Search Results

Search found 17754 results on 711 pages for 'field description'.

Page 696/711 | < Previous Page | 692 693 694 695 696 697 698 699 700 701 702 703  | Next Page >

  • parentNode.parentNode.rowindex to delete a row in a dynamic table

    - by billy85
    I am creating my rows dynamically when the user clicks on "Ajouter". <?xml version="1.0" encoding="UTF-8"?> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html> <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <script> function getXhr(){ var xhr = null; if(window.XMLHttpRequest) // Firefox and others xhr = new XMLHttpRequest(); else if(window.ActiveXObject){ // Internet Explorer try { xhr = new ActiveXObject("Msxml2.XMLHTTP"); } catch (e) { xhr = new ActiveXObject("Microsoft.XMLHTTP"); } } else { // XMLHttpRequest not supported by your browser alert("Votre navigateur ne supporte pas les objets XMLHTTPRequest..."); xhr = false; } return xhr } /** * method called when the user clicks on the button */ function go(){ var xhr = getXhr() // We defined what we gonna do with the response xhr.onreadystatechange = function(){ // We do somthing once the server's response is OK if(xhr.readyState == 4 && xhr.status == 200){ //alert(xhr.responseText); var body = document.getElementsByTagName("body")[0]; // Retrieve <table> ID and create a <tbody> element var tbl = document.getElementById("table"); var tblBody = document.createElement("tbody"); var row = document.createElement("tr"); // Create <td> elements and a text node, make the text // node the contents of the <td>, and put the <td> at // the end of the table row var cell_1 = document.createElement("td"); var cell_2 = document.createElement("td"); var cell_3 = document.createElement("td"); var cell_4 = document.createElement("td"); // Create the first cell which is a text zone var cell1=document.createElement("input"); cell1.type="text"; cell1.name="fname"; cell1.size="20"; cell1.maxlength="50"; cell_1.appendChild(cell1); // Create the second cell which is a text area var cell2=document.createElement("textarea"); cell2.name="fdescription"; cell2.rows="2"; cell2.cols="30"; cell_2.appendChild(cell2); var cell3 = document.createElement("div"); cell3.innerHTML=xhr.responseText; cell_3.appendChild(cell3); // Create the fourth cell which is a href var cell4 = document.createElement("a"); cell4.appendChild(document.createTextNode("[Delete]")); cell4.setAttribute("href","javascrit:deleteRow();"); cell_4.appendChild(cell4); // add cells to the row row.appendChild(cell_1); row.appendChild(cell_2); row.appendChild(cell_3); row.appendChild(cell_4); // add the row to the end of the table body tblBody.appendChild(row); // put the <tbody> in the <table> tbl.appendChild(tblBody); // appends <table> into <body> body.appendChild(tbl); // sets the border attribute of tbl to 2; tbl.setAttribute("border", "1"); } } xhr.open("GET","fstatus.php",true); xhr.send(null); } </head> <body > <h1> Create an Item </h1> <form method="post"> <table align="center" border = "2" cellspacing ="0" cellpadding="3" id="table"> <tr><td><b>Functionality Name:</b></td> <td><b>Description:</b></td> <td><b>Status:</b></td> <td><input type="button" Name= "Ajouter" Value="Ajouter" onclick="go()"></td></tr> </table> </form> </body> </html> Now, I would like to use the href [Delete] to delete one particular row. I wrote this: <script type="text/javascript"> function deleteRow(r){ var i=r.parentNode.parentNode.rowIndex; document.getElementById('table').deleteRow(i); } </script> When I change the first code like this: cell4.setAttribute("href","javascrit:deleteRow(this);"); I got an error: The page cannot be displayed. I am redirected to a new pagewhich can not be displayed. How could I delete my row by using the function deleteRow(r)? table is the id of my table Thanks. Billy85

    Read the article

  • How should I model the database for this problem? And which ORM can handle it?

