Search Results

Search found 3956 results on 159 pages for 'regex cookbook'.

Page 69/159 | < Previous Page | 65 66 67 68 69 70 71 72 73 74 75 76  | Next Page >

  • Convert from apache rewrite to nginx

    - by Linux Intel
    I want to convert from apache rewrite modules to nginx RewriteCond %{QUERY_STRING} mosConfig_[a-zA-Z_]{1,21}(=|\%3D) [OR] RewriteCond %{QUERY_STRING} base64_encode.*\(.*\) [OR] RewriteCond %{QUERY_STRING} (\<|%3C).*script.*(\>|%3E) [NC,OR] RewriteCond %{QUERY_STRING} GLOBALS(=|\[|\%[0-9A-Z]{0,2}) [OR] RewriteCond %{QUERY_STRING} _REQUEST(=|\[|\%[0-9A-Z]{0,2}) RewriteCond %{QUERY_STRING} SELECT(=|\[|\%[0-9A-Z]{0,2}) [OR] RewriteCond %{QUERY_STRING} UNION(=|\[|\%[0-9A-Z]{0,2}) [OR] RewriteCond %{QUERY_STRING} UPDATE(=|\[|\%[0-9A-Z]{0,2}) [OR] RewriteRule ^([^.]*)/?$ index.php [L] RewriteRule ^domain/trial/cms$ index/index.php?%{QUERY_STRING} [L] RewriteCond %{HTTP:Range} ([a-z]+) [NC] RewriteRule ([0-9_\-]+)flv$ http://www.domain.com [R,L] RewriteCond %{ENV:byte-ranges-specifier} !^$ RewriteRule ([0-9_\-]+)flv$ http://www.domain.com [R,L] RewriteCond %{HTTP_USER_AGENT} !^Mozilla/5 [NC] RewriteCond %{HTTP_USER_AGENT} !^Mozilla/4 [NC] RewriteCond %{HTTP_USER_AGENT} !^Opera [NC] RewriteRule ([0-9_\-]+)flv$ http://www.domain.com [R,L] RewriteRule ^$ index/index.php?%{QUERY_STRING} [L] RewriteCond %{SCRIPT_FILENAME} !sss.php [NC] RewriteCond %{SCRIPT_FILENAME} !m-administrator [NC] RewriteRule ^([^/^.]*)$ sss.php?encrypted=$1&%{QUERY_STRING} [L] RewriteCond %{SCRIPT_FILENAME} !sss.php [NC] RewriteCond %{SCRIPT_FILENAME} !m-administrator [NC] RewriteRule ^([^/^.]*)/([^/^.]*)$ sss.php?tab=$1&page=$2&%{QUERY_STRING} [L] RewriteCond %{SCRIPT_FILENAME} !sss.php [NC] RewriteCond %{SCRIPT_FILENAME} !m-administrator [NC] RewriteRule ^([^/^.]*)/([^/^.]*)/([^.]*)$ sss.php?tab=$1&page=$2&queryString=$3&%{QUERY_STRING} [L] RewriteCond %{SCRIPT_FILENAME} !sss.php [NC] RewriteCond %{SCRIPT_FILENAME} !security.php [NC] RewriteRule ^([^/]*)$ index/$1?%{QUERY_STRING} [L] I tried to convert it by online tools such as : http://www.anilcetin.com/convert-apache-htaccess-to-nginx/ but it didn't convert it correctly. The conversion output is : if ($args ~ "mosConfig_[a-zA-Z_]{1,21}(=|%3D)"){ set $rule_0 1; } if ($args ~ "base64_encode.*(.*)"){ set $rule_0 1; } if ($args ~* "(<|%3C).*script.*(>|%3E)"){ set $rule_0 1; } if ($args ~ "GLOBALS(=|[|%[0-9A-Z]{0,2})"){ set $rule_0 1; } if ($args ~ "_REQUEST(=|[|%[0-9A-Z]{0,2})"){ set $rule_0 1; } if ($args ~ "SELECT(=|[|%[0-9A-Z]{0,2})"){ set $rule_0 1; } if ($args ~ "UNION(=|[|%[0-9A-Z]{0,2})"){ set $rule_0 1; } if ($args ~ "UPDATE(=|[|%[0-9A-Z]{0,2})"){ set $rule_0 1; } if ($rule_0 = "1"){ rewrite ^/([^.]*)/?$ /index.php last; } if ($rule_1 = ""){ rewrite ^/domain/trial/cms$ /index/index.php?$args last; } if ($http_range ~* "([a-z]+)"){ set $rule_2 1$rule_2; } if ($rule_2 = "1"){ rewrite /([0-9_-]+)flv$ http://www.domain.com redirect; } #ignored: condition 0 if ($rule_3 = "1"){ rewrite /([0-9_-]+)flv$ http://www.domain.com redirect; } if ($http_user_agent !~* "^Mozilla/5"){ set $rule_4 1$rule_4; } if ($http_user_agent !~* "^Mozilla/4"){ set $rule_4 2$rule_4; } if ($http_user_agent !~* "^Opera"){ set $rule_4 3$rule_4; } if ($rule_4 = "321"){ rewrite /([0-9_-]+)flv$ http://www.domain.com redirect; } if ($rule_5 = ""){ rewrite ^/$ /index/index.php?$args last; } if ($uri !~* "sss.php"){ set $rule_6 1$rule_6; } if ($uri !~* "m-administrator"){ set $rule_6 2$rule_6; } if ($rule_6 = "21"){ rewrite ^/([^/^.]*)$ /sss.php?encrypted=$1&$args last; } if ($uri !~* "sss.php"){ set $rule_7 1$rule_7; } if ($uri !~* "m-administrator"){ set $rule_7 2$rule_7; } if ($rule_7 = "21"){ rewrite ^/([^/^.]*)/([^/^.]*)$ /sss.php?tab=$1&page=$2&$args last; } if ($uri !~* "sss.php"){ set $rule_8 1$rule_8; } if ($uri !~* "m-administrator"){ set $rule_8 2$rule_8; } if ($rule_8 = "21"){ rewrite ^/([^/^.]*)/([^/^.]*)/([^.]*)$ /sss.php?tab=$1&page=$2&queryString=$3&$args last; } if ($uri !~* "sss.php"){ set $rule_9 1$rule_9; } if ($uri !~* "security.php"){ set $rule_9 2$rule_9; } if ($rule_9 = "21"){ rewrite ^/([^/]*)$ /index/$1?$args last; } Please help me with the proper conversion result for nginx in order to work perfectly.

