust selected File to FileFilter in a JFileChooser

    - by amarillion
    I'm writing a diagram editor in java. This app has the option to export to various standard image formats such as .jpg, .png etc. When the user clicks File-Export, you get a JFileChooser which has a number of FileFilters in it, for .jpg, .png etc. Now here is my question: Is there a way to have the extension of the default adjust to the selected file filter? E.g. if the document is named "lolcat" then the default option should be "lolcat.png" when the png filter is selected, and when the user selects the jpg file filter, the default should change to "lolcat.jpg" automatically. Is this possible? How can I do it? edit: Based on the answer below, I wrote some code. But it doesn't quite work yet. I've added a propertyChangeListener to the FILE_FILTER_CHANGED_PROPERTY, but it seems that within this method getSelectedFile() returns null. Here is the code. package nl.helixsoft; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import java.beans.PropertyChangeEvent; import java.beans.PropertyChangeListener; import java.io.File; import java.util.ArrayList; import java.util.List; import javax.swing.JButton; import javax.swing.JFileChooser; import javax.swing.JFrame; import javax.swing.filechooser.FileFilter; public class JFileChooserTest { public class SimpleFileFilter extends FileFilter { private String desc; private List<String> extensions; private boolean showDirectories; /** * @param name example: "Data files" * @param glob example: "*.txt|*.csv" */ public SimpleFileFilter (String name, String globs) { extensions = new ArrayList<String>(); for (String glob : globs.split("\\|")) { if (!glob.startsWith("*.")) throw new IllegalArgumentException("expected list of globs like \"*.txt|*.csv\""); // cut off "*" // store only lower case (make comparison case insensitive) extensions.add (glob.substring(1).toLowerCase()); } desc = name + " (" + globs + ")"; } public SimpleFileFilter(String name, String globs, boolean showDirectories) { this(name, globs); this.showDirectories = showDirectories; } @Override public boolean accept(File file) { if(showDirectories && file.isDirectory()) { return true; } String fileName = file.toString().toLowerCase(); for (String extension : extensions) { if (fileName.endsWith (extension)) { return true; } } return false; } @Override public String getDescription() { return desc; } /** * @return includes '.' */ public String getFirstExtension() { return extensions.get(0); } } void export() { String documentTitle = "lolcat"; final JFileChooser jfc = new JFileChooser(); jfc.setDialogTitle("Export"); jfc.setDialogType(JFileChooser.SAVE_DIALOG); jfc.setSelectedFile(new File (documentTitle)); jfc.addChoosableFileFilter(new SimpleFileFilter("JPEG", "*.jpg")); jfc.addChoosableFileFilter(new SimpleFileFilter("PNG", "*.png")); jfc.addPropertyChangeListener(JFileChooser.FILE_FILTER_CHANGED_PROPERTY, new PropertyChangeListener() { public void propertyChange(PropertyChangeEvent arg0) { System.out.println ("Property changed"); String extold = null; String extnew = null; if (arg0.getOldValue() == null || !(arg0.getOldValue() instanceof SimpleFileFilter)) return; if (arg0.getNewValue() == null || !(arg0.getNewValue() instanceof SimpleFileFilter)) return; SimpleFileFilter oldValue = ((SimpleFileFilter)arg0.getOldValue()); SimpleFileFilter newValue = ((SimpleFileFilter)arg0.getNewValue()); extold = oldValue.getFirstExtension(); extnew = newValue.getFirstExtension(); String filename = "" + jfc.getSelectedFile(); System.out.println ("file: " + filename + " old: " + extold + ", new: " + extnew); if (filename.endsWith(extold)) { filename.replace(extold, extnew); } else { filename += extnew; } jfc.setSelectedFile(new File (filename)); } }); jfc.showDialog(frame, "export"); } JFrame frame; void run() { frame = new JFrame(); JButton btn = new JButton ("export"); frame.add (btn); btn.addActionListener (new ActionListener() { public void actionPerformed(ActionEvent ae) { export(); } }); frame.setSize (300, 300); frame.pack(); frame.setVisible(true); } public static void main(String[] args) { javax.swing.SwingUtilities.invokeLater(new Runnable() { public void run() { JFileChooserTest x = new JFileChooserTest(); x.run(); } }); } }

    Read the article

  • JSF 2.1 Spring 3.0 Integration

    - by danny.lesnik
    I'm trying to make very simple Spring 3 + JSF2.1 integration according to examples I googled in the web. So here is my code: My HTML submitted to actionController.actionSubmitted() method: <h:form> <h:message for="textPanel" style="color:red;" /> <h:panelGrid columns="3" rows="5" id="textPanel"> //all my bean prperties mapped to HTML code. </h:panelGrid> <h:commandButton value="Submit" action="#{actionController.actionSubmitted}" /> </h:form> now the Action Controller itself: @ManagedBean(name="actionController") @SessionScoped public class ActionController implements Serializable{ @ManagedProperty(value="#{user}") User user; @ManagedProperty(value="#{mailService}") MailService mailService; public void setMailService(MailService mailService) { this.mailService = mailService; } public void setUser(User user) { this.user = user; } private static final long serialVersionUID = 1L; public ActionController() {} public String actionSubmitted(){ System.out.println(user.getEmail()); mailService.sendUserMail(user); return "success"; } } Now my bean Spring: public interface MailService { void sendUserMail(User user); } public class MailServiceImpl implements MailService{ @Override public void sendUserMail(User user) { System.out.println("Mail to "+user.getEmail()+" sent." ); } } This is my web.xml <listener> <listener-class> org.springframework.web.context.ContextLoaderListener </listener-class> </listener> <listener> <listener-class> org.springframework.web.context.request.RequestContextListener </listener-class> </listener> <!-- Welcome page --> <welcome-file-list> <welcome-file>index.xhtml</welcome-file> </welcome-file-list> <!-- JSF mapping --> <servlet> <servlet-name>Faces Servlet</servlet-name> <servlet-class>javax.faces.webapp.FacesServlet</servlet-class> <load-on-startup>1</load-on-startup> </servlet> my applicationContext.xml <beans xmlns="http://www.springframework.org/schema/beans" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://www.springframework.org/schema/beans http://www.springframework.org/schema/beans/spring-beans-3.0.xsd"> <bean id="mailService" class="com.vanilla.jsf.services.MailServiceImpl"> </bean> </beans> my faces-config.xml is the following: <application> <el-resolver> org.springframework.web.jsf.el.SpringBeanFacesELResolver </el-resolver> <message-bundle> com.vanilla.jsf.validators.MyMessages </message-bundle> </application> <managed-bean> <managed-bean-name>actionController</managed-bean-name> <managed-bean-class>com.vanilla.jsf.controllers.ActionController</managed-bean-class> <managed-bean-scope>session</managed-bean-scope> <managed-property> <property-name>mailService</property-name> <value>#{mailService}</value> </managed-property> </managed-bean> <navigation-rule> <from-view-id>index.xhtml</from-view-id> <navigation-case> <from-action>#{actionController.actionSubmitted}</from-action> <from-outcome>success</from-outcome> <to-view-id>submitted.xhtml</to-view-id> <redirect /> </navigation-case> </navigation-rule> My Problem is that I'm getting NullPointerExeption because my mailService Spring bean is null. public String actionSubmitted(){ System.out.println(user.getEmail()); //mailService is null Getting NullPointerException mailService.sendUserMail(user); return "success"; }

    Read the article

  • login form whith java/sqlite

    - by tuxou
    hi I would like to create a login form for my application with the possibility to add or remove users for an sqlite database, i have created the table users(nam, pass) but i can't unclud it in my login form, it someone could help me this is my login code: import java.awt.*; import java.awt.event.*; import javax.swing.*; public class login extends JFrame { // Variables declaration private JLabel jLabel1; private JLabel jLabel2; private JTextField jTextField1; private JPasswordField jPasswordField1; private JButton jButton1; private JPanel contentPane; // End of variables declaration public login() { super(); create(); this.setVisible(true); } private void create() { jLabel1 = new JLabel(); jLabel2 = new JLabel(); jTextField1 = new JTextField(); jPasswordField1 = new JPasswordField(); jButton1 = new JButton(); contentPane = (JPanel)this.getContentPane(); // // jLabel1 // jLabel1.setHorizontalAlignment(SwingConstants.LEFT); jLabel1.setForeground(new Color(0, 0, 255)); jLabel1.setText("username:"); // // jLabel2 // jLabel2.setHorizontalAlignment(SwingConstants.LEFT); jLabel2.setForeground(new Color(0, 0, 255)); jLabel2.setText("password:"); // // jTextField1 // jTextField1.setForeground(new Color(0, 0, 255)); jTextField1.setSelectedTextColor(new Color(0, 0, 255)); jTextField1.setToolTipText("Enter your username"); jTextField1.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { jTextField1_actionPerformed(e); } }); // // jPasswordField1 // jPasswordField1.setForeground(new Color(0, 0, 255)); jPasswordField1.setToolTipText("Enter your password"); jPasswordField1.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { jPasswordField1_actionPerformed(e); } }); // // jButton1 // jButton1.setBackground(new Color(204, 204, 204)); jButton1.setForeground(new Color(0, 0, 255)); jButton1.setText("Login"); jButton1.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { jButton1_actionPerformed(e); } }); // // contentPane // contentPane.setLayout(null); contentPane.setBorder(BorderFactory.createEtchedBorder()); contentPane.setBackground(new Color(204, 204, 204)); addComponent(contentPane, jLabel1, 5,10,106,18); addComponent(contentPane, jLabel2, 5,47,97,18); addComponent(contentPane, jTextField1, 110,10,183,22); addComponent(contentPane, jPasswordField1, 110,45,183,22); addComponent(contentPane, jButton1, 150,75,83,28); // // login // this.setTitle("Login To Members Area"); this.setLocation(new Point(76, 182)); this.setSize(new Dimension(335, 141)); this.setDefaultCloseOperation(WindowConstants.EXIT_ON_CLOSE); this.setResizable(false); } /** Add Component Without a Layout Manager (Absolute Positioning) */ private void addComponent(Container container,Component c,int x,int y,int width,int height) { c.setBounds(x,y,width,height); container.add(c); } private void jTextField1_actionPerformed(ActionEvent e) { } private void jPasswordField1_actionPerformed(ActionEvent e) { } private void jButton1_actionPerformed(ActionEvent e) { System.out.println("\njButton1_actionPerformed(ActionEvent e) called."); String username = new String(jTextField1.getText()); String password = new String(jPasswordField1.getText()); if(username.equals("") || password.equals("")) // If password and username is empty Do this { jButton1.setEnabled(false); JLabel errorFields = new JLabel("You must enter a username and password to login."); JOptionPane.showMessageDialog(null,errorFields); jTextField1.setText(""); jPasswordField1.setText(""); jButton1.setEnabled(true); this.setVisible(true); } else { JLabel optionLabel = new JLabel("You entered "+username+" as your username. Is this correct?"); int confirm =JOptionPane.showConfirmDialog(null,optionLabel); switch(confirm){ // Switch Case case JOptionPane.YES_OPTION: // Attempt to Login user jButton1.setEnabled(false); // Set button enable to false to prevent 2 login attempts break; case JOptionPane.NO_OPTION: // No Case.(Go back. Set text to 0) jButton1.setEnabled(false); jTextField1.setText(""); jPasswordField1.setText(""); jButton1.setEnabled(true); break; case JOptionPane.CANCEL_OPTION: // Cancel Case.(Go back. Set text to 0) jButton1.setEnabled(false); jTextField1.setText(""); jPasswordField1.setText(""); jButton1.setEnabled(true); break; } // End Switch Case } } public static void main(String[] args) { JFrame.setDefaultLookAndFeelDecorated(true); JDialog.setDefaultLookAndFeelDecorated(true); try { UIManager.setLookAndFeel("com.sun.java.swing.plaf.windows.WindowsLookAndFeel"); } catch (Exception ex) { System.out.println("Failed loading L&F: "); System.out.println(ex); } new login(); }; }

    Read the article

  • Help required in adding new methods, properties into existing classes dynamically