    - by Kristof Claes
    I need to build some sort of a custom CMS for a client of ours. These are some of the functional requirements: Must be able to manage the list of Pages in the site Each Page can contain a number of ColumnGroups A ColumnGroup is nothing more than a list of Columns in a certain ColumnGroupLayout. For example: "one column taking up the entire width of the page", "two columns each taking up half of the width", ... Each Column can contain a number ContentBlocks Examples of a ContentBlock are: TextBlock, NewsBlock, PictureBlock, ... ContentBlocks can be given a certain sorting within a Column A ContentBlock can be put in different Columns so that content can be reused without having to be duplicated. My first quick draft of how this could look like in C# code (we're using ASP.NET 4.0 to develop the CMS) can be found at the bottom of my question. One of the technical requirements is that it must be as easy as possible to add new types of ContentBlocks to the CMS. So I would like model everything as flexible as possible. Unfortunately, I'm already stuck at trying to figure out how the database should look like. One of the problems I'm having has to do with sorting different types of ContentBlocks in a Column. I guess each type of ContentBlock (like TextBlock, NewsBlock, PictureBlock, ...) should have it's own table in the database because each has it's own different fields. A TextBlock might only have a field called Text whereas a NewsBlock might have fields for the Text, the Summary, the PublicationDate, ... Since one Column can have ContentBlocks located in different tables, I guess I'll have to create a many-to-many association for each type of ContentBlock. For example: ColumnTextBlocks, ColumnNewsBlocks and ColumnPictureBlocks. The problem I have with this setup is the sorting of the different ContentBlocks in a column. This could be something like this: TextBlock NewsBlock TextBlock TextBlock PictureBlock Where do I store the sorting number? If I store them in the associaton tables, I'll have to update a lot of tables when changing the sorting order of ContentBlocks in a Column. Is this a good approach to the problem? Basically, my question is: What is the best way to model this keeping in mind that it should be easy to add new types of ContentBlocks? My next question is: What ORM can deal with that kind of modeling? To be honest, we are ORM-virgins at work. I have been reading a bit about Linq-to-SQL and NHibernate, but we have no experience with them. Because of the IList in the Column class (see code below) I think we can rule out Linq-to-SQL, right? Can NHibernate handle the mapping of data from many different tables to one IList? Also keep in mind that this is just a very small portion of the domain. Other parts are Users belonging to a certain UserGroup having certain Permissions on Pages, ColumnGroups, Columns and ContentBlocks. The code (just a quick first draft): public class Page { public int PageID { get; set; } public string Title { get; set; } public string Description { get; set; } public string Keywords { get; set; } public IList<ColumnGroup> ColumnGroups { get; set; } } public class ColumnGroup { public enum ColumnGroupLayout { OneColumn, HalfHalf, NarrowWide, WideNarrow } public int ColumnGroupID { get; set; } public ColumnGroupLayout Layout { get; set; } public IList<Column> Columns { get; set; } } public class Column { public int ColumnID { get; set; } public IList<IContentBlock> ContentBlocks { get; set; } } public interface IContentBlock { string GetSummary(); } public class TextBlock : IContentBlock { public string GetSummary() { return "I am a piece of text."; } } public class NewsBlock : IContentBlock { public string GetSummary() { return "I am a news item."; } }

    Read the article

  • asp.net labels and asp.net textboxes are not lining up correctly?