    Read the article

  • Regex working in RedHat is not giving any result in Ubuntu

    - by Supratik
    My goal is to match specific files from specific sub directories. I have the following folder structure `-- data |-- a |-- a.txt |-- b |-- b.txt |-- c |-- c.txt |-- d |-- d.txt |-- e |-- e.txt |-- org-1 | |-- a.org | |-- b.org | |-- org.txt | |-- user-0 | | |-- a.txt | | |-- b.txt I am trying to list the files only inside the data directory. I am able to get the correct result using the following command in RHEL find ./testdir/ -iwholename "*/data/[!/].txt" a.txt b.txt c.txt d.txt e.txt If I run the same command in Ubuntu it is not working. Can anyone please tell me why it is not working in Ubuntu ?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • How do I make sdiff ignore the * character?

    - by Runcible
    Here's what I'm sure is an easy one, but I can't figure it out. I have two files: file1: You are in a maze of twisty little passages, all alike file2: You are in a maze of twisty little* passages, all alike I want to perform sdiff on these files, but I want to ignore the * character. How do I do this?

    Read the article

  • Apache LocationMatch does not work for group

    - by dma_k
    I would like to configure Apache to proxy mldonkey running at localhost. Initially I have used the following configuration: <IfModule mod_proxy.c> <LocationMatch /(mldonkey|bittorrent)/> ProxyPass http://localhost:4080/ ProxyPassReverse http://localhost:4080/ </LocationMatch> </IfModule> and it didn't worked! error.log reads [error] [client 192.168.1.1] File does not exist: /var/www/mldonkey which means that Apache does not intersect the URL. However, when I change the regexp to following: <LocationMatch /mldonkey/> it started to work (i.e. mod_proxy functions OK, more over all ). I have tried the following alternatives: <LocationMatch ^/(mldonkey|bittorrent)/> <LocationMatch ^/(mldonkey|bittorrent)/.*> <LocationMatch ^/(mldonkey|bittorrent)> <LocationMatch /(mldonkey|bittorrent)> <LocationMatch "^/(mldonkey|bittorrent)/"> <LocationMatch "/(mldonkey|bittorrent)"> <LocationMatch "/(mldonkey)"> <LocationMatch "/(mldonkey)/"> with no positive result. I am stuck. Please give me a hint where to look at. P.S. Apache Server 2.2.19. P.P.S. Would be happy if <LocationMatch> would work, without using the heavy artillery of mod_rewrite.