    - by Bepenfriends
    Hi All, I am not sure whether it is possible to achieve this kind of implementation in Dot Net. Below are the information Currently we are on an application which is done in COM+, ASP, XSL, XML technologies. It is a multi tier architecture application in which COM+ acts as the BAL. The execution steps for any CRUD operation will be defined using a seperate UI which uses XML to store the information. BAL reads the XML and understands the execution steps which are defined and executes corresponding methods in DLL. Much like EDM we have our custom model (using XML) which determines which property of object is searchable, retrievable etc. Based on this information BAL constructs queries and calls procedures to get the data. In the current application both BAL and DAL are heavily customizable without doing any code change. the results will be transmitted to presentation layer in XML format which constructs the UI based on the data recieved. Now I am creating a migration project which deals with employee information. It is also going to follow the N Tier architecture in which the presentation layer communicates with BAL which connects to DAL to return the Data. Here is the problem, In our existing version we are handling every information as XML in its native form (no converstion of object etc), but in the migration project, Team is really interested in utilizing the OOP model of development where every information which is sent from BAL need to be converted to objects of its respective types (example employeeCollection, Address Collection etc). If we have the static number of data returned from BAL we can have a class which contains those nodes as properties and we can access the same. But in our case the data returned from our BAL need to be customized. How can we handle the customization in presentation layer which is converting the result to an Object. Below is an example of the XML returned <employees> <employee> <firstName>Employee 1 First Name</firstName> <lastName>Employee 1 Last Name</lastName> <addresses> <address> <addressType>1</addressType> <StreetName>Street name1</StreetName> <RegionName>Region name</RegionName> <address> <address> <addressType>2</addressType> <StreetName>Street name2</StreetName> <RegionName>Region name</RegionName> <address> <address> <addressType>3</addressType> <StreetName>Street name3</StreetName> <RegionName>Region name</RegionName> <address> <addresses> </employee> <employee> <firstName>Employee 2 First Name</firstName> <lastName>Employee 2 Last Name</lastName> <addresses> <address> <addressType>1</addressType> <StreetName>Street name1</StreetName> <RegionName>Region name</RegionName> <address> <address> <addressType>2</addressType> <StreetName>Street name2</StreetName> <RegionName>Region name</RegionName> <address> <addresses> </employee> </employees> If these are the only columns then i can write a class which is like public class Address{ public int AddressType {get;set;}; public string StreetName {get;set;}; public string RegionName {get;set;}; } public class Employee{ public string FirstName {get; set;} public string LastName {get; set;} public string AddressCollection {get; set;} } public class EmployeeCollection : List<Employee>{ public bool Add (Employee Data){ .... } } public class AddressCollection : List<Address>{ public bool Add (Address Data){ .... } } This class will be provided to customers and consultants as DLLs. We will not provide the source code for the same. Now when the consultants or customers does customization(example adding country to address and adding passport information object with employee object) they must be able to access those properties in these classes, but without source code they will not be able to do those modifications.which makes the application useless. Is there is any way to acomplish this in DotNet. I thought of using Anonymous classes but, the problem with Anonymous classes are we can not have methods in it. I am not sure how can i fit the collection objects (which will be inturn an anonymous class) Not sure about datagrid / user control binding etc. I also thought of using CODEDom to create classes runtime but not sure about the meory, performance issues. also the classes must be created only once and must use the same till there is another change. Kindly help me out in this problem. Any kind of help meterial/ cryptic code/ links will be helpful.

    Read the article

  • Pointers to Derived Class Objects Losing vfptr

    - by duckworthd
    To begin, I am trying to write a run-of-the-mill, simple Ray Tracer. In my Ray Tracer, I have multiple types of geometries in the world, all derived from a base class called "SceneObject". I've included the header for it here. /** Interface for all objects that will appear in a scene */ class SceneObject { public: mat4 M, M_inv; Color c; SceneObject(); ~SceneObject(); /** The transformation matrix to be applied to all points of this object. Identity leaves the object in world frame. */ void setMatrix(mat4 M); void setMatrix(MatrixStack mStack); void getMatrix(mat4& M); /** The color of the object */ void setColor(Color c); void getColor(Color& c); /** Alter one portion of the color, leaving the rest as they were. */ void setDiffuse(vec3 rgb); void setSpecular(vec3 rgb); void setEmission(vec3 rgb); void setAmbient(vec3 rgb); void setShininess(double s); /** Fills 'inter' with information regarding an intersection between this object and 'ray'. Ray should be in world frame. */ virtual void intersect(Intersection& inter, Ray ray) = 0; /** Returns a copy of this SceneObject */ virtual SceneObject* clone() = 0; /** Print information regarding this SceneObject for debugging */ virtual void print() = 0; }; As you can see, I've included a couple virtual functions to be implemented elsewhere. In this case, I have only two derived class -- Sphere and Triangle, both of which implement the missing member functions. Finally, I have a Parser class, which is full of static methods that do the actual "Ray Tracing" part. Here's a couple snippets for relevant portions void Parser::trace(Camera cam, Scene scene, string outputFile, int maxDepth) { int width = cam.getNumXPixels(); int height = cam.getNumYPixels(); vector<vector<vec3>> colors; colors.clear(); for (int i = 0; i< width; i++) { vector<vec3> ys; for (int j = 0; j<height; j++) { Intersection intrsct; Ray ray; cam.getRay(ray, i, j); vec3 color; printf("Obtaining color for Ray[%d,%d]\n", i,j); getColor(color, scene, ray, maxDepth); ys.push_back(color); } colors.push_back(ys); } printImage(colors, width, height, outputFile); } void Parser::getColor(vec3& color, Scene scene, Ray ray, int numBounces) { Intersection inter; scene.intersect(inter,ray); if(inter.isIntersecting()){ Color c; inter.getColor(c); c.getAmbient(color); } else { color = vec3(0,0,0); } } Right now, I've forgone the true Ray Tracing part and instead simply return the color of the first object hit, if any. As you have no doubt noticed, the only way the computer knows that a ray has intersected an object is through Scene.intersect(), which I also include. void Scene::intersect(Intersection& i, Ray r) { Intersection result; result.setDistance(numeric_limits<double>::infinity()); result.setIsIntersecting(false); double oldDist; result.getDistance(oldDist); /* Cycle through all objects, making result the closest one */ for(int ind=0; ind<objects.size(); ind++){ SceneObject* thisObj = objects[ind]; Intersection betterIntersect; thisObj->intersect(betterIntersect, r); double newDist; betterIntersect.getDistance(newDist); if (newDist < oldDist){ result = betterIntersect; oldDist = newDist; } } i = result; } Alright, now for the problem. I begin by creating a scene and filling it with objects outside of the Parser::trace() method. Now for some odd reason, I cast Ray for i=j=0 and everything works wonderfully. However, by the time the second ray is cast all of the objects stored in my Scene no longer recognize their vfptr's! I stepped through the code with a debugger and found that the information to all the vfptr's are lost somewhere between the end of getColor() and the continuation of the loop. However, if I change the arguments of getColor() to use a Scene& instead of a Scene, then no loss occurs. What crazy voodoo is this?

    Read the article

  • XML over HTTP with JMS and Spring

    - by Will Sumekar
    I have a legacy HTTP server where I need to send an XML file over HTTP request (POST) using Java (not browser) and the server will respond with another XML in its HTTP response. It is similar to Web Service but there's no WSDL and I have to follow the existing XML structure to construct my XML to be sent. I have done a research and found an example that matches my requirement here. The example uses HttpClient from Apache Commons. (There are also other examples I found but they use java.net networking package (like URLConnection) which is tedious so I don't want to use them). But it's also my requirement to use Spring and JMS. I know from Spring's reference that it's possible to combine HttpClient, JMS and Spring. My question is, how? Note that it's NOT in my requirement to use HttpClient. If you have a better suggestion, I'm welcome. Appreciate it. For your reference, here's the XML-over-HTTP example I've been talking about: /* * $Header: * $Revision$ * $Date$ * ==================================================================== * * Copyright 2002-2004 The Apache Software Foundation * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. * You may obtain a copy of the License at * * http://www.apache.org/licenses/LICENSE-2.0 * * Unless required by applicable law or agreed to in writing, software * distributed under the License is distributed on an "AS IS" BASIS, * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. * See the License for the specific language governing permissions and * limitations under the License. * ==================================================================== * * This software consists of voluntary contributions made by many * individuals on behalf of the Apache Software Foundation. For more * information on the Apache Software Foundation, please see * <http://www.apache.org/>. * * [Additional notices, if required by prior licensing conditions] * */ import java.io.File; import java.io.FileInputStream; import org.apache.commons.httpclient.HttpClient; import org.apache.commons.httpclient.methods.InputStreamRequestEntity; import org.apache.commons.httpclient.methods.PostMethod; /** * * This is a sample application that demonstrates * how to use the Jakarta HttpClient API. * * This application sends an XML document * to a remote web server using HTTP POST * * @author Sean C. Sullivan * @author Ortwin Glück * @author Oleg Kalnichevski */ public class PostXML { /** * * Usage: * java PostXML http://mywebserver:80/ c:\foo.xml * * @param args command line arguments * Argument 0 is a URL to a web server * Argument 1 is a local filename * */ public static void main(String[] args) throws Exception { if (args.length != 2) { System.out.println( "Usage: java -classpath <classpath> [-Dorg.apache.commons."+ "logging.simplelog.defaultlog=<loglevel>]" + " PostXML <url> <filename>]"); System.out.println("<classpath> - must contain the "+ "commons-httpclient.jar and commons-logging.jar"); System.out.println("<loglevel> - one of error, "+ "warn, info, debug, trace"); System.out.println("<url> - the URL to post the file to"); System.out.println("<filename> - file to post to the URL"); System.out.println(); System.exit(1); } // Get target URL String strURL = args[0]; // Get file to be posted String strXMLFilename = args[1]; File input = new File(strXMLFilename); // Prepare HTTP post PostMethod post = new PostMethod(strURL); // Request content will be retrieved directly // from the input stream // Per default, the request content needs to be buffered // in order to determine its length. // Request body buffering can be avoided when // content length is explicitly specified post.setRequestEntity(new InputStreamRequestEntity( new FileInputStream(input), input.length())); // Specify content type and encoding // If content encoding is not explicitly specified // ISO-8859-1 is assumed post.setRequestHeader( "Content-type", "text/xml; charset=ISO-8859-1"); // Get HTTP client HttpClient httpclient = new HttpClient(); // Execute request try { int result = httpclient.executeMethod(post); // Display status code System.out.println("Response status code: " + result); // Display response System.out.println("Response body: "); System.out.println(post.getResponseBodyAsString()); } finally { // Release current connection to the connection pool // once you are done post.releaseConnection(); } } }

    Read the article

  • How can I keep a graphics object centered (like a circle) when zooming in or out on it?