    - by Xaisoft
    My Registration page currently looks like the following: The current styling I have for the above is image is: <style type="text/css"> #contactinfo label { float: left; width: 10em; margin-right: 0.5em; text-align: right; font-size: 14px; } #contactinfo p { padding: 5px; } #contactinfo input[type="text"], input[type="password"] { height: 1.5em; } #contactinfo select { padding: 0.25em; } #contactinfo input[type="text"]:focus, input[type="password"]:focus { background-color: #FFFFE0; } #contactinfo .update { margin-left: 12.5em; } #contactinfo .error { background-color: transparent; } #contactinfo .longtextbox { width: 20em; } #contactinfo .shorttextbox { width: 5em; } </style> and the markup is <div id="contactinfo"> <p> <asp:Label runat="server" AssociatedControlID="txtEmail">Email </asp:Label> <asp:TextBox ID="txtEmail" runat="server" CssClass="longtextbox" /> </p> <p> <asp:Label runat="server" AssociatedControlID="txtFirstName">First Name </asp:Label> <asp:TextBox ID="txtFirstName" runat="server" ValidationGroup="AccountValidation" /> <asp:RequiredFieldValidator runat="server" ControlToValidate="txtFirstName" Text="First Name is required." ValidationGroup="AccountValidation" CssClass="error"> </asp:RequiredFieldValidator> </p> <p> <asp:Label runat="server" AssociatedControlID="txtLastName">Last Name </asp:Label> <asp:TextBox ID="txtLastName" runat="server" ValidationGroup="AccountValidation" /> <asp:RequiredFieldValidator runat="server" ControlToValidate="txtLastName" Text="Last Name is required." ValidationGroup="AccountValidation" CssClass="error"> </asp:RequiredFieldValidator> </p> <p> <asp:Label runat="server" AssociatedControlID="txtBusinessName">Business Name </asp:Label> <asp:TextBox ID="txtBusinessName" runat="server" CssClass="longtextbox" ValidationGroup="AccountValidation" /> <asp:RequiredFieldValidator runat="server" ControlToValidate="txtBusinessName" Text="Business Name is required." ValidationGroup="AccountValidation" CssClass="error"> </asp:RequiredFieldValidator> </p> <p> <asp:Label runat="server" AssociatedControlID="txtPhone">Phone </asp:Label> <asp:TextBox ID="txtPhone" runat="server" ValidationGroup="AccountValidation" /> </p> <p> <asp:Label runat="server" AssociatedControlID="txtAddress">Address </asp:Label> <asp:TextBox ID="txtAddress" runat="server" CssClass="longtextbox" ValidationGroup="AccountValidation" /> <asp:RequiredFieldValidator runat="server" ControlToValidate="txtAddress" Text="Address is required." ValidationGroup="AccountValidation" CssClass="error"></asp:RequiredFieldValidator> </p> <p> <asp:Label runat="server" AssociatedControlID="txtCity">City </asp:Label><asp:TextBox ID="txtCity" runat="server" ValidationGroup="AccountValidation" /> <asp:RequiredFieldValidator ID="RequiredFieldValidator4" runat="server" ControlToValidate="txtCity" Text="City is required." ValidationGroup="AccountValidation" CssClass="error"> </asp:RequiredFieldValidator> </p> <p> <asp:Label runat="server" AssociatedControlID="ddlState">State </asp:Label> <asp:DropDownList ID="ddlState" runat="server" DataSourceID="dsStates" DataTextField="Name" DataValueField="Id"> </asp:DropDownList> </p> <p> <asp:Label runat="server" AssociatedControlID="txtZipcode">Zipcode</asp:Label> <asp:TextBox ID="txtZipCode" runat="server" CssClass="shorttextbox" ValidationGroup="AccountValidation" /> </p> </div> As you can see from above, I have every label field pair wrapped in a p tag so it breaks to the next line, but I am not sure if I need to do this. I want to get city, state, and zip all on the same line, but as soon as I move all the labels and inputs for city,state,zip into one p tag, it looks like the following and I don't know how to fix it.