    Read the article

  • Regular expression in mySQL [migrated]

    - by Rayne
    I have a mysql table that has 2 columns - Column 1 contains a string value, and Column 2 contains the number of times that string value occurred. I'm trying to find the string abc.X.def, where the beginning of the string is "abc.", followed by one or more characters, then the string ".def". There could be more characters following ".def". How can I find such strings, then add the occurrence of such strings and display the results? For example, if I have abc.111.def23 1 abc.111.def 2 abc.22.def444 1 abc.111.def 1 Then I will get abc.111.def23 1 abc.111.def 3 abc.22.def444 1 Thank you.

    Read the article

  • Misbehavior in regular expression in VIM

    - by poissonbreaker
    I am having a problem with a regular expression on vim. I have a pattern as follows: http:\/\/\(\w\+\.\?\)\+ [matches http://(AS MANY WORDS FOLLOWED BY DOT OR NOT ENCOUNTERS) e.g. http://wd1.wd2.com] I have a text as follows: http://wd1.wd2.com/wd3 I am trying to make this substitution on it: s/\(http:\/\/\)\(\w\+\.\?\)\+/\1wd4.wd5.com and the result is http://wd4.wd5.com /wd3 (Notice the white space inserted at the end of the replacement) How can I avoid having this inserted space? I am afraid is a bug in the regexp engine but I am not sure.

    Read the article

  • Nginx HTTPS when only matching admin subfolder

    - by sebastyuiop
    I have managed to get all /admin requests redirected to https by: server { listen 80; location /admin { rewrite ^ https://$server_name$request_uri?$args permanent; } } But can't figure out how to get all https requests that are not within /admin redirected to http, so far I have: server { listen 443; location ~ /admin { rewrite ^ http://$server_name$request_uri?$args permanent; } } EDIT: I have got the redirects working as required but can't stop the /admin url going to 404. It feels like I need to put something in the empty block. server { listen 443; location /admin { } location / { rewrite ^ http://$server_name$request_uri?$args permanent; } } Thanks

    Read the article

  • Regular Expression for "AND"?

    - by Kevin
    Let's say I gave you the following text: allow_httpd_anon_write --> off allow_httpd_mod_auth_ntlm_winbind --> off allow_httpd_mod_auth_pam --> off allow_httpd_sys_script_anon_write --> off httpd_builtin_scripting --> on httpd_can_check_spam --> off httpd_can_network_connect --> off httpd_can_network_connect_cobbler --> off httpd_can_network_connect_db --> off httpd_can_network_memcache --> off httpd_can_network_relay --> off httpd_can_sendmail --> off httpd_dbus_avahi --> on httpd_enable_cgi --> on httpd_enable_ftp_server --> off httpd_enable_homedirs --> on httpd_execmem --> off httpd_read_user_content --> off httpd_setrlimit --> off httpd_ssi_exec --> off httpd_tmp_exec --> off httpd_tty_comm --> on httpd_unified --> on httpd_use_cifs --> off httpd_use_gpg --> off httpd_use_nfs --> off What I want to do is create a regular expression that can parse text like this looking for two or more words on the same line. For example, if I was looking for a SELinux boolean that covered "ftp" AND "home" on the same line, I would currently do the following: getsebool -a | grep -i ftp | grep -i home However, I am looking for a regular expression that does the same thing. Specifically, find all of the words in any order on a line...