    - by sonny5
    using System; using System.Drawing; using System.Collections; using System.ComponentModel; using System.Windows.Forms; using System.Data; using System.Drawing.Drawing2D; using System.Drawing.Imaging; namespace testgrfx { public class Form1 : System.Windows.Forms.Form { float m_Scalef; float m_Scalefout; Rectangle m_r1; private System.Windows.Forms.Button button2; private System.Windows.Forms.Button button3; private System.ComponentModel.Container components = null; private void InitializeComponent() { m_Scalef = 1.0f; // for zooming purposes Console.WriteLine("opening m_Scalef= {0}",m_Scalef); m_Scalefout = 1.0f; Console.WriteLine("opening m_Scalefout= {0}",m_Scalefout); m_r1 = new Rectangle(50,50,100,100); this.AutoScrollMinSize = new Size(600,700); this.components = new System.ComponentModel.Container(); this.button2 = new System.Windows.Forms.Button(); this.button2.BackColor = System.Drawing.Color.LightGray; this.button2.Location = new System.Drawing.Point(120, 30); this.button2.Name = "button2"; this.button2.Size = new System.Drawing.Size(72, 24); this.button2.TabIndex = 1; this.button2.Text = "Zoom In"; this.button2.Click += new System.EventHandler(this.mnuZoomin_Click); this.Controls.Add(button2); this.button3 = new System.Windows.Forms.Button(); this.button3.BackColor = System.Drawing.Color.LightGray; this.button3.Location = new System.Drawing.Point(200, 30); this.button3.Name = "button3"; this.button3.Size = new System.Drawing.Size(72, 24); this.button3.TabIndex = 2; this.button3.Text = "Zoom Out"; this.button3.Click += new System.EventHandler(this.mnuZoomout_Click); this.Controls.Add(button3); //InitMyForm(); } public Form1() { InitializeComponent(); Text = " DrawLine"; BackColor = SystemColors.Window; // Gotta load these kind at start-up ... not with button assignments this.Paint+=new PaintEventHandler(this.Form1_Paint); } static void Main() { Application.Run(new Form1()); } /// Clean up any resources being used. protected override void Dispose( bool disposing ) { if( disposing ) { if (components != null) { components.Dispose(); } } base.Dispose( disposing ); } // autoscroll2.cs does work private void Form1_Paint(object sender, System.Windows.Forms.PaintEventArgs e) { Graphics dc = e.Graphics; dc.PageUnit = GraphicsUnit.Pixel; dc.PageScale = m_Scalef; Console.WriteLine("opening dc.PageScale= {0}",dc.PageScale); dc.TranslateTransform(this.AutoScrollPosition.X/m_Scalef, this.AutoScrollPosition.Y/m_Scalef); Pen pn = new Pen(Color.Blue,2); dc.DrawEllipse(pn,m_r1); Console.WriteLine("form_paint_dc.PageUnit= {0}",dc.PageUnit); Console.WriteLine("form_paint_dc.PageScale= {0}",dc.PageScale); //Console.Out.NewLine = "\r\n\r\n"; // makes all double spaces } private void mnuZoomin_Click(object sender, System.EventArgs e) { m_Scalef = m_Scalef * 2.0f; Console.WriteLine("in mnuZoomin_Click m_Scalef= {0}",m_Scalef); Invalidate(); // to trigger Paint of entire client area } // try: System.Drawing.Rectangle resolution = Screen.GetWorkingArea(someForm); private void Form1_MouseDown(object sender, System.Windows.Forms.MouseEventArgs e) { // Uses the mouse wheel to scroll Graphics dc = CreateGraphics(); dc.TranslateTransform(this.AutoScrollPosition.X/m_Scalef, this.AutoScrollPosition.Y/m_Scalef); Console.WriteLine("opening Form1_MouseDown dc.PageScale= {0}", dc.PageScale); Console.WriteLine("Y wheel= {0}", this.AutoScrollPosition.Y/m_Scalef); dc.PageUnit = GraphicsUnit.Pixel; dc.PageScale = m_Scalef; Console.WriteLine("frm1_moudwn_dc.PageScale= {0}",dc.PageScale); Point [] mousep = new Point[1]; Console.WriteLine("mousep= {0}", mousep); // make sure to adjust mouse pos.for scroll position Size scrollOffset = new Size(this.AutoScrollPosition); mousep[0] = new Point(e.X-scrollOffset.Width, e.Y-scrollOffset.Height); dc.TransformPoints(CoordinateSpace.Page, CoordinateSpace.Device,mousep); Pen pen = new Pen(Color.Green,1); dc.DrawRectangle(pen,m_r1); Console.WriteLine("m_r1= {0}", m_r1); Console.WriteLine("mousep[0].X= {0}", mousep[0].X); Console.WriteLine("mousep[0].Y= {0}", mousep[0].Y); if (m_r1.Contains(new Rectangle(mousep[0].X, mousep[0].Y,1,1))) MessageBox.Show("click inside rectangle"); } private void Form1_Load(object sender, System.EventArgs e) { } private void mnuZoomout_Click(object sender, System.EventArgs e) { Console.WriteLine("first line--mnuZoomout_Click m_Scalef={0}",m_Scalef); if(m_Scalef > 9 ) { m_Scalef = m_Scalef / 2.0f; Console.WriteLine("in >9 mnuZoomout_Click m_Scalef= {0}",m_Scalef); Console.WriteLine("in >9 mnuZoomout_Click__m_Scalefout= {0}",m_Scalefout); } else { Console.WriteLine("<= 9_Zoom-out B-4 redefining={0}",m_Scalef); m_Scalef = m_Scalef * 0.5f; // make it same as previous Zoom In Console.WriteLine("<= 9_Zoom-out after m_Scalef= {0}",m_Scalef); } Invalidate(); } } // public class Form1 }

    Read the article

  • App crashes when adding array data to table cells

    - by bassmandan
    I am trying to create a table view that loads a number of tweets into the table (one per cell etc). I am using NSXMLParser to get the information and have got as far as creating an array with the selection of tweets that I want. However, when I try to add them to the table cells, the app crashes on the line: cell.textLabel.text = cellValue; An NSLog before this shows in the console that the app is getting the correct data, so I am a bit stumped as to why this isn't working. This is the block of code that appears to be having the problem: - (UITableViewCell *)tableView:(UITableView *)tableView cellForRowAtIndexPath:(NSIndexPath *)indexPath { static NSString *CellIdentifier = @"Cell"; UITableViewCell *cell = [tableView dequeueReusableCellWithIdentifier:CellIdentifier]; if (cell == nil) { cell = [[UITableViewCell alloc] initWithStyle:UITableViewCellStyleDefault reuseIdentifier:CellIdentifier]; } // Set up the cell... NSString *cellValue = [statuses objectAtIndex:indexPath.row]; NSLog(@"%@", cellValue); cell.textLabel.text = cellValue; return cell;} If it makes a difference, I am using ARC and the latest version of XCode. I'm still quite new to all this, so if I need to give some extra information, let me know. Thanks in advance. Edit: Backtrace gives the following: * thread #1: tid = 0x2003, 0x918a19c6 libsystem_kernel.dylib`__pthread_kill + 10, stop reason = signal SIGABRT frame #0: 0x918a19c6 libsystem_kernel.dylib`__pthread_kill + 10 frame #1: 0x9968ff78 libsystem_c.dylib`pthread_kill + 106 frame #2: 0x99680bdd libsystem_c.dylib`abort + 167 frame #3: 0x03c93e78 libc++abi.dylib`_Unwind_DeleteException frame #4: 0x03c9189e libc++abi.dylib`_ZL17default_terminatev + 34 frame #5: 0x0154df4b libobjc.A.dylib`_objc_terminate + 94 frame #6: 0x03c918de libc++abi.dylib`_ZL19safe_handler_callerPFvvE + 13 frame #7: 0x03c91946 libc++abi.dylib`std::terminate() + 23 frame #8: 0x03c92ab2 libc++abi.dylib`__cxa_throw + 110 frame #9: 0x0154de15 libobjc.A.dylib`objc_exception_throw + 311 frame #10: 0x013bdced CoreFoundation`-[NSObject doesNotRecognizeSelector:] + 253 frame #11: 0x01322f00 CoreFoundation`___forwarding___ + 432 frame #12: 0x01322ce2 CoreFoundation`_CF_forwarding_prep_0 + 50 frame #13: 0x0015168f UIKit`-[UILabel setText:] + 56 frame #14: 0x00003088 Twitter`-[TwitterViewController tableView:cellForRowAtIndexPath:] + 376 at TwitterViewController.m:131 frame #15: 0x000ace0f UIKit`-[UITableView(UITableViewInternal) _createPreparedCellForGlobalRow:withIndexPath:] + 494 frame #16: 0x000ad589 UIKit`-[UITableView(UITableViewInternal) _createPreparedCellForGlobalRow:] + 69 frame #17: 0x00098dfd UIKit`-[UITableView(_UITableViewPrivate) _updateVisibleCellsNow:] + 1350 frame #18: 0x000a7851 UIKit`-[UITableView layoutSubviews] + 242 frame #19: 0x00052301 UIKit`-[UIView(CALayerDelegate) layoutSublayersOfLayer:] + 145 frame #20: 0x013bde72 CoreFoundation`-[NSObject performSelector:withObject:] + 66 frame #21: 0x01d6692d QuartzCore`-[CALayer layoutSublayers] + 266 frame #22: 0x01d70827 QuartzCore`CA::Layer::layout_if_needed(CA::Transaction*) + 231 frame #23: 0x01cf6fa7 QuartzCore`CA::Context::commit_transaction(CA::Transaction*) + 377 frame #24: 0x01cf8ea6 QuartzCore`CA::Transaction::commit() + 374 frame #25: 0x01d8430c QuartzCore`+[CATransaction flush] + 52 frame #26: 0x000124c6 UIKit`-[UIApplication _reportAppLaunchFinished] + 39 frame #27: 0x00012bd6 UIKit`-[UIApplication _runWithURL:payload:launchOrientation:statusBarStyle:statusBarHidden:] + 1324 frame #28: 0x00021743 UIKit`-[UIApplication handleEvent:withNewEvent:] + 1027 frame #29: 0x000221f8 UIKit`-[UIApplication sendEvent:] + 68 frame #30: 0x00015aa9 UIKit`_UIApplicationHandleEvent + 8196 frame #31: 0x012a6fa9 GraphicsServices`PurpleEventCallback + 1274 frame #32: 0x013901c5 CoreFoundation`__CFRUNLOOP_IS_CALLING_OUT_TO_A_SOURCE1_PERFORM_FUNCTION__ + 53 frame #33: 0x012f5022 CoreFoundation`__CFRunLoopDoSource1 + 146 frame #34: 0x012f390a CoreFoundation`__CFRunLoopRun + 2218 frame #35: 0x012f2db4 CoreFoundation`CFRunLoopRunSpecific + 212 frame #36: 0x012f2ccb CoreFoundation`CFRunLoopRunInMode + 123 frame #37: 0x000122a7 UIKit`-[UIApplication _run] + 576 frame #38: 0x00013a9b UIKit`UIApplicationMain + 1175 frame #39: 0x0000239d Twitter`main + 141 at main.m:16 frame #40: 0x00002305 Twitter`start + 53 Debugging console shows this: 2012-04-08 10:10:05.084 Twitter[25309:f803] ( { text = "Have you shared the Shakedown yet? http://t.co/WHrIC9w7"; }, { text = "For all you closet rocknrollas pencil in Sat 12th May The Rebirth of Rock n Roll Party. Haywire Saint @ The Good... http://t.co/OXHKlLIV"; }, { text = "4 weeks today: Vocal tracks will be getting recorded at The Premises Studios"; }, { text = "Rehearsal tonight in preparation to some big recording next month!"; }, { text = "haywire saint 'great taste.' Tune. \n\nhttp://t.co/GKmu5Lna http://t.co/0fii55Hw"; }, { text = "Meeting up with an old roadie for The Cure today. oh the stories...... http://t.co/UeUYccme"; }, { text = "Satisfying day of programming today.. Haywire Saint app coming along nicely with the custom music player ready to rock 'n' roll!"; }, { text = "Happy Friday Everyone!"; }, { text = "We had a great time at The Premises Studios yesterday. We'll be back there before long :D x"; }, { text = "I posted a new photo to Facebook http://t.co/73qAnCvk"; } ) 2012-04-08 10:10:05.093 Twitter[25309:f803] { text = "Have you shared the Shakedown yet? http://t.co/WHrIC9w7"; } 2012-04-08 10:10:05.094 Twitter[25309:f803] -[__NSCFDictionary isEqualToString:]: unrecognized selector sent to instance 0x6877a50 2012-04-08 10:10:05.096 Twitter[25309:f803] *** Terminating app due to uncaught exception 'NSInvalidArgumentException', reason: '-[__NSCFDictionary isEqualToString:]: unrecognized selector sent to instance 0x6877a50' *** First throw call stack: (0x13bc052 0x154dd0a 0x13bdced 0x1322f00 0x1322ce2 0x15168f 0x3088 0xace0f 0xad589 0x98dfd 0xa7851 0x52301 0x13bde72 0x1d6692d 0x1d70827 0x1cf6fa7 0x1cf8ea6 0x1d8430c 0x124c6 0x12bd6 0x21743 0x221f8 0x15aa9 0x12a6fa9 0x13901c5 0x12f5022 0x12f390a 0x12f2db4 0x12f2ccb 0x122a7 0x13a9b 0x239d 0x2305) terminate called throwing an exception2012-04-08 10:10:05.924 Twitter[25309:f803] -[__NSCFConstantString count]: unrecognized selector sent to instance 0x5b30

    Read the article

  • Windows 7 Seems to break SWT Control.print(GC)