    Read the article

  • MVC 3 Remote Validation jQuery error on submit

    - by Richard Reddy
    I seem to have a weird issue with remote validation on my project. I am doing a simple validation check on an email field to ensure that it is unique. I've noticed that unless I put the cursor into the textbox and then remove it to trigger the validation at least once before submitting my form I will get a javascript error. e[h] is not a function jquery.min.js line 3 If I try to resubmit the form after the above error is returned everything works as expected. It's almost like the form tried to submit before waiting for the validation to return or something. Am I required to silently fire off a remote validation request on submit before submitting my form? Below is a snapshot of the code I'm using: (I've also tried GET instead of POST but I get the same result). As mentioned above, the code works fine but the form returns a jquery error unless the validation is triggered at least once. Model: public class RegisterModel { [Required] [Remote("DoesUserNameExist", "Account", HttpMethod = "POST", ErrorMessage = "User name taken.")] [Display(Name = "User name")] public string UserName { get; set; } [Required] [Display(Name = "Firstname")] public string Firstname { get; set; } [Display(Name = "Surname")] public string Surname { get; set; } [Required] [Remote("DoesEmailExist", "Account", HttpMethod = "POST", ErrorMessage = "Email taken.", AdditionalFields = "UserName")] [Display(Name = "Email address")] public string Email { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Password")] public string Password { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Confirm password")] public string ConfirmPassword { get; set; } [Display(Name = "Approved?")] public bool IsApproved { get; set; } } public class UserRoleModel { [Display(Name = "Assign Roles")] public IEnumerable<RoleViewModel> AllRoles { get; set; } public RegisterModel RegisterUser { get; set; } } Controller: // POST: /Account/DoesEmailExist // passing in username so that I can ignore the same email address for the same user on edit page [HttpPost] public JsonResult DoesEmailExist([Bind(Prefix = "RegisterUser.Email")]string Email, [Bind(Prefix = "RegisterUser.UserName")]string UserName) { var user = Membership.GetUserNameByEmail(Email); if (!String.IsNullOrEmpty(UserName)) { if (user == UserName) return Json(true); } return Json(user == null); } View: <script src="//ajax.googleapis.com/ajax/libs/jquery/1.7.1/jquery.min.js" type="text/javascript"></script> <script src="//ajax.googleapis.com/ajax/libs/jqueryui/1.8.17/jquery-ui.min.js" type="text/javascript"></script> <script type="text/javascript" src="/Content/web/js/jquery.unobtrusive-ajax.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.unobtrusive.min.js"></script> ...... @using (Html.BeginForm()) { @Html.AntiForgeryToken() <div class="titleh"> <h3>Edit a user account</h3> </div> <div class="body"> @Html.HiddenFor(model => model.RegisterUser.UserName) @Html.Partial("_CreateOrEdit", Model) <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(model => model.RegisterUser.IsApproved)</span> @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, true, new { @class = "uniform" }) Active @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, false, new { @class = "uniform" }) Disabled <div class="clear"></div> </div> <div class="button-box"> <input type="submit" name="submit" value="Save" class="st-button"/> @Html.ActionLink("Back to List", "Index", null, new { @class = "st-clear" }) </div> </div> } CreateEdit Partial View @model Project.Domain.Entities.UserRoleModel <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Firstname)</span> @Html.TextBoxFor(m => m.RegisterUser.Firstname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Firstname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Surname)</span> @Html.TextBoxFor(m => m.RegisterUser.Surname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Surname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Email)</span> @Html.TextBoxFor(m => m.RegisterUser.Email, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Email) <div class="clear"></div> </div> Thanks, Rich