    Read the article

  • Request exceeded the limit of 10

    - by Webnet
    My logs are FULL of [Tue Jan 11 10:20:45 2011] [error] [client 99.162.115.123] Request exceeded the limit of 10 internal redirects due to probable configuration error. Use 'LimitInternalRecursion' to increase the limit if necessary. Use 'LogLevel debug' to get a backtrace., referer: https://www.domain.com/vehicles/Chevrolet/Uplander/2006 The problem is when I enable LogLevel debug we get HUGE error logs because all of our traffic is SSL. From what I can tell the file doesn't record these errors anymore, either that or it's so buried in SSL logs that I just can't find them. Here's my .htaccess Options -indexes RewriteEngine On RewriteRule ^battery/([^/]+)$ /browser/product?sku=BATTERY+$1&type=battery RewriteRule ^vehicles/([^/]+)/([^/]+)/([^/]+)/product([0-9]+)$ /browser/index.php?make=$1&model=$2&id=$3&%{QUERY_STRING} [L,NC] RewriteRule ^vehicles/([^/]+)/([^/]+)/([^/]+)/([0-9]+)$ /browser/product.php?make=$1&model=$2&year=$3&id=$4&%{QUERY_STRING} [L,NC] RewriteRule ^vehicles/([^/]+)/([^/]+)/([^/]+)$ /store/product/list.php?make=$1&model=$2&year=$3&%{QUERY_STRING} [L,NC] RewriteRule ^vehicles/([^/]+)/([^/]+)$ /vehicle/make/model/year/list.php?make=$1&model=$2&%{QUERY_STRING} [L,NC] RewriteRule ^vehicles/([^/]+)$ /vehicle/make/model/list.php?make=$1&%{QUERY_STRING} [L,NC]

    Read the article

  • NotePad++ - Why Does Finding ^ Not Work

    - by ChloeRadshaw
    I am trying to move away from TextPad and I just cant get reg expressions like ^ and $ to be replaced. I have definitely ticked the regular expression box What am I doing wrong EDIT: I am trying to find the start of a new line - In textpad it is find '^' and ensure reg ex is enabled. With notepad++ it does not do that. It just says not found

    Read the article

  • Can I sort files A-Z and at the same time Z-A?

    - by The_Buff
    I am trying to sort and rename a large number of files that are labeled #####_## The LEFT side of the underscore are numbers (e.g., 32956715, 32956810, etc.) that do not repeat. The RIGHT side of the underscore are also numbers (e.g., 1, 2, 3, etc.) and they do repeat. (The left side is the number of a scan and the right side is the page of that particular scan.) I would like to be able to sort the left side of the underscore Z-A and the right side A-Z. Example: 3_1 3_2 3_3 2_1 2_2 2_3 1_1 1_2 1_3 I am using ReNamer by den4b (easily the best free renamer out there). It supports regular expressions so I believe there should be an easy way to do this, but I don't know how. (I've been trying to learn regular expressions but I don't use them enough to retain anything.) I'm open for any suggestions that achieve the same result. I've spent enough time trying to figure it out that I could have probably just sorted them myself already but this is a reccuring problem so hopefully someone has a solution that will save me lots of time in the long run. Thank You!

    Read the article

  • Notepad ++ regular expression

    - by arvindwill
    have javascript file will millions of lines. The problem is IE dont support ','(comma) followed by '}'(curly close bracket) by using notepadd++ need to find all the comma which is followed by curly close bracket. So regular expression \,.*\} works. but the problem between the comma and close bracket many tab space or newline or linefeed can be there . cant able to provide the newline with spaces in regular expression. like below one somestring, }

    Read the article

  • Searching Multiple Terms

    - by nevets1219
    I know that grep -E 'termA|termB' files allows me to search multiple files for termA OR termB. What I would like to do instead is search for termA AND termB. They do not have to be on the same line as long as the two terms exists within the same file. Essentially a "search within result" feature. I know I can pipe the results of one grep into another but that seems slow when going over many files. grep -l "termA" * | xargs grep -l "termB" | xargs grep -E -H -n --color "termA|termB" Hopefully the above isn't the only way to do this. It would be extra nice if this could work on Windows (have cygwin) and Linux. I don't mind installing a tool to perform this task.

    Read the article

  • RewriteMap syntax Regex

    - by ienabellamy
    in my .htaccess i've tons of directives, with same syntax: RewriteRule ^(.*)/PRODUCT_1.aspx http://www.site.com/product.php?id_product=2891 RewriteRule ^(.*)/PRODUCT_2.aspx http://www.site.com/product.php?id_product=2896 and everything works. Now, i created a RewriteMap in my because i need to increase velocity (20.000 redirect 301 in htaccess no good), so: RewriteEngine On RewriteMap redirects dbm=db:/var/www/html/presta152/prestashop/redirects.db RewriteCond ${redirects:$1} !="" RewriteRule ^(.*)$ ${redirects:$1} [redirect=permanent,last] and my redirects.db is created by redirects.txt, that contains: /PRODUCT_1.aspx http://www.site.com/product.php?id_product=2891 /PRODUCT_2.aspx http://www.site.com/product.php?id_product=2896 this works if i try to call for example: www.site.com/PRODUCT_1.aspx i'm redirected... but if i try to call www.site.com/everythingpossibileinside/PRODUCT_1.aspx the redirect doesn't work. So, in my .htaccess this rule: RewriteRule ^(.*)/PRODUCT_1.aspx http://www.site.com/product.php?id_product=2891 works, but in my RewriteMap no. I think i must change this directive: RewriteRule ^(.*)$ ${redirects:$1} [redirect=permanent,last] i tried, but unsuccessful. Thanks to all.