    - by GreenKiwi
    A bug has been filed and fixed (super quickly) in SWT: https://bugs.eclipse.org/bugs/show_bug.cgi?id=305294 Just to preface this, my goal here is to print the two images into a canvas so that I can animate the canvas sliding across the screen (think iPhone), sliding the controls themselves was too CPU intensive, so this was a good alternative until I tested it on Win7. I'm open to anything that will help me solve my original problem, it doesn't have to be fixing the problem below. Does anyone know how to get "Control.print(GC)" to work with Windows 7 Aero? I have code that works just fine in Windows XP and in Windows 7, when Aero is disabled, but the command: control.print(GC) causes a non-top control to be effectively erased from the screen. GC gc = new GC(image); try { // As soon as this code is called, calling "layout" on the controls // causes them to disappear. control.print(gc); } finally { gc.dispose(); } I have stacked controls and would like to print the images from the current and next controls such that I can "slide" them off the screen. However, upon printing the non-top control, it is never redrawn again. Here is some example code. (Interesting code bits are at the top and it will require pointing at SWT in order to work.) Thanks for any and all help. As a work around, I'm thinking about swapping controls between prints to see if that helps, but I'd rather not. import org.eclipse.swt.SWT; import org.eclipse.swt.custom.StackLayout; import org.eclipse.swt.events.SelectionAdapter; import org.eclipse.swt.events.SelectionEvent; import org.eclipse.swt.graphics.GC; import org.eclipse.swt.graphics.Image; import org.eclipse.swt.graphics.Point; import org.eclipse.swt.layout.GridData; import org.eclipse.swt.layout.GridLayout; import org.eclipse.swt.widgets.Button; import org.eclipse.swt.widgets.Composite; import org.eclipse.swt.widgets.Control; import org.eclipse.swt.widgets.Display; import org.eclipse.swt.widgets.Label; import org.eclipse.swt.widgets.Shell; public class SWTImagePrintTest { private Composite stack; private StackLayout layout; private Label lblFlip; private Label lblFlop; private boolean flip = true; private Button buttonFlop; private Button buttonPrint; /** * Prints the control into an image * * @param control */ protected void print(Control control) { Image image = new Image(control.getDisplay(), control.getBounds()); GC gc = new GC(image); try { // As soon as this code is called, calling "layout" on the controls // causes them to disappear. control.print(gc); } finally { gc.dispose(); } } /** * Swaps the controls in the stack */ private void flipFlop() { if (flip) { flip = false; layout.topControl = lblFlop; buttonFlop.setText("flop"); stack.layout(); } else { flip = true; layout.topControl = lblFlip; buttonFlop.setText("flip"); stack.layout(); } } private void createContents(Shell shell) { shell.setLayout(new GridLayout(2, true)); stack = new Composite(shell, SWT.NONE); GridData gdStack = new GridData(GridData.FILL_BOTH); gdStack.horizontalSpan = 2; stack.setLayoutData(gdStack); layout = new StackLayout(); stack.setLayout(layout); lblFlip = new Label(stack, SWT.BOLD); lblFlip.setBackground(Display.getCurrent().getSystemColor( SWT.COLOR_CYAN)); lblFlip.setText("FlIp"); lblFlop = new Label(stack, SWT.NONE); lblFlop.setBackground(Display.getCurrent().getSystemColor( SWT.COLOR_BLUE)); lblFlop.setText("fLoP"); layout.topControl = lblFlip; stack.layout(); buttonFlop = new Button(shell, SWT.FLAT); buttonFlop.setText("Flip"); GridData gdFlip = new GridData(); gdFlip.horizontalAlignment = SWT.RIGHT; buttonFlop.setLayoutData(gdFlip); buttonFlop.addSelectionListener(new SelectionAdapter() { @Override public void widgetSelected(SelectionEvent e) { flipFlop(); } }); buttonPrint = new Button(shell, SWT.FLAT); buttonPrint.setText("Print"); GridData gdPrint = new GridData(); gdPrint.horizontalAlignment = SWT.LEFT; buttonPrint.setLayoutData(gdPrint); buttonPrint.addSelectionListener(new SelectionAdapter() { @Override public void widgetSelected(SelectionEvent e) { print(lblFlip); print(lblFlop); } }); } /** * @param args */ public static void main(String[] args) { Shell shell = new Shell(); shell.setText("Slider Test"); shell.setSize(new Point(800, 600)); shell.setLayout(new GridLayout()); SWTImagePrintTest tt = new SWTImagePrintTest(); tt.createContents(shell); shell.open(); Display display = Display.getDefault(); while (shell.isDisposed() == false) { if (display.readAndDispatch() == false) { display.sleep(); } } display.dispose(); } }

    Read the article

  • Java Client-Server problem when sending multiple files

    - by Jim
    Client public void transferImage() { File file = new File(ServerStats.clientFolder); String[] files = file.list(); int numFiles = files.length; boolean done = false; BufferedInputStream bis; BufferedOutputStream bos; int num; byte[] byteArray; long count; long len; Socket socket = null ; while (!done){ try{ socket = new Socket(ServerStats.imgServerName,ServerStats.imgServerPort) ; InputStream inStream = socket.getInputStream() ; OutputStream outStream = socket.getOutputStream() ; System.out.println("Connected to : " + ServerStats.imgServerName); BufferedReader inm = new BufferedReader(new InputStreamReader(inStream)); PrintWriter out = new PrintWriter(outStream, true /* autoFlush */); for (int itor = 0; itor < numFiles; itor++) { String fileName = files[itor]; System.out.println("transfer: " + fileName); File sentFile = new File(fileName); len = sentFile.length(); len++; System.out.println(len); out.println(len); out.println(sentFile); //SENDFILE bis = new BufferedInputStream(new FileInputStream(fileName)); bos = new BufferedOutputStream(socket.getOutputStream( )); byteArray = new byte[1000000]; count = 0; while ( count < len ){ num = bis.read(byteArray); bos.write(byteArray,0,num); count++; } bos.close(); bis.close(); System.out.println("file done: " + itor); } done = true; }catch (Exception e) { System.err.println(e) ; } } } Server public static void main(String[] args) { BufferedInputStream bis; BufferedOutputStream bos; int num; File file = new File(ServerStats.serverFolder); if (!(file.exists())){ file.mkdir(); } try { int i = 1; ServerSocket socket = new ServerSocket(ServerStats.imgServerPort); Socket incoming = socket.accept(); System.out.println("Spawning " + i); try { try{ if (!(file.exists())){ file.mkdir(); } InputStream inStream = incoming.getInputStream(); OutputStream outStream = incoming.getOutputStream(); BufferedReader inm = new BufferedReader(new InputStreamReader(inStream)); PrintWriter out = new PrintWriter(outStream, true /* autoFlush */); String length2 = inm.readLine(); System.out.println(length2); String filename = inm.readLine(); System.out.println("Filename = " + filename); out.println("ACK: Filename received = " + filename); //RECIEVE and WRITE FILE byte[] receivedData = new byte[1000000]; bis = new BufferedInputStream(incoming.getInputStream()); bos = new BufferedOutputStream(new FileOutputStream(ServerStats.serverFolder + "/" + filename)); long length = (long)Integer.parseInt(length2); length++; long counter = 0; while (counter < length){ num = bis.read(receivedData); bos.write(receivedData,0,num); counter ++; } System.out.println(counter); bos.close(); bis.close(); File receivedFile = new File(filename); long receivedLen = receivedFile.length(); out.println("ACK: Length of received file = " + receivedLen); } finally { incoming.close(); } } catch (IOException e){ e.printStackTrace(); } } catch (IOException e1){ e1.printStackTrace(); } } The code is some I found, and I have slightly modified it, but I am having problems transferring multiple images over the server. Output on Client: run ServerQueue.Client Connected to : localhost transfer: Picture 012.jpg 1312743 java.lang.ArrayIndexOutOfBoundsException Connected to : localhost transfer: Picture 012.jpg 1312743 Cant seem to get it to transfer multiple images. But bothsides I think crash or something because the file never finishes transfering

    Read the article

  • Pixel plot method errors out without error message.

    - by sonny5
    // The following method blows up (big red x on screen) without generating error info. Any // ideas why? // MyPlot.PlotPixel(x, y, Color.BlueViolet, Grf); // runs if commented out // My goal is to draw a pixel on a form. Is there a way to increase the pixel size also? using System; using System.Drawing; using System.Drawing.Drawing2D; using System.Collections; using System.ComponentModel; using System.Windows.Forms; using System.Data; public class Plot : System.Windows.Forms.Form { private Size _ClientArea; //keeps the pixels info private double _Xspan; private double _Yspan; public Plot() { InitializeComponent(); } public Size ClientArea { set { _ClientArea = value; } } private void InitializeComponent() { this.AutoScaleBaseSize = new System.Drawing.Size(5, 13); this.ClientSize = new System.Drawing.Size(400, 300); this.Text="World Plot (world_plot.cs)"; this.Resize += new System.EventHandler(this.Form1_Resize); this.Paint += new System.Windows.Forms.PaintEventHandler(this.doLine); this.Paint += new System.Windows.Forms.PaintEventHandler(this.TransformPoints); // new this.Paint += new System.Windows.Forms.PaintEventHandler(this.DrawRectangleFloat); this.Paint += new System.Windows.Forms.PaintEventHandler(this.DrawWindow_Paint); } private void DrawWindow_Paint(object sender, PaintEventArgs e) { Graphics Grf = e.Graphics; pixPlot(Grf); } static void Main() { Application.Run(new Plot()); } private void doLine(object sender, System.Windows.Forms.PaintEventArgs e) { // no transforms done yet!!! Graphics g = e.Graphics; g.FillRectangle(Brushes.White, this.ClientRectangle); Pen p = new Pen(Color.Black); g.DrawLine(p, 0, 0, 100, 100); // draw DOWN in y, which is positive since no matrix called p.Dispose(); } public void PlotPixel(double X, double Y, Color C, Graphics G) { Bitmap bm = new Bitmap(1, 1); bm.SetPixel(0, 0, C); G.DrawImageUnscaled(bm, TX(X), TY(Y)); } private int TX(double X) //transform real coordinates to pixels for the X-axis { double w; w = _ClientArea.Width / _Xspan * X + _ClientArea.Width / 2; return Convert.ToInt32(w); } private int TY(double Y) //transform real coordinates to pixels for the Y-axis { double w; w = _ClientArea.Height / _Yspan * Y + _ClientArea.Height / 2; return Convert.ToInt32(w); } private void pixPlot(Graphics Grf) { Plot MyPlot = new Plot(); double x = 12.0; double y = 10.0; MyPlot.ClientArea = this.ClientSize; Console.WriteLine("x = {0}", x); Console.WriteLine("y = {0}", y); //MyPlot.PlotPixel(x, y, Color.BlueViolet, Grf); // blows up } private void DrawRectangleFloat(object sender, PaintEventArgs e) { // Create pen. Pen penBlu = new Pen(Color.Blue, 2); // Create location and size of rectangle. float x = 0.0F; float y = 0.0F; float width = 200.0F; float height = 200.0F; // translate DOWN by 200 pixels // Draw rectangle to screen. e.Graphics.DrawRectangle(penBlu, x, y, width, height); } private void TransformPoints(object sender, System.Windows.Forms.PaintEventArgs e) { // after transforms Graphics g = this.CreateGraphics(); Pen penGrn = new Pen(Color.Green, 3); Matrix myMatrix2 = new Matrix(1, 0, 0, -1, 0, 0); // flip Y axis with -1 g.Transform = myMatrix2; g.TranslateTransform(0, 200, MatrixOrder.Append); // translate DOWN the same distance as the rectangle... // ...so this will put it at lower left corner g.DrawLine(penGrn, 0, 0, 100, 90); // notice that y 90 is going UP } private void Form1_Resize(object sender, System.EventArgs e) { Invalidate(); } }