    Read the article

  • Sorting/Paginating/Filtering Complex Multi-AR Object Tables in Rails

    - by Matt Rogish
    I have a complex table pulled from a multi-ActiveRecord object array. This listing is a combined display of all of a particular user's "favorite" items (songs, messages, blog postings, whatever). Each of these items is a full-fledged AR object. My goal is to present the user with a simplified search, sort, and pagination interface. The user need not know that the Song has a singer, and that the Message has an author -- to the end user both entries in the table will be displayed as "User". Thus, the search box will simply be a dropdown list asking them which to search on (User name, created at, etc.). Internally, I would need to convert that to the appropriate object search, combine the results, and display. I can, separately, do pagination (mislav will_paginate), sorting, and filtering, but together I'm having some problems combining them. For example, if I paginate the combined list of items, the pagination plugin handles it just fine. It is not efficient since the pagination is happening in the app vs. the DB, but let's assume the intended use-case would indicate the vast majority of the users will have less than 30 favorited items and all other behavior, server capabilities, etc. indicates this will not be a bottleneck. However, if I wish to sort the list I cannot sort it via the pagination plugin because it relies on the assumption that the result set is derived from a single SQL query, and also that the field name is consistent throughout. Thus, I must sort the merged array via ruby, e.g. @items.sort_by{ |i| i.whatever } But, since the items do not share common names, I must first interrogate the object and then call the correct sort by. For example, if the user wishes to sort by user name, if the sorted object is a message, I sort by author but if the object is a song, I sort by singer. This is all very gross and feels quite un-ruby-like. This same problem comes into play with the filter. If the user filters on the "parent item" (the message's thread, the song's album), I must translate that to the appropriate collection object method. Also gross. This is not the exact set-up but is close enough. Note that this is a legacy app so changing it is quite difficult, although not impossible. Also, yes there is some DRY that can be done, but don't focus on the style or elegance of the following code. Style/elegance of the SOLUTION is important, however! :D models: class User < ActiveRecord::Base ... has_and_belongs_to_many :favorite_messages, :class_name => "Message" has_and_belongs_to_many :favorite_songs, :class_name => "Song" has_many :authored_messages, :class_name => "Message" has_many :sung_songs, :class_name => "Song" end class Message < ActiveRecord::Base has_and_belongs_to_many :favorite_messages belongs_to :author, :class_name => "User" belongs_to :thread end class Song < ActiveRecord::Base has_and_belongs_to_many :favorite_songs belongs_to :singer, :class_name => "User" belongs_to :album end controller: def show u = User.find 123 @items = Array.new @items << u.favorite_messages @items << u.favorite_songs # etc. etc. @items.flatten! @items = @items.sort_by{ |i| i.created_at } @items = @items.paginate :page => params[:page], :per_page => 20 end def search # Assume user is searching for username like 'Bob' u = User.find 123 @items = Array.new @items << u.favorite_messages.find( :all, :conditions => "LOWER( author ) LIKE LOWER('%bob%')" ) @items << u.favorite_songs.find( :all, :conditions => "LOWER( singer ) LIKE ... " ) # etc. etc. @items.flatten! @items = @items.sort_by{ |i| determine appropriate sorting based on user selection } @items = @items.paginate :page => params[:page], :per_page => 20 end view: #index.html.erb ... <table> <tr> <th>Title (sort ASC/DESC links)</th> <th>Created By (sort ASC/DESC links))</th> <th>Collection Title (sort ASC/DESC links)</th> <th>Created At (sort ASC/DESC links)</th> </tr> <% @items.each |item| do %> <%= render { :partial => "message", :locals => item } if item.is_a? Message %> <%= render { :partial => "song", :locals => item } if item.is_a? Song %> <%end%> ... </table> #message.html.erb # shorthand, not real ruby print out message title, author name, thread title, message created at #song.html.erb # shorthand print out song title, singer name, album title, song created at

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How to implement Cocoa copyWithZone on derived object in MonoMac C#?