    Read the article

  • referral with regex for firefox?

    - by acidzombie24
    I am looking for a firefox referral plugin. I would like to be able to forge the referral name based on the pagename without extension. Such as http://site.com/page/abc.ANYTHING i need to set the referral as http://site.com/view/blah-abc-more.ext Does anyone know of a solution?

    Read the article

  • Regular expression to remove one parameter from query string

    - by Kip
    I'm looking for a regular expression to remove a single parameter from a query string, and I want to do it in a single regular expression if possible. Say I want to remove the foo parameter. Right now I use this: /&?foo\=[^&]+/ That works as long as foo is not the first parameter in the query string. If it is, then my new query string starts with an ampersand. (For example, "foo=123&bar=456" gives a result of "&bar=456".) Right now, I'm just checking after the regex if the query string starts with ampersand, and chopping it off if it does. Example edge cases: Input | Output -------------------------+----------------- foo=123 | (empty string) foo=123&bar=456 | bar=456 bar=456&foo=123 | bar=456 abc=789&foo=123&bar=456 | abc=789&bar=456 Edit OK as pointed out in comments there are there are way more edge cases than I originally considered. I got the following regex to work with all of them: /&foo(\=[^&]*)?(?=&|$)|^foo(\=[^&]*)?(&|$)/ This is modified from Mark Byers's answer, which is why I'm accepting that one, but Roger Pate's input helped a lot too. Here is the full suite of test cases I'm using, and a Perl script which tests them. Input | Output -------------------------+------------------- foo | foo&bar=456 | bar=456 bar=456&foo | bar=456 abc=789&foo&bar=456 | abc=789&bar=456 foo= | foo=&bar=456 | bar=456 bar=456&foo= | bar=456 abc=789&foo=&bar=456 | abc=789&bar=456 foo=123 | foo=123&bar=456 | bar=456 bar=456&foo=123 | bar=456 abc=789&foo=123&bar=456 | abc=789&bar=456 xfoo | xfoo xfoo&bar=456 | xfoo&bar=456 bar=456&xfoo | bar=456&xfoo abc=789&xfoo&bar=456 | abc=789&xfoo&bar=456 xfoo= | xfoo= xfoo=&bar=456 | xfoo=&bar=456 bar=456&xfoo= | bar=456&xfoo= abc=789&xfoo=&bar=456 | abc=789&xfoo=&bar=456 xfoo=123 | xfoo=123 xfoo=123&bar=456 | xfoo=123&bar=456 bar=456&xfoo=123 | bar=456&xfoo=123 abc=789&xfoo=123&bar=456 | abc=789&xfoo=123&bar=456 foox | foox foox&bar=456 | foox&bar=456 bar=456&foox | bar=456&foox abc=789&foox&bar=456 | abc=789&foox&bar=456 foox= | foox= foox=&bar=456 | foox=&bar=456 bar=456&foox= | bar=456&foox= abc=789&foox=&bar=456 | abc=789&foox=&bar=456 foox=123 | foox=123 foox=123&bar=456 | foox=123&bar=456 bar=456&foox=123 | bar=456&foox=123 abc=789&foox=123&bar=456 | abc=789&foox=123&bar=456 Test script (Perl) @in = ('foo' , 'foo&bar=456' , 'bar=456&foo' , 'abc=789&foo&bar=456' ,'foo=' , 'foo=&bar=456' , 'bar=456&foo=' , 'abc=789&foo=&bar=456' ,'foo=123' , 'foo=123&bar=456' , 'bar=456&foo=123' , 'abc=789&foo=123&bar=456' ,'xfoo' , 'xfoo&bar=456' , 'bar=456&xfoo' , 'abc=789&xfoo&bar=456' ,'xfoo=' , 'xfoo=&bar=456' , 'bar=456&xfoo=' , 'abc=789&xfoo=&bar=456' ,'xfoo=123', 'xfoo=123&bar=456', 'bar=456&xfoo=123', 'abc=789&xfoo=123&bar=456' ,'foox' , 'foox&bar=456' , 'bar=456&foox' , 'abc=789&foox&bar=456' ,'foox=' , 'foox=&bar=456' , 'bar=456&foox=' , 'abc=789&foox=&bar=456' ,'foox=123', 'foox=123&bar=456', 'bar=456&foox=123', 'abc=789&foox=123&bar=456' ); @exp = ('' , 'bar=456' , 'bar=456' , 'abc=789&bar=456' ,'' , 'bar=456' , 'bar=456' , 'abc=789&bar=456' ,'' , 'bar=456' , 'bar=456' , 'abc=789&bar=456' ,'xfoo' , 'xfoo&bar=456' , 'bar=456&xfoo' , 'abc=789&xfoo&bar=456' ,'xfoo=' , 'xfoo=&bar=456' , 'bar=456&xfoo=' , 'abc=789&xfoo=&bar=456' ,'xfoo=123', 'xfoo=123&bar=456', 'bar=456&xfoo=123', 'abc=789&xfoo=123&bar=456' ,'foox' , 'foox&bar=456' , 'bar=456&foox' , 'abc=789&foox&bar=456' ,'foox=' , 'foox=&bar=456' , 'bar=456&foox=' , 'abc=789&foox=&bar=456' ,'foox=123', 'foox=123&bar=456', 'bar=456&foox=123', 'abc=789&foox=123&bar=456' ); print "Succ | Input | Output | Expected \n"; print "-----+--------------------------+--------------------------+-------------------------\n"; for($i=0; $i <= $#in; $i++) { $out = $in[$i]; $out =~ s/_PUT_REGEX_HERE_//; $succ = ($out eq $exp[$i] ? 'PASS' : 'FAIL'); #if($succ eq 'FAIL') #{ printf("%s | %- 24s | %- 24s | %- 24s\n", $succ, $in[$i], $out, $exp[$i]); #} }