    Read the article

  • How to replace a div container with javascript

    - by Kovu
    Hi, I must have a little design in javascript. I have a menu with 5 entrys and only 1 HTML-page. So I will have a content-div and enabled and disabled different static content in it, each menu-entry is another content. I tried with 5 divs and disable 4 of them and enable 1, but the element under each other means every div is like a - enabled or not, so the "content" is moving then. Hope its understandable. Here is the code so far: <html><head><title>Des Einsame-Katerchen's kleine Homepage</title> <style type="text/css"> a:link { font-weight:bold; color:blue; text-decoration:none; } a:visited { font-weight:bold; color:blue; text-decoration:none; } a:focus { font-weight:bold; color:blue; text-decoration:none; } a:hover { font-weight:bold; color:blue; text-decoration:line-through; } a:active { font-weight:bold; color:blue; text-decoration:none; } h1:focus { background-color:red; } h1:hover { background-color:silver; } h1:active { background-color:green; } </style> <script> function an(id) { document.getElementById('start').style.visibility = 'hidden'; document.getElementById('start').style.height = '0px'; document.getElementById('me').style.visibility = 'hidden'; document.getElementById('me').style.height = '0px'; document.getElementById('rpg').style.visibility = 'hidden'; document.getElementById('rpg').style.height = '0px'; document.getElementById('musik').style.visibility = 'hidden'; document.getElementById('musik').style.height = '0px'; document.getElementById('screens').style.visibility = 'hidden'; document.getElementById('screens').style.height = '0px'; document.getElementById(id).style.visibility = 'visible'; document.getElementById(id).style.height = '500px'; } </script> </head> <body style=" " > <div style="width=100%; text-align:center; border: 1px red solid; height:40px;"> <div style="float:left; width:100px;"><a href="#" OnClick="an('start')" >Startseite</a></div> <div style="float:left; width:100px;"><a href="#" OnClick="an('me')" >Über mich</a></div> <div style="float:left; width:100px;"><a href="#" OnClick="an('rpg')" >RPG-Chars</a></div> <div style="float:left; width:100px;"><a href="#" OnClick="an('musik')" >Musik</a></div> <div style="float:left; width:150px;"><a href="#" OnClick="an('screens')" >Knuddels-Screens</a></div> </div> <br> <div id="start" style="border:1px red solid; width:500px; height:500px; overflow: visible; " > a </div> <div id="me" style="border:1px red solid; width:500px; height:0px; overflow: visible; visibility: hidden; " > b </div> <div id="rpg" style="border:1px red solid; width:500px; height:0px; overflow: visible; visibility: hidden; " > c </div> <div id="musik" style="border:1px red solid; width:500px; height:0px; overflow: visible; visibility: hidden; " > d </div> <div id="screens" style="border:1px red solid; width:500px; height:0px; overflow: visible; visibility: hidden; " > e </div> </body>

    Read the article

  • jqGrid concatinating/building html tag incorrectly

    - by Energetic Pixels
    Please excuse to length of post. But I needed to explain what I am seeing. I have a onSelectRow option that is supposed to build stacked html <li> tags (such as <li>...</li> <li>...</li> <li>...</li> ) up to the number of static xml elements that I am looking at. But my script is concatinating all the image src links together instead of building the whole listobject tag. Everything else in my jqGrid script works with exception of repeated elements inside my xml. onSelectRow: function() { var gsr = $('#searchResults').jqGrid('getGridParam', 'selrow'); if (gsr) { var data = $('#searchResults').jqGrid('getRowData', gsr); $('#thumbs ul').html('<li><a class='thumb' href='' + data.piclocation + '' title='' + data.pictitle + ''><img src='" + data.picthumb + "' alt='" + data.pictitle + "' /></a><div class='caption'><div class='image-title'>" + data.pictitle + "</div></div></li>"); };" my xml file is something like this: <photo> <pic> <asset>weaponLib/stillMedia/slides/A106.jpg</asset> <thumb>weaponLib/stillMedia/thumbs/A106.jpg</thumb> <caption>Side view of DODIC A106</caption> <title>Side view of 22 caliber long rifle ball cartridge</title> </pic> <pic> <asset>weaponLib/stillMedia/slides/A106_A.jpg</asset> <thumb>weaponLib/stillMedia/thumbs/A106_A.jpg</thumb> <caption>Side view of DODIC A106</caption> <title>Side view of 22 caliber long rifle ball cartridge</title> </pic> <pic> <asset>weaponLib/stillMedia/slides/A106_B.jpg</asset> <thumb>weaponLib/stillMedia/thumbs/A106_B.jpg</thumb> <caption>Side view of DODIC A106</caption> <title>Side view of 22 caliber long rifle ball cartridge</title> </pic> <pic> <asset>weaponLib/stillMedia/slides/A106_C.jpg</asset> <thumb>weaponLib/stillMedia/thumbs/A106_C.jpg</thumb> <caption>Side view of DODIC A106</caption> <title>Side view of 22 caliber long rifle ball cartridge</title> </pic> <pic> <asset>weaponLib/stillMedia/slides/A106_D.jpg</asset> <thumb>weaponLib/stillMedia/thumbs/A106_D.jpg</thumb> <caption>Side view of DODIC A106</caption> <title>Side view of 22 caliber long rifle ball cartridge</title> </pic> My script works fine when it only sees one sequence, but when it sees more than one it puts all html inside the tags together then for the caption and title does the same for them. It generates only one <li></li> tag set instead of 5 in the example above like I want. The <li> tags are being used by a slideshow (with thumbnails) utility. Inside firebug, I can see the object that it is built for me: <a title="Side view of 22 caliber long rifle ball cartridgeSide view of 22 caliber long rifle ball cartridgeSide view of 22 caliber long rifle ball cartridgeSide view of 22 caliber long rifle ball cartridgeSide view of 22 caliber long rifle ball cartridge" href="weaponLib/stillMedia/slides/A106.jpgweaponLib/stillMedia/slides/A106_A.jpgweaponLib/stillMedia/slides/A106_B.jpgweaponLib/stillMedia/slides/A106_C.jpgweaponLib/stillMedia/slides/A106_D.jpg" class="thumb"><img alt="Side view of 22 caliber long rifle ball cartridgeSide view of 22 caliber long rifle ball cartridgeSide view of 22 caliber long rifle ball cartridgeSide view of 22 caliber long rifle ball cartridgeSide view of 22 caliber long rifle ball cartridge" src="weaponLib/stillMedia/thumbs/A106.jpgweaponLib/stillMedia/thumbs/A106_A.jpgweaponLib/stillMedia/thumbs/A106_B.jpgweaponLib/stillMedia/thumbs/A106_C.jpgweaponLib/stillMedia/thumbs/A106_D.jpg"></a> Within jqGrid, the cell is holding: <td title="weaponLib/stillMedia/slides/A106.jpgweaponLib/stillMedia/slides/A106_A.jpgweaponLib/stillMedia/slides/A106_B.jpgweaponLib/stillMedia/slides/A106_C.jpgweaponLib/stillMedia/slides/A106_D.jpg" style="text-align: center; display: none;" role="gridcell">weaponLib/stillMedia/slides/A106.jpgweaponLib/stillMedia/slides/A106_A.jpgweaponLib/stillMedia/slides/A106_B.jpgweaponLib/stillMedia/slides/A106_C.jpgweaponLib/stillMedia/slides/A106_D.jpg</td> I know that jqGrid is building it wrong. I am double-stumped as to direction to fix it. Any suggestions would be greatly greatly appreciated. tony

    Read the article

  • Android 2.1 NullPointerException with TabWidgets

    - by ninjasense
    I have an issue I have not been able to figure out and it is only happening on devices running <2.1. It works fine on android 2.2. I have ansynchronous task that displays a loading dialog while it loads all the tabs. Here is the code for the TabActivity: public class OppTabsView extends TabActivity { Dialog dialog; String errorText; boolean save; final int OPP_SAVE = 0; public static boolean edited; public void onCreate(Bundle icicle) { try { super.onCreate(icicle); new DoInBackground().execute(); } catch (Exception e) { Toast.makeText(this, "Error occured. Please try again later.", Toast.LENGTH_SHORT).show(); } } @Override protected void onResume() { super.onResume(); } @Override protected void onStop() { super.onStop(); } @Override protected void onPause() { super.onPause(); } public boolean onCreateOptionsMenu(Menu menu) { menu.add(0, OPP_SAVE, 0, "Test"); return true; } public boolean onOptionsItemSelected(MenuItem item) { switch (item.getItemId()) { case OPP_SAVE: save = true; new DoInBackground().execute(); return true; } return false; } public void LoadOpp() { handler.sendEmptyMessage(0); } public void SaveOpp() { DoStuff(); } public void LoadLayout() { setContentView(R.layout.view_opptabs); /* TabHost will have Tabs */ TabHost tabHost = (TabHost) findViewById(android.R.id.tabhost); /* * TabSpec used to create a new tab. By using TabSpec only we can able * to setContent to the tab. By using TabSpec setIndicator() we can set * name to tab. */ /* tid1 is firstTabSpec Id. Its used to access outside. */ TabSpec firstTabSpec = tabHost.newTabSpec("tid1"); TabSpec secondTabSpec = tabHost.newTabSpec("tid1"); TabSpec thirdTabSpec = tabHost.newTabSpec("tid1"); /* TabSpec setIndicator() is used to set name for the tab. */ /* TabSpec setContent() is used to set content for a particular tab. */ firstTabSpec.setIndicator("General", getResources().getDrawable(R.drawable.tab_moneybag)) .setContent(new Intent(this, OppTabGeneral.class)); secondTabSpec.setIndicator("Details", getResources().getDrawable(R.drawable.tab_papers)).setContent( new Intent(this, OppTabDetails.class)); thirdTabSpec.setIndicator("Contact", getResources().getDrawable(R.drawable.tab_contact)).setContent( new Intent(this, OppTabContact.class)); /* Add tabSpec to the TabHost to display. */ tabHost.addTab(firstTabSpec); tabHost.addTab(secondTabSpec); tabHost.addTab(thirdTabSpec); } private void do_update() { if (save) { SaveOpp(); } else { LoadOpp(); } } Handler handler = new Handler() { public void handleMessage(Message msg) { LoadLayout(); } }; private class DoInBackground extends AsyncTask<Void, Void, Void> implements DialogInterface.OnCancelListener { protected void onPreExecute() { String verb = "Connecting"; if (save) { verb = "Saving"; } dialog = ProgressDialog.show(OppTabsView.this, "", verb + ". Please Wait...", true, true, this); } protected Void doInBackground(Void... v) { do_update(); return null; } protected void onPostExecute(Void v) { dialog.dismiss(); } public void onCancel(DialogInterface dialog) { cancel(true); dialog.dismiss(); finish(); } } } Here is the stack trace from the error: java.lang.NullPointerException at android.widget.TabWidget.dispatchDraw(TabWidget.java:206) at android.view.ViewGroup.drawChild(ViewGroup.java:1529) at android.view.ViewGroup.dispatchDraw(ViewGroup.java:1258) at android.view.ViewGroup.drawChild(ViewGroup.java:1529) at android.view.ViewGroup.dispatchDraw(ViewGroup.java:1258) at android.view.ViewGroup.drawChild(ViewGroup.java:1529) at android.view.ViewGroup.dispatchDraw(ViewGroup.java:1258) at android.view.View.draw(View.java:6538) at android.widget.FrameLayout.draw(FrameLayout.java:352) at android.view.ViewGroup.drawChild(ViewGroup.java:1531) at android.view.ViewGroup.dispatchDraw(ViewGroup.java:1258) at android.view.ViewGroup.drawChild(ViewGroup.java:1529) at android.view.ViewGroup.dispatchDraw(ViewGroup.java:1258) at android.view.View.draw(View.java:6538) at android.widget.FrameLayout.draw(FrameLayout.java:352) at com.android.internal.policy.impl.PhoneWindow$DecorView.draw(PhoneWindow.java:1830) at android.view.ViewRoot.draw(ViewRoot.java:1349) at android.view.ViewRoot.performTraversals(ViewRoot.java:1114) at android.view.ViewRoot.handleMessage(ViewRoot.java:1633) at android.os.Handler.dispatchMessage(Handler.java:99) at android.os.Looper.loop(Looper.java:123) at android.app.ActivityThread.main(ActivityThread.java:4363) at java.lang.reflect.Method.invokeNative(Native Method) at java.lang.reflect.Method.invoke(Method.java:521) at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:860) at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:618) at dalvik.system.NativeStart.main(Native Method) I have tried stepping through it but the error seems to come out of no where, not at a specific line. Any help is greatly appreciated.