    - by Justin Aquadro
    I'm currently porting a small Winforms-based .NET application to use a native Mac front-end with MonoMac. The application has a TreeControl with icons and text, which does not exist out of the box in Cocoa. So far, I've ported almost all of the ImageAndTextCell code in Apple's DragNDrop example: https://developer.apple.com/library/mac/#samplecode/DragNDropOutlineView/Listings/ImageAndTextCell_m.html#//apple_ref/doc/uid/DTS40008831-ImageAndTextCell_m-DontLinkElementID_6, which is assigned to an NSOutlineView as a custom cell. It seems to be working almost perfectly, except that I have not figured out how to properly port the copyWithZone method. Unfortunately, this means the internal copies that NSOutlineView is making do not have the image field, and it leads to the images briefly vanishing during expand and collapse operations. The objective-c code in question is: - (id)copyWithZone:(NSZone *)zone { ImageAndTextCell *cell = (ImageAndTextCell *)[super copyWithZone:zone]; // The image ivar will be directly copied; we need to retain or copy it. cell->image = [image retain]; return cell; } The first line is what's tripping me up, as MonoMac does not expose a copyWithZone method, and I don't know how to otherwise call it. Update Based on current answers and additional research and testing, I've come up with a variety of models for copying an object. static List<ImageAndTextCell> _refPool = new List<ImageAndTextCell>(); // Method 1 static IntPtr selRetain = Selector.GetHandle ("retain"); [Export("copyWithZone:")] public virtual NSObject CopyWithZone(IntPtr zone) { ImageAndTextCell cell = new ImageAndTextCell() { Title = Title, Image = Image, }; Messaging.void_objc_msgSend (cell.Handle, selRetain); return cell; } // Method 2 [Export("copyWithZone:")] public virtual NSObject CopyWithZone(IntPtr zone) { ImageAndTextCell cell = new ImageAndTextCell() { Title = Title, Image = Image, }; _refPool.Add(cell); return cell; } [Export("dealloc")] public void Dealloc () { _refPool.Remove(this); this.Dispose(); } // Method 3 static IntPtr selRetain = Selector.GetHandle ("retain"); [Export("copyWithZone:")] public virtual NSObject CopyWithZone(IntPtr zone) { ImageAndTextCell cell = new ImageAndTextCell() { Title = Title, Image = Image, }; _refPool.Add(cell); Messaging.void_objc_msgSend (cell.Handle, selRetain); return cell; } // Method 4 static IntPtr selRetain = Selector.GetHandle ("retain"); static IntPtr selRetainCount = Selector.GetHandle("retainCount"); [Export("copyWithZone:")] public virtual NSObject CopyWithZone (IntPtr zone) { ImageAndTextCell cell = new ImageAndTextCell () { Title = Title, Image = Image, }; _refPool.Add (cell); Messaging.void_objc_msgSend (cell.Handle, selRetain); return cell; } public void PeriodicCleanup () { List<ImageAndTextCell> markedForDelete = new List<ImageAndTextCell> (); foreach (ImageAndTextCell cell in _refPool) { uint count = Messaging.UInt32_objc_msgSend (cell.Handle, selRetainCount); if (count == 1) markedForDelete.Add (cell); } foreach (ImageAndTextCell cell in markedForDelete) { _refPool.Remove (cell); cell.Dispose (); } } // Method 5 static IntPtr selCopyWithZone = Selector.GetHandle("copyWithZone:"); [Export("copyWithZone:")] public virtual NSObject CopyWithZone(IntPtr zone) { IntPtr copyHandle = Messaging.IntPtr_objc_msgSendSuper_IntPtr(SuperHandle, selCopyWithZone, zone); ImageAndTextCell cell = new ImageAndTextCell(copyHandle) { Image = Image, }; _refPool.Add(cell); return cell; } Method 1: Increases the retain count of the unmanaged object. The unmanaged object will persist persist forever (I think? dealloc never called), and the managed object will be harvested early. Seems to be lose-lose all-around, but runs in practice. Method 2: Saves a reference of the managed object. The unmanaged object is left alone, and dealloc appears to be invoked at a reasonable time by the caller. At this point the managed object is released and disposed. This seems reasonable, but on the downside the base type's dealloc won't be run (I think?) Method 3: Increases the retain count and saves a reference. Unmanaged and managed objects leak forever. Method 4: Extends Method 3 by adding a cleanup function that is run periodically (e.g. during Init of each new ImageAndTextCell object). The cleanup function checks the retain counts of the stored objects. A retain count of 1 means the caller has released it, so we should as well. Should eliminate leaking in theory. Method 5: Attempt to invoke the copyWithZone method on the base type, and then construct a new ImageAndTextView object with the resulting handle. Seems to do the right thing (the base data is cloned). Internally, NSObject bumps the retain count on objects constructed like this, so we also use the PeriodicCleanup function to release these objects when they're no longer used. Based on the above, I believe Method 5 is the best approach since it should be the only one that results in a truly correct copy of the base type data, but I don't know if the approach is inherently dangerous (I am also making some assumptions about the underlying implementation of NSObject). So far nothing bad has happened "yet", but if anyone is able to vet my analysis then I would be more confident going forward.