    Read the article

  • Little Regular Expression (against HTML) help

    - by Marcos Placona
    Hi, I have the following HTML <p>Some text <a title="link" href="http://link.com/" target="_blank">my link</a> more text <a title="link" href="http://link.com/" target="_blank">more link</a>.</p> <p>Another paragraph.</p> <p>[code:cf]</p> <p>&lt;cfset ArrFruits = ["Orange", "Apple", "Peach", "Blueberry", </p> <p>"Blackberry", "Strawberry", "Grape", "Mango", </p> <p>"Clementine", "Cherry", "Plum", "Guava", </p> <p>"Cranberry"]&gt;</p> <p>[/code]</p> <p>Another line</p> <p><img src="http://image.jpg" alt="Array" /> </p> <p>More text</p> <p>[code:cf]</p> <p>&lt;table border="1"&gt;</p> <p> &lt;cfoutput&gt;</p> <p> &lt;cfloop array="#GroupsOf(ArrFruits, 5)#" index="arrFruitsIX"&gt;</p> <p>  &lt;tr&gt;</p> <p> &lt;cfloop array="#arrFruitsIX#" index="arrFruit"&gt;</p> <p>     &lt;td&gt;#arrFruit#&lt;/td&gt;</p> <p> &lt;/cfloop&gt;</p> <p>  &lt;/tr&gt;</p> <p> &lt;/cfloop&gt;</p> <p> &lt;/cfoutput&gt;</p> <p>&lt;/table&gt;</p> <p>[/code]</p> <p>With an output that looks like:</p> <p><img src="another_image.jpg" alt="" width="342" height="85" /></p> What I'm trying to do, is write a regular expression that will remove all the or , and whenever it finds a , it will replace it with a line-break. So far, my pattern looks like this: /\<p\>(.*?)(<\/p>)/g And I'm replacing the matches with: $1\n It all looks good, but it's also replacing the contents inside the [code][/code] tags, which in this case should not replace the tags at all, so as a result, i would lkike to get rid of the tags, when the content isn't inside the [code] tags. I can't ever get negation right, I know it will be something along the lines of \<p\>^\[code*\](.*?)(<\/p>) But obviously this doesn't work :-) Could anyone please lend me a hand with this regex? BTW, I know I shouldn't be using regular expressions to parse HTML at all. I'm fully aware of that, but still, for this specific case, I'd like to use regex. Thanks in advance