    Read the article

  • (C++) Linking with namespaces causes duplicate symbol error

    - by user577072
    Hello. For the past few days, I have been trying to figure out how to link the files for a CLI gaming project I have been working on. There are two halves of the project, the Client and the Server code. The client needs two libraries I've made. The first is a general purpose game board. This is split between GameEngine.h and GameEngine.cpp. The header file looks something like this namespace gfdGaming { // struct sqr_size { // Index x; // Index y; // }; typedef struct { Index x, y; } sqr_size; const sqr_size sPos = {1, 1}; sqr_size sqr(Index x, Index y); sqr_size ePos; class board { // Prototypes / declarations for the class } } And the CPP file is just giving everything content #include "GameEngine.h" type gfdGaming::board::functions The client also has game-specific code (in this case, TicTacToe) split into declarations and definitions (TTT.h, Client.cpp). TTT.h is basically #include "GameEngine.h" #define TTTtar "localhost" #define TTTport 2886 using namespace gfdGaming; void* turnHandler(void*); namespace nsTicTacToe { GFDCON gfd; const char X = 'X'; const char O = 'O'; string MPhostname, mySID; board TTTboard; bool PlayerIsX = true, isMyTurn; char Player = X, Player2 = O; int recon(string* datHolder = NULL, bool force = false); void initMP(bool create = false, string hn = TTTtar); void init(); bool isTie(); int turnPlayer(Index loc, char lSym = Player); bool checkWin(char sym = Player); int mainloop(); int mainloopMP(); }; // NS I made the decision to put this in a namespace to group it instead of a class because there are some parts that would not work well in OOP, and it's much easier to implement later on. I have had trouble linking the client in the past, but this setup seems to work. My server is also split into two files, Server.h and Server.cpp. Server.h contains exactly: #include "../TicTacToe/TTT.h" // Server needs a full copy of TicTacToe code class TTTserv; struct TTTachievement_requirement { Index id; Index loc; bool inUse; }; struct TTTachievement_t { Index id; bool achieved; bool AND, inSameGame; bool inUse; bool (*lHandler)(TTTserv*); char mustBeSym; int mustBePlayer; string name, description; TTTachievement_requirement steps[safearray(8*8)]; }; class achievement_core_t : public GfdOogleTech { public: // May be shifted to private TTTachievement_t list[safearray(8*8)]; public: achievement_core_t(); int insert(string name, string d, bool samegame, bool lAnd, int lSteps[8*8], int mbP=0, char mbS=0); }; struct TTTplayer_t { Index id; bool inUse; string ip, sessionID; char sym; int desc; TTTachievement_t Ding[8*8]; }; struct TTTgame_t { TTTplayer_t Player[safearray(2)]; TTTplayer_t Spectator; achievement_core_t achievement_core; Index cTurn, players; port_t roomLoc; bool inGame, Xused, Oused, newEvent; }; class TTTserv : public gSserver { TTTgame_t Game; TTTplayer_t *cPlayer; port_t conPort; public: achievement_core_t *achiev; thread threads[8]; int parseit(string tDat, string tsIP); Index conCount; int parseit(string tDat, int tlUser, TTTplayer_t** retval); private: int parseProto(string dat, string sIP); int parseProto(string dat, int lUser); int cycleTurn(); void setup(port_t lPort = 0, bool complete = false); public: int newEvent; TTTserv(port_t tlPort = TTTport, bool tcomplete = true); TTTplayer_t* userDC(Index id, Index force = false); int sendToPlayers(string dat, bool asMSG = false); int mainLoop(volatile bool *play); }; // Other void* userHandler(void*); void* handleUser(void*); And in the CPP file I include Server.h and provide main() and the contents of all functions previously declared. Now to the problem at hand I am having issues when linking my server. More specifically, I get a duplicate symbol error for every variable in nsTicTacToe (and possibly in gfdGaming as well). Since I need the TicTacToe functions, I link Client.cpp ( without main() ) when building the server ld: duplicate symbol nsTicTacToe::PlayerIsX in Client.o and Server.o collect2: ld returned 1 exit status Command /Developer/usr/bin/g++-4.2 failed with exit code 1 It stops once a problem is encountered, but if PlayerIsX is removed / changed temporarily than another variable causes an error Essentially, I am looking for any advice on how to better organize my code to hopefully fix these errors. Disclaimers: -I apologize in advance if I provided too much or too little information, as it is my first time posting -I have tried using static and extern to fix these problems, but apparently those are not what I need Thank you to anyone who takes the time to read all of this and respond =)

    Read the article

  • Nullpointerexcption & abrupt IOStream closure with inheritence and subclasses

    - by user1401652
    A brief background before so we can communicate on the same wave length. I've had about 8-10 university courses on programming from data structure, to one on all languages, to specific ones such as java & c++. I'm a bit rusty because i usually take 2-3 month breaks from coding. This is a personal project that I started thinking of two years back. Okay down to the details, and a specific question, I'm having problems with my mutator functions. It seems to be that I am trying to access a private variable incorrectly. The question is, am I nesting my classes too much and trying to mutate a base class variable the incorrect way. If so point me in the way of the correct literature, or confirm this is my problem so I can restudy this information. Thanks package GroceryReceiptProgram; import java.io.*; import java.util.Vector; public class Date { private int hour, minute, day, month, year; Date() { try { BufferedReader keyboard = new BufferedReader(new InputStreamReader(System.in)); System.out.println("What's the hour? (Use 1-24 military notation"); hour = Integer.parseInt(keyboard.readLine()); System.out.println("what's the minute? "); minute = Integer.parseInt(keyboard.readLine()); System.out.println("What's the day of the month?"); day = Integer.parseInt(keyboard.readLine()); System.out.println("Which month of the year is it, use an integer"); month = Integer.parseInt(keyboard.readLine()); System.out.println("What year is it?"); year = Integer.parseInt(keyboard.readLine()); keyboard.close(); } catch (IOException e) { System.out.println("Yo houston we have a problem"); } } public void setHour(int hour) { this.hour = hour; } public void setHour() { try { BufferedReader keyboard = new BufferedReader(new InputStreamReader(System.in)); System.out.println("What hour, use military notation?"); this.hour = Integer.parseInt(keyboard.readLine()); keyboard.close(); } catch (NumberFormatException e) { System.out.println(e.toString() + ":doesnt seem to be a number"); } catch (IOException e) { System.out.println(e.toString()); } } public int getHour() { return hour; } public void setMinute(int minute) { this.minute = minute; } public void setMinute() { try (BufferedReader keyboard = new BufferedReader(new InputStreamReader(System.in))) { System.out.println("What minute?"); this.minute = Integer.parseInt(keyboard.readLine()); } catch (NumberFormatException e) { System.out.println(e.toString() + ": doesnt seem to be a number"); } catch (IOException e) { System.out.println(e.toString() + ": minute shall not cooperate"); } catch (NullPointerException e) { System.out.println(e.toString() + ": in the setMinute function of the Date class"); } } public int getMinute() { return minute; } public void setDay(int day) { this.day = day; } public void setDay() { try { BufferedReader keyboard = new BufferedReader(new InputStreamReader(System.in)); System.out.println("What day 0-6?"); this.day = Integer.parseInt(keyboard.readLine()); keyboard.close(); } catch (NumberFormatException e) { System.out.println(e.toString() + ":doesnt seem to be a number"); } catch (IOException e) { System.out.println(e.toString()); } } public int getDay() { return day; } public void setMonth(int month) { this.month = month; } public void setMonth() { try { BufferedReader keyboard = new BufferedReader(new InputStreamReader(System.in)); System.out.println("What month 0-11?"); this.month = Integer.parseInt(keyboard.readLine()); keyboard.close(); } catch (NumberFormatException e) { System.out.println(e.toString() + ":doesnt seem to be a number"); } catch (IOException e) { System.out.println(e.toString()); } } public int getMonth() { return month; } public void setYear(int year) { this.year = year; } public void setYear() { try { BufferedReader keyboard = new BufferedReader(new InputStreamReader(System.in)); System.out.println("What year?"); this.year = Integer.parseInt(keyboard.readLine()); keyboard.close(); } catch (NumberFormatException e) { System.out.println(e.toString() + ":doesnt seem to be a number"); } catch (IOException e) { System.out.println(e.toString()); } } public int getYear() { return year; } public void set() { setMinute(); setHour(); setDay(); setMonth(); setYear(); } public Vector<Integer> get() { Vector<Integer> holder = new Vector<Integer>(5); holder.add(hour); holder.add(minute); holder.add(month); holder.add(day); holder.add(year); return holder; } }; That is the Date class obviously, next is the other base class Location. package GroceryReceiptProgram; import java.io.*; import java.util.Vector; public class Location { String streetName, state, city, country; int zipCode, address; Location() { try { BufferedReader keyboard = new BufferedReader(new InputStreamReader(System.in)); System.out.println("What is the street name"); streetName = keyboard.readLine(); System.out.println("Which state?"); state = keyboard.readLine(); System.out.println("Which city?"); city = keyboard.readLine(); System.out.println("Which country?"); country = keyboard.readLine(); System.out.println("Which zipcode?");//if not u.s. continue around this step zipCode = Integer.parseInt(keyboard.readLine()); System.out.println("What address?"); address = Integer.parseInt(keyboard.readLine()); } catch (IOException e) { System.out.println(e.toString()); } } public void setZipCode(int zipCode) { this.zipCode = zipCode; } public void setZipCode() { try { BufferedReader keyboard = new BufferedReader(new InputStreamReader(System.in)); System.out.println("What zipCode?"); this.zipCode = Integer.parseInt(keyboard.readLine()); keyboard.close(); } catch (NumberFormatException e) { System.out.println(e.toString() + ":doesnt seem to be a number"); } catch (IOException e) { System.out.println(e.toString()); } } public void set() { setAddress(); setCity(); setCountry(); setState(); setStreetName(); setZipCode(); } public int getZipCode() { return zipCode; } public void setAddress(int address) { this.address = address; } public void setAddress() { try { BufferedReader keyboard = new BufferedReader(new InputStreamReader(System.in)); System.out.println("What minute?"); this.address = Integer.parseInt(keyboard.readLine()); keyboard.close(); } catch (NumberFormatException e) { System.out.println(e.toString() + ":doesnt seem to be a number"); } catch (IOException e) { System.out.println(e.toString()); } } public int getAddress() { return address; } public void setStreetName(String streetName) { this.streetName = streetName; } public void setStreetName() { try { BufferedReader keyboard = new BufferedReader(new InputStreamReader(System.in)); System.out.println("What minute?"); this.streetName = keyboard.readLine(); keyboard.close(); } catch (IOException e) { System.out.println(e.toString()); } } public String getStreetName() { return streetName; } public void setState(String state) { this.state = state; } public void setState() { try { BufferedReader keyboard = new BufferedReader(new InputStreamReader(System.in)); System.out.println("What minute?"); this.state = keyboard.readLine(); keyboard.close(); } catch (IOException e) { System.out.println(e.toString()); } } public String getState() { return state; } public void setCity(String city) { this.city = city; } public void setCity() { try { BufferedReader keyboard = new BufferedReader(new InputStreamReader(System.in)); System.out.println("What minute?"); this.city = keyboard.readLine(); keyboard.close(); } catch (IOException e) { System.out.println(e.toString()); } } public String getCity() { return city; } public void setCountry(String country) { this.country = country; } public void setCountry() { try { BufferedReader keyboard = new BufferedReader(new InputStreamReader(System.in)); System.out.println("What minute?"); this.country = keyboard.readLine(); keyboard.close(); } catch (IOException e) { System.out.println(e.toString()); } } public String getCountry() { return country; } }; their parent(What is the proper name?) class package GroceryReceiptProgram; import java.io.*; public class FoodGroup { private int price, count; private Date purchaseDate, expirationDate; private Location location; private String name; public FoodGroup() { try { setPrice(); setCount(); expirationDate.set(); purchaseDate.set(); location.set(); } catch (NullPointerException e) { System.out.println(e.toString() + ": in the constructor of the FoodGroup class"); } } public void setPrice(int price) { this.price = price; } public void setPrice() { try (BufferedReader keyboard = new BufferedReader(new InputStreamReader(System.in))) { System.out.println("What Price?"); price = Integer.parseInt(keyboard.readLine()); } catch (NumberFormatException e) { System.out.println(e.toString() + ":doesnt seem to be a number"); } catch (IOException e) { System.out.println(e.toString() + ": in the FoodGroup class, setPrice function"); } catch (NullPointerException e) { System.out.println(e.toString() + ": in FoodGroup class. SetPrice()"); } } public int getPrice() { return price; } public void setCount(int count) { this.count = count; } public void setCount() { try (BufferedReader keyboard = new BufferedReader(new InputStreamReader(System.in))) { System.out.println("What count?"); count = Integer.parseInt(keyboard.readLine()); } catch (NumberFormatException e) { System.out.println(e.toString() + ":doesnt seem to be a number"); } catch (IOException e) { System.out.println(e.toString() + ": in the FoodGroup class, setCount()"); } catch (NullPointerException e) { System.out.println(e.toString() + ": in FoodGroup class, setCount"); } } public int getCount() { return count; } public void setName(String name) { this.name = name; } public void setName() { try { BufferedReader keyboard = new BufferedReader(new InputStreamReader(System.in)); System.out.println("What minute?"); this.name = keyboard.readLine(); } catch (IOException e) { System.out.println(e.toString()); } } public String getName() { return name; } public void setLocation(Location location) { this.location = location; } public Location getLocation() { return location; } public void setPurchaseDate(Date purchaseDate) { this.purchaseDate = purchaseDate; } public void setPurchaseDate() { this.purchaseDate.set(); } public Date getPurchaseDate() { return purchaseDate; } public void setExpirationDate(Date expirationDate) { this.expirationDate = expirationDate; } public void setExpirationDate() { this.expirationDate.set(); } public Date getExpirationDate() { return expirationDate; } } and finally the main class, so I can get access to all of this work. package GroceryReceiptProgram; public class NewMain { public static void main(String[] args) { FoodGroup test = new FoodGroup(); } } If anyone is further interested, here is a link the UML for this. https://www.dropbox.com/s/1weigjnxih70tbv/GRP.dia