    Read the article

  • C# Reading and Writing a Char[] to and from a Byte[] - Updated with Solution

    - by Simon G
    Hi, I have a byte array of around 10,000 bytes which is basically a blob from delphi that contains char, string, double and arrays of various types. This need to be read in and updated via C#. I've created a very basic reader that gets the byte array from the db and converts the bytes to the relevant object type when accessing the property which works fine. My problem is when I try to write to a specific char[] item, it doesn't seem to update the byte array. I've created the following extensions for reading and writing: public static class CharExtension { public static byte ToByte( this char c ) { return Convert.ToByte( c ); } public static byte ToByte( this char c, int position, byte[] blob ) { byte b = c.ToByte(); blob[position] = b; return b; } } public static class CharArrayExtension { public static byte[] ToByteArray( this char[] c ) { byte[] b = new byte[c.Length]; for ( int i = 1; i < c.Length; i++ ) { b[i] = c[i].ToByte(); } return b; } public static byte[] ToByteArray( this char[] c, int positon, int length, byte[] blob ) { byte[] b = c.ToByteArray(); Array.Copy( b, 0, blob, positon, length ); return b; } } public static class ByteExtension { public static char ToChar( this byte[] b, int position ) { return Convert.ToChar( b[position] ); } } public static class ByteArrayExtension { public static char[] ToCharArray( this byte[] b, int position, int length ) { char[] c = new char[length]; for ( int i = 0; i < length; i++ ) { c[i] = b.ToChar( position ); position += 1; } return c; } } to read and write chars and char arrays my code looks like: Byte[] _Blob; // set from a db field public char ubin { get { return _tariffBlob.ToChar( 14 ); } set { value.ToByte( 14, _Blob ); } } public char[] usercaplas { get { return _tariffBlob.ToCharArray( 2035, 10 ); } set { value.ToByteArray( 2035, 10, _Blob ); } } So to write to the objects I can do: ubin = 'C'; // this will update the byte[] usercaplas = new char[10] { 'A', 'B', etc. }; // this will update the byte[] usercaplas[3] = 'C'; // this does not update the byte[] I know the reason is that the setter property is not being called but I want to know is there a way around this using code similar to what I already have? I know a possible solution is to use a private variable called _usercaplas that I set and update as needed however as the byte array is nearly 10,000 bytes in length the class is already long and I would like a simpler approach as to reduce the overall code length and complexity. Thank Solution Here's my solution should anyone want it. If you have a better way of doing then let me know please. First I created a new class for the array: public class CharArrayList : ArrayList { char[] arr; private byte[] blob; private int length = 0; private int position = 0; public CharArrayList( byte[] blob, int position, int length ) { this.blob = blob; this.length = length; this.position = position; PopulateInternalArray(); SetArray(); } private void PopulateInternalArray() { arr = blob.ToCharArray( position, length ); } private void SetArray() { foreach ( char c in arr ) { this.Add( c ); } } private void UpdateInternalArray() { this.Clear(); SetArray(); } public char this[int i] { get { return arr[i]; } set { arr[i] = value; UpdateInternalArray(); } } } Then I created a couple of extension methods to help with converting to a byte[] public static byte[] ToByteArray( this CharArrayList c ) { byte[] b = new byte[c.Count]; for ( int i = 0; i < c.Count; i++ ) { b[i] = Convert.ToChar( c[i] ).ToByte(); } return b; } public static byte[] ToByteArray( this CharArrayList c, byte[] blob, int position, int length ) { byte[] b = c.ToByteArray(); Array.Copy( b, 0, blob, position, length ); return b; } So to read and write to the object: private CharArrayList _usercaplass; public CharArrayList usercaplas { get { if ( _usercaplass == null ) _usercaplass = new CharArrayList( _tariffBlob, 2035, 100 ); return _usercaplass; } set { _usercaplass = value; _usercaplass.ToByteArray( _tariffBlob, 2035, 100 ); } } As mentioned before its not an ideal solutions as I have to have private variables and extra code in the setter but I couldnt see a way around it.