    Read the article

  • Visual Studio Find and Replace Regular Expressions ~ find lines with quoted strings, not containing

    - by Darkoni
    Visual Studio Find and Replace Regular Expressions Find lines with quoted strings, not containing strings include or trace i am tryling to find out all lines in c++ project that contains some text as i have to use visual studio, i have to use its Find and Replace http://www.codinghorror.com/blog/2006/07/the-visual-studio-ide-and-regular-expressions.html so, for finding all lines like: print("abc"); it is enogh to write :q and it will find all quotted strings ok, but i also get lot of lines like #include "stdio.h" and trace("* step 1 *") i find out regex to get all lines containing include and trace <include|trace> so, mine question is, how to find all lines with "quotted strings" but NOT lines that contains strings include and trace. thanx

    Read the article

  • JMeter to grab full querystring into a variable for future use

    - by jfbauer
    Someone provided me the regex to parse out a query string: (?<=\?)[^?]+$ I am trying to use that in JMeter with no luck (although I am successful in pulling out individual query string parameter values based on various example postings on the web). I created a regular expression extractor called "Grab QueryString". I selected the URL response field to check. For the reference name, I typed "myQueryString". For the regular expression, I entered your text. For template, I entered $1$ Match no = 1 Default Value = ERROR Unfortunately, "myQueryString" is getting populated with ERROR and not the URL query string as hoped when I try and use it as a parameter in a future GET. Thus, I see this in the "View Results Tree": https:/www.website.com/folder/page.aspx?ERROR Instead of: https:/www.website.com/folder/page.aspx?jfhjHSDjgdjhsjhsdhjSJHWed Did I do something wrong? Anyone have any suggestions?

    Read the article

  • Remove all html tags from attributes in rails

    - by Hock
    I have a Project model and it has some text attributes, one is summary. I have some projects that have html tags in the summary and I want to convert that to plain text. I have this method that has a regex that will remove all html tags. def strip_html_comments_on_data self.attributes.each{|key,value| value.to_s.gsub!(/(<[^>]+>|&nbsp;|\r|\n)/,"")} end I also have a before_save filter before_save :strip_html_comments_on_data The problem is that the html tags are still there after saving the project. What am I missing? And, is there a really easy way to have that method called in all the models? Thanks, Nicolás Hock Isaza

    Read the article

  • jQuery Javascript array 'contains' functionality?

    - by YourMomzThaBomb
    I'm trying to use the jQuery $.inArray function to iterate through an array and if there's an element whose text contains a particular keyword, remove that element. $.inArray is only returning the array index though if the element's text is equal to the keyword. For example given the following array named 'tokens': - tokens {...} Object [0] "Starbucks^25^http://somelink" String [1] "McDonalds^34^" String [2] "BurgerKing^31^https://www.somewhere.com" String And a call to removeElement(tokens, 'McDonalds'); would return the following array: - tokens {...} Object [0] "Starbucks^25^http://somelink" String [1] "BurgerKing^31^https://www.somewhere.com" String I'm guessing this may be possible using the jQuery $.grep or $.each function, or maybe regex. However, I'm not familiar enough with jQuery to accomplish this. Any help would be appreciated!

    Read the article

  • Repairing malformatted html attributes using c#

    - by jhoefnagels
    I have a web application with an upload functionality for HTML files generated by chess software to be able to include a javascript player that reproduces a chess game. I do not like to load the uploaded files in a frame so I reconstruct the HTML and javascript generated by the software by parsing the dynamic parts of the file. The problem with the HTML is that all attributes values are surrounded with an apostrophe instead of a quotation mark. I am looking for a way to fix this using a library or a regex replace using c#. The html looks like this: <DIV class='pgb'><TABLE class='pgbb' CELLSPACING='0' CELLPADDING='0'><TR><TD> and I would transform it into: <DIV class="pgb"><TABLE class="pgbb" CELLSPACING="0" CELLPADDING="0"><TR><TD>

    Read the article

  • How to Pregreplace {number}) with \n{number})

    - by streetparade
    How can i replace {number}) with \n{number}) Say i have something like this 1) test string testing new string. 2) that is also a new string no new line. 3) here also no new lines. The output should be something like this 1) test string testing new string. 2) that is also a new string no new line. 3) here also no new lines. How can i do that with a regex?

    Read the article

< Previous Page | 65 66 67 68 69 70 71 72 73 74 75 76  | Next Page >