    Read the article

  • CDI @Conversation not propagated with handleNavigation()

    - by Thomas Kernstock
    I have a problem with the propagation of a long runnig conversation when I redirect the view by the handleNavigation() method. Here is my test code: I have a conversationscoped bean and two views: conversationStart.xhtml is called in Browser with URL http://localhost/tests/conversationStart.jsf?paramTestId=ParameterInUrl <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xmlns:h="http://java.sun.com/jsf/html" xmlns:f="http://java.sun.com/jsf/core"> <f:metadata> <f:viewParam name="paramTestId" value="#{conversationTest.fieldTestId}" /> <f:event type="preRenderView" listener="#{conversationTest.preRenderView}" /> </f:metadata> <h:head> <title>Conversation Test</title> </h:head> <h:body> <h:form> <h2>Startpage Test Conversation with Redirect</h2> <h:messages /> <h:outputText value="Testparameter: #{conversationTest.fieldTestId}"/><br /> <h:outputText value="Logged In: #{conversationTest.loggedIn}"/><br /> <h:outputText value="Conversation ID: #{conversationTest.convID}"/><br /> <h:outputText value="Conversation Transient: #{conversationTest.convTransient}"/><br /> <h:commandButton action="#{conversationTest.startLogin}" value="Login ->" rendered="#{conversationTest.loggedIn==false}" /><br /> <h:commandLink action="/tests/conversationLogin.xhtml?faces-redirect=true" value="Login ->" rendered="#{conversationTest.loggedIn==false}" /><br /> </h:form> <h:link outcome="/tests/conversationLogin.xhtml" value="Login Link" rendered="#{conversationTest.loggedIn==false}"> <f:param name="cid" value="#{conversationTest.convID}"></f:param> </h:link> </h:body> </html> The Parameter is written to the beanfield and displayed in the view correctly. There are 3 different possibilites to navigate to the next View. All 3 work fine. The beanfield shows up the next view (conversationLogin.xhtml) too: <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xmlns:h="http://java.sun.com/jsf/html" xmlns:f="http://java.sun.com/jsf/core"> <h:head> <title>Conversation Test</title> </h:head> <h:body> <h:form> <h2>Loginpage Test Conversation with Redirect</h2> <h:messages /> <h:outputText value="Testparameter: #{conversationTest.fieldTestId}"/><br /> <h:outputText value="Logged In: #{conversationTest.loggedIn}"/><br /> <h:outputText value="Conversation ID: #{conversationTest.convID}"/><br /> <h:outputText value="Conversation Transient: #{conversationTest.convTransient}"/><br /> <h:commandButton action="#{conversationTest.login}" value="Login And Return" /><br /> </h:form> </h:body> </html> When I return to the Startpage by clicking the button the conversation bean still contains all values. So everything is fine. Here is the bean: package test; import java.io.Serializable; import javax.annotation.PostConstruct; import javax.enterprise.context.Conversation; import javax.enterprise.context.ConversationScoped; import javax.faces.event.ComponentSystemEvent; import javax.inject.Inject; import javax.inject.Named; @Named @ConversationScoped public class ConversationTest implements Serializable{ private static final long serialVersionUID = 1L; final String CONVERSATION_NAME="longRun"; @Inject Conversation conversation; private boolean loggedIn; private String fieldTestId; @PostConstruct public void init(){ if(conversation.isTransient()){ conversation.begin(CONVERSATION_NAME); System.out.println("New Conversation started"); } loggedIn=false; } public String getConvID(){ return conversation.getId(); } public boolean isConvTransient(){ return conversation.isTransient(); } public boolean getLoggedIn(){ return loggedIn; } public String startLogin(){ return "/tests/conversationLogin.xhtml?faces-redirect=true"; } public String login(){ loggedIn=true; return "/tests/conversationStart.xhtml?faces-redirect=true"; } public void preRenderView(ComponentSystemEvent ev) { // if(!loggedIn){ // System.out.println("Will redirect to Login"); // FacesContext ctx = FacesContext.getCurrentInstance(); // ctx.getApplication().getNavigationHandler().handleNavigation(ctx, null, "/tests/conversationLogin.xhtml?faces-redirect=true"); // ctx.renderResponse(); // } } public void setFieldTestId(String fieldTestId) { System.out.println("fieldTestID was set to: "+fieldTestId); this.fieldTestId = fieldTestId; } public String getFieldTestId() { return fieldTestId; } } Now comes the problem !! As soon as I try to redirect the page in the preRenderView method of the bean (just uncomment the code in the method), using handleNavigation() the bean is created again in the next view instead of using the allready created instance. Although the cid parameter is propagated to the next view ! Has anybody an idea what's wrong ? best regards Thomas

    Read the article

  • Value cannot be null, ArgumentNullException

    - by Wooolie
    I am currently trying to return an array which contains information about a seat at a theate such as Seat number, Name, Price and Status. I am using a combobox where I want to list all vacant or reserved seats based upon choice. When I choose reserved seats in my combobox, I call upon a method using AddRange. This method is supposed to loop through an array containing all seats and their information. If a seat is Vacant, I add it to an array. When all is done, I return this array. However, I am dealing with a ArgumentNullException. MainForm namespace Assignment4 { public partial class MainForm : Form { // private const int totNumberOfSeats = 240; private SeatManager seatMngr; private const int columns = 10; private const int rows = 10; public enum DisplayOptions { AllSeats, VacantSeats, ReservedSeats } public MainForm() { InitializeComponent(); seatMngr = new SeatManager(rows, columns); InitializeGUI(); } /// <summary> /// Fill the listbox with information from the beginning, /// let the user be able to choose from vacant seats. /// </summary> private void InitializeGUI() { rbReserve.Checked = true; txtName.Text = string.Empty; txtPrice.Text = string.Empty; lblTotalSeats.Text = seatMngr.GetNumOfSeats().ToString(); cmbOptions.Items.AddRange(Enum.GetNames(typeof(DisplayOptions))); cmbOptions.SelectedIndex = 0; UpdateGUI(); } /// <summary> /// call on methods ValidateName and ValidatePrice with arguments /// </summary> /// <param name="name"></param> /// <param name="price"></param> /// <returns></returns> private bool ValidateInput(out string name, out double price) { bool nameOK = ValidateName(out name); bool priceOK = ValidatePrice(out price); return nameOK && priceOK; } /// <summary> /// Validate name using inputUtility, show error if input is invalid /// </summary> /// <param name="name"></param> /// <returns></returns> private bool ValidateName(out string name) { name = txtName.Text.Trim(); if (!InputUtility.ValidateString(name)) { //inform user MessageBox.Show("Input of name is Invalid. It can not be empty, " + Environment.NewLine + "and must have at least one character.", " Error!"); txtName.Focus(); txtName.Text = " "; txtName.SelectAll(); return false; } return true; } /// <summary> /// Validate price using inputUtility, show error if input is invalid /// </summary> /// <param name="price"></param> /// <returns></returns> private bool ValidatePrice(out double price) { // show error if input is invalid if (!InputUtility.GetDouble(txtPrice.Text.Trim(), out price, 0)) { //inform user MessageBox.Show("Input of price is Invalid. It can not be less than 0, " + Environment.NewLine + "and must not be empty.", " Error!"); txtPrice.Focus(); txtPrice.Text = " "; txtPrice.SelectAll(); return false; } return true; } /// <summary> /// Check if item is selected in listbox /// </summary> /// <returns></returns> private bool CheckSelectedIndex() { int index = lbSeats.SelectedIndex; if (index < 0) { MessageBox.Show("Please select an item in the box"); return false; } else return true; } /// <summary> /// Call method ReserveOrCancelSeat when button OK is clicked /// </summary> /// <param name="sender"></param> /// <param name="e"></param> private void btnOK_Click(object sender, EventArgs e) { ReserveOrCancelSeat(); } /// <summary> /// Reserve or cancel seat depending on choice the user makes. Update GUI after choice. /// </summary> private void ReserveOrCancelSeat() { if (CheckSelectedIndex() == true) { string name = string.Empty; double price = 0.0; int selectedSeat = lbSeats.SelectedIndex; bool reserve = false; bool cancel = false; if (rbReserve.Checked) { DialogResult result = MessageBox.Show("Do you want to continue?", "Approve", MessageBoxButtons.YesNo); if (result == DialogResult.Yes) { if (ValidateInput(out name, out price)) { reserve = seatMngr.ReserveSeat(name, price, selectedSeat); if (reserve == true) { MessageBox.Show("Seat has been reserved"); UpdateGUI(); } else { MessageBox.Show("Seat has already been reserved"); } } } } else { DialogResult result = MessageBox.Show("Do you want to continue?", "Approve", MessageBoxButtons.YesNo); if (result == DialogResult.Yes) { cancel = seatMngr.CancelSeat(selectedSeat); if (cancel == true) { MessageBox.Show("Seat has been cancelled"); UpdateGUI(); } else { MessageBox.Show("Seat is already vacant"); } } } UpdateGUI(); } } /// <summary> /// Update GUI with new information. /// </summary> /// <param name="customerName"></param> /// <param name="price"></param> private void UpdateGUI() { lbSeats.Items.Clear(); lbSeats.Items.AddRange(seatMngr.GetSeatInfoString()); lblVacantSeats.Text = seatMngr.GetNumOfVacant().ToString(); lblReservedSeats.Text = seatMngr.GetNumOfReserved().ToString(); if (rbReserve.Checked) { txtName.Text = string.Empty; txtPrice.Text = string.Empty; } } /// <summary> /// set textboxes to false if cancel reservation button is checked /// </summary> /// <param name="sender"></param> /// <param name="e"></param> private void rbCancel_CheckedChanged_1(object sender, EventArgs e) { txtName.Enabled = false; txtPrice.Enabled = false; } /// <summary> /// set textboxes to true if reserved radiobutton is checked /// </summary> /// <param name="sender"></param> /// <param name="e"></param> private void rbReserve_CheckedChanged_1(object sender, EventArgs e) { txtName.Enabled = true; txtPrice.Enabled = true; } /// <summary> /// Make necessary changes on the list depending on what choice the user makes. Show only /// what the user wants to see, whether its all seats, reserved seats or vacant seats only. /// </summary> /// <param name="sender"></param> /// <param name="e"></param> private void cmbOptions_SelectedIndexChanged(object sender, EventArgs e) { if (cmbOptions.SelectedIndex == 0 && rbReserve.Checked) //All seats visible. { UpdateGUI(); txtName.Enabled = true; txtPrice.Enabled = true; btnOK.Enabled = true; } else if (cmbOptions.SelectedIndex == 0 && rbCancel.Checked) { UpdateGUI(); txtName.Enabled = false; txtPrice.Enabled = false; btnOK.Enabled = true; } else if (cmbOptions.SelectedIndex == 1) //Only vacant seats visible. { lbSeats.Items.Clear(); lbSeats.Items.AddRange(seatMngr.ReturnVacantSeats()); // Value cannot be null txtName.Enabled = false; txtPrice.Enabled = false; btnOK.Enabled = false; } else if (cmbOptions.SelectedIndex == 2) //Only reserved seats visible. { lbSeats.Items.Clear(); lbSeats.Items.AddRange(seatMngr.ReturnReservedSeats()); // Value cannot be null txtName.Enabled = false; txtPrice.Enabled = false; btnOK.Enabled = false; } } } } SeatManager namespace Assignment4 { class SeatManager { private string[,] nameList = null; private double[,] priceList = null; private string[,] seatList = null; private readonly int totCols; private readonly int totRows; /// <summary> /// Constructor with declarations of size for all arrays. /// </summary> /// <param name="totNumberOfSeats"></param> public SeatManager(int row, int cols) { totCols = cols; totRows = row; nameList = new string[row, cols]; priceList = new double[row, cols]; seatList = new string[row, cols]; for (int rows = 0; rows < row; rows++) { for (int col = 0; col < totCols; col++) { seatList[rows, col] = "Vacant"; } } } /// <summary> /// Check if index is within bounds of the array /// </summary> /// <param name="index"></param> /// <returns></returns> private bool CheckIndex(int index) { if (index >= 0 && index < nameList.Length) return true; else return false; } /// <summary> /// Return total number of seats /// </summary> /// <returns></returns> public int GetNumOfSeats() { int count = 0; for (int rows = 0; rows < totRows; rows++) { for (int cols = 0; cols < totCols; cols++) { count++; } } return count; } /// <summary> /// Calculate and return total number of reserved seats /// </summary> /// <returns></returns> public int GetNumOfReserved() { int totReservedSeats = 0; for (int rows = 0; rows < totRows; rows++) { for (int col = 0; col < totCols; col++) { if (!string.IsNullOrEmpty(nameList[rows, col])) { totReservedSeats++; } } } return totReservedSeats; } /// <summary> /// Calculate and return total number of vacant seats /// </summary> /// <returns></returns> public int GetNumOfVacant() { int totVacantSeats = 0; for (int rows = 0; rows < totRows; rows++) { for (int col = 0; col < totCols; col++) { if (string.IsNullOrEmpty(nameList[rows, col])) { totVacantSeats++; } } } return totVacantSeats; } /// <summary> /// Return formated string with info about the seat, name, price and its status /// </summary> /// <param name="index"></param> /// <returns></returns> public string GetSeatInfoAt(int index) { int cols = ReturnColumn(index); int rows = ReturnRow(index); string strOut = string.Format("{0,2} {1,10} {2,17} {3,20} {4,35:f2}", rows+1, cols+1, seatList[rows, cols], nameList[rows, cols], priceList[rows, cols]); return strOut; } /// <summary> /// Send an array containing all seats in the cinema /// </summary> /// <returns></returns> public string[] GetSeatInfoString() { int count = totRows * totCols; if (count <= 0) return null; string[] strSeatInfoStrings = new string[count]; for (int i = 0; i < totRows * totCols; i++) { strSeatInfoStrings[i] = GetSeatInfoAt(i); } return strSeatInfoStrings; } /// <summary> /// Reserve seat if seat is vacant /// </summary> /// <param name="name"></param> /// <param name="price"></param> /// <param name="index"></param> /// <returns></returns> public bool ReserveSeat(string name, double price, int index) { int cols = ReturnColumn(index); int rows = ReturnRow(index); if (string.IsNullOrEmpty(nameList[rows, cols])) { nameList[rows, cols] = name; priceList[rows, cols] = price; seatList[rows, cols] = "Reserved"; return true; } else return false; } public string[] ReturnVacantSeats() { int totVacantSeats = int.Parse(GetNumOfVacant().ToString()); string[] vacantSeats = new string[totVacantSeats]; for (int i = 0; i < vacantSeats.Length; i++) { if (GetSeatInfoAt(i) == "Vacant") { vacantSeats[i] = GetSeatInfoAt(i); } } return vacantSeats; } public string[] ReturnReservedSeats() { int totReservedSeats = int.Parse(GetNumOfReserved().ToString()); string[] reservedSeats = new string[totReservedSeats]; for (int i = 0; i < reservedSeats.Length; i++) { if (GetSeatInfoAt(i) == "Reserved") { reservedSeats[i] = GetSeatInfoAt(i); } } return reservedSeats; } /// <summary> /// Cancel seat if seat is reserved /// </summary> /// <param name="index"></param> /// <returns></returns> public bool CancelSeat(int index) { int cols = ReturnColumn(index); int rows = ReturnRow(index); if (!string.IsNullOrEmpty(nameList[rows, cols])) { nameList[rows, cols] = ""; priceList[rows, cols] = 0.0; seatList[rows, cols] = "Vacant"; return true; } else { return false; } } /// <summary> /// Convert index to row and return value /// </summary> /// <param name="index"></param> /// <returns></returns> public int ReturnRow(int index) { int vectorRow = index; int row; row = (int)Math.Ceiling((double)(vectorRow / totCols)); return row; } /// <summary> /// Convert index to column and return value /// </summary> /// <param name="index"></param> /// <returns></returns> public int ReturnColumn(int index) { int row = index; int col = row % totCols; return col; } } } In MainForm, this is where I get ArgumentNullException: lbSeats.Items.AddRange(seatMngr.ReturnVacantSeats()); And this is the method where the array is to be returned containing all vacant seats: public string[] ReturnVacantSeats() { int totVacantSeats = int.Parse(GetNumOfVacant().ToString()); string[] vacantSeats = new string[totVacantSeats]; for (int i = 0; i < vacantSeats.Length; i++) { if (GetSeatInfoAt(i) == "Vacant") { vacantSeats[i] = GetSeatInfoAt(i); } } return vacantSeats; }

    Read the article

  • Simple XNA 2D demo: why is my F# version slower than C# version?

    - by Den
    When running this XNA application it should display a rotated rectangle that moves from top-left corner to bottom-right corner. It looks like my F# version is noticeably much slower. It seems that the Draw method skips a lot of frames. I am using VS 2012 RC, XNA 4.0, .NET 4.5, F# 3.0. I am trying to make it as functional as possible. What could be the reason for poor performance? C#: class Program { static void Main(string[] args) { using (var game = new FlockGame()) { game.Run(); } } } public class FlockGame : Game { private GraphicsDeviceManager graphics; private DrawingManager drawingManager; private Vector2 position = Vector2.Zero; public FlockGame() { graphics = new GraphicsDeviceManager(this); } protected override void Initialize() { drawingManager = new DrawingManager(graphics.GraphicsDevice); this.IsFixedTimeStep = false; } protected override void Update(GameTime gameTime) { position = new Vector2(position.X + 50.1f * (float)gameTime.ElapsedGameTime.TotalSeconds, position.Y + 50.1f * (float)gameTime.ElapsedGameTime.TotalSeconds); base.Update(gameTime); } protected override void Draw(GameTime gameTime) { //this.GraphicsDevice.Clear(Color.Lavender) drawingManager.DrawRectangle(position, new Vector2(100.0f, 100.0f), 0.7845f, Color.Red); base.Draw(gameTime); } } public class DrawingManager { private GraphicsDevice GraphicsDevice; private Effect Effect; public DrawingManager(GraphicsDevice graphicsDevice) { GraphicsDevice = graphicsDevice; this.Effect = new BasicEffect(this.GraphicsDevice) { VertexColorEnabled = true, Projection = Matrix.CreateOrthographicOffCenter(0.0f, this.GraphicsDevice.Viewport.Width, this.GraphicsDevice.Viewport.Height, 0.0f, 0.0f, 1.0f) }; } private VertexPositionColor[] GetRectangleVertices (Vector2 center, Vector2 size, float radians, Color color) { var halfSize = size/2.0f; var topLeft = -halfSize; var bottomRight = halfSize; var topRight = new Vector2(bottomRight.X, topLeft.Y); var bottomLeft = new Vector2(topLeft.X, bottomRight.Y); topLeft = Vector2.Transform(topLeft, Matrix.CreateRotationZ(radians)) + center; topRight = Vector2.Transform(topRight, Matrix.CreateRotationZ(radians)) + center; bottomRight = Vector2.Transform(bottomRight, Matrix.CreateRotationZ(radians)) + center; bottomLeft = Vector2.Transform(bottomLeft, Matrix.CreateRotationZ(radians)) + center; return new VertexPositionColor[] { new VertexPositionColor(new Vector3(topLeft, 0.0f), color), new VertexPositionColor(new Vector3(topRight, 0.0f), color), new VertexPositionColor(new Vector3(topRight, 0.0f), color), new VertexPositionColor(new Vector3(bottomRight, 0.0f), color), new VertexPositionColor(new Vector3(bottomRight, 0.0f), color), new VertexPositionColor(new Vector3(bottomLeft, 0.0f), color), new VertexPositionColor(new Vector3(bottomLeft, 0.0f), color), new VertexPositionColor(new Vector3(topLeft, 0.0f), color) }; } public void DrawRectangle(Vector2 center, Vector2 size, float radians, Color color) { var vertices = GetRectangleVertices(center, size, radians, color); foreach (var pass in this.Effect.CurrentTechnique.Passes) { pass.Apply(); this.GraphicsDevice.DrawUserPrimitives(PrimitiveType.LineList, vertices, 0, vertices.Length/2); } } } F#: namespace Flocking module FlockingProgram = open System open Flocking [<STAThread>] [<EntryPoint>] let Main _ = use g = new FlockGame() g.Run() 0 //------------------------------------------------------------------------------ namespace Flocking open System open System.Diagnostics open Microsoft.Xna.Framework open Microsoft.Xna.Framework.Graphics open Microsoft.Xna.Framework.Input type public FlockGame() as this = inherit Game() let mutable graphics = new GraphicsDeviceManager(this) let mutable drawingManager = null let mutable position = Vector2.Zero override Game.LoadContent() = drawingManager <- new Rendering.DrawingManager(graphics.GraphicsDevice) this.IsFixedTimeStep <- false override Game.Update gameTime = position <- Vector2(position.X + 50.1f * float32 gameTime.ElapsedGameTime.TotalSeconds, position.Y + 50.1f * float32 gameTime.ElapsedGameTime.TotalSeconds) base.Update gameTime override Game.Draw gameTime = //this.GraphicsDevice.Clear(Color.Lavender) Rendering.DrawRectangle(drawingManager, position, Vector2(100.0f, 100.0f), 0.7845f, Color.Red) base.Draw gameTime //------------------------------------------------------------------------------ namespace Flocking open System open System.Collections.Generic open Microsoft.Xna.Framework open Microsoft.Xna.Framework.Graphics open Microsoft.Xna.Framework.Input module Rendering = [<AllowNullLiteral>] type DrawingManager (graphicsDevice : GraphicsDevice) = member this.GraphicsDevice = graphicsDevice member this.Effect = new BasicEffect(this.GraphicsDevice, VertexColorEnabled = true, Projection = Matrix.CreateOrthographicOffCenter(0.0f, float32 this.GraphicsDevice.Viewport.Width, float32 this.GraphicsDevice.Viewport.Height, 0.0f, 0.0f, 1.0f)) let private GetRectangleVertices (center:Vector2, size:Vector2, radians:float32, color:Color) = let halfSize = size / 2.0f let mutable topLeft = -halfSize let mutable bottomRight = halfSize let mutable topRight = new Vector2(bottomRight.X, topLeft.Y) let mutable bottomLeft = new Vector2(topLeft.X, bottomRight.Y) topLeft <- Vector2.Transform(topLeft, Matrix.CreateRotationZ(radians)) + center topRight <- Vector2.Transform(topRight, Matrix.CreateRotationZ(radians)) + center bottomRight <- Vector2.Transform(bottomRight, Matrix.CreateRotationZ(radians)) + center bottomLeft <- Vector2.Transform(bottomLeft, Matrix.CreateRotationZ(radians)) + center [| new VertexPositionColor(new Vector3(topLeft, 0.0f), color) new VertexPositionColor(new Vector3(topRight, 0.0f), color) new VertexPositionColor(new Vector3(topRight, 0.0f), color) new VertexPositionColor(new Vector3(bottomRight, 0.0f), color) new VertexPositionColor(new Vector3(bottomRight, 0.0f), color) new VertexPositionColor(new Vector3(bottomLeft, 0.0f), color) new VertexPositionColor(new Vector3(bottomLeft, 0.0f), color) new VertexPositionColor(new Vector3(topLeft, 0.0f), color) |] let DrawRectangle (drawingManager:DrawingManager, center:Vector2, size:Vector2, radians:float32, color:Color) = let vertices = GetRectangleVertices(center, size, radians, color) for pass in drawingManager.Effect.CurrentTechnique.Passes do pass.Apply() drawingManager.GraphicsDevice.DrawUserPrimitives(PrimitiveType.LineList, vertices, 0, vertices.Length/2)

    Read the article

< Previous Page | 683 684 685 686 687 688 689 690 691 692 693 694  | Next Page >