    Read the article

  • pass an ID with hyperlik but cant get this ID value from a fk in one table when i click in insert

    - by susan
    Something strange happened in my codes, actually I have a hyperlink that pass ID value in a query string to second page.in second page i have 2 sql datasource that both these sql datasources should get this id value and pass it to a filter parameter to show sth in datalist. so in another word I have a first page that has an hyperlink read ID value from a datasource and pass it to second page.its like below: <asp:HyperLink ID="HyperLink1" runat="server" NavigateUrl='<%# "~/forumpage.aspx?ID="+Eval("ID")%>'><%#Eval("title")%> </asp:HyperLink> then in second page i have one sql datasource with a query like this ...where ID=@id and get this id in query string from db.it work great . but i have problem with second sql datasource in second page it has a query sth like below:...forms.question_id=@id then in sql reference both to query string as ID that get by first page in hyperlink. but when i click in insert button show me error with fk. error:Error:The INSERT statement conflicted with the FOREIGN KEY constraint "FK_forumreply_forumquestions". The conflict occurred in database "forum", table "dbo.forumquestions", column 'ID'. The statement has been terminated. my tables (question(ID,user_id(fk),Cat_id(fk),title,bodytext) (reply(ID,userr_id(fk),questionn_id(fk),titlereply,bodytestreply); When by hand in cb i gave a number in questionn_id like 1 it show me successful but when it want read from a filter by datasource this field face with problem. plzzzz help i really need skip from this part.and cause i am new i guess I cant understand the logic way clearly. <asp:SqlDataSource ID="sdsreply" runat="server" ConnectionString="<%$ ConnectionStrings:forumConnectionString %>" SelectCommand="SELECT forumreply.ID, forumreply.userr_id, forumreply.questionn_id, forumreply.bodytextreply, forumreply.datetimereply, forumquestions.ID AS Expr1, forumusers.ID AS Expr2, forumusers.username FROM forumquestions INNER JOIN forumreply ON forumquestions.ID = forumreply.questionn_id INNER JOIN forumusers ON forumquestions.user_id = forumusers.ID AND forumreply.userr_id = forumusers.ID where forumreply.questionn_id=@questionn_id"> <SelectParameters> <asp:QueryStringParameter Name="questionn_id" QueryStringField="ID" /> </SelectParameters> </asp:SqlDataSource> it is cb for second page in insert button: { if (Session["userid"] != null) { lblreply.Text = Session["userid"].ToString(); } else { Session["userid"]=null; } if (HttpContext.Current.User.Identity.IsAuthenticated) { lblshow.Text = string.Empty; string d = HttpContext.Current.User.Identity.Name; lblshow.Text =d + "???? ??? ?????." ; foreach (DataListItem item in DataList2.Items) { Label questionn_idLabel = (Label)item.FindControl("questionn_idLabel"); Label userr_idLabel = (Label)item.FindControl("userr_idLabel"); lbltest.Text = string.Empty; lbltest.Text = questionn_idLabel.Text; lblreply.Text = string.Empty; lblreply.Text = userr_idLabel.Text; } } else { lblshow.Text = "??? ??? ??? ??? ?? ?? ?????? ???? ???? ???? ????? ??? ??? ? ??? ????? ???????."; } } { if(HttpContext.Current.User.Identity.IsAuthenticated) { if (Page.IsValid) { SqlConnection con = new SqlConnection(ConfigurationManager.ConnectionStrings["forumConnectionString"].ConnectionString); try { con.Open(); SqlCommand cmd = new SqlCommand("insert into forumreply (userr_id,questionn_id,bodytextreply,datetimereply)values(@userr_id,@questionn_id,@bodytextreply,@datetimereply)", con); cmd.Parameters.AddWithValue("userr_id",lblreply.Text); cmd.Parameters.AddWithValue("questionn_id",lbltest.Text); cmd.Parameters.AddWithValue("bodytextreply",txtbody.Text); cmd.Parameters.AddWithValue("datetimereply",DateTime.Now ); cmd.ExecuteNonQuery(); } catch (Exception exp) { Response.Write("<b>Error:</b>"); Response.Write(exp.Message); } finally { con.Close(); } lblmsg.Text = "???? ??? ?? ?????? ??? ?????.thx"; lblshow.Visible = false; //lbltxt.Text = txtbody.Text; txtbody.Text = string.Empty; } } else { lblmsg.Text = string.Empty; Session["rem"] = Request.UrlReferrer.AbsoluteUri; Response.Redirect("~/login.aspx"); } }

    Read the article

  • i have made a from and want to connect it to a oracle 10g data base using php.can you please assume

    - by nachiket-panse
    http://www.freecsstemplates.org Released for free under a Creative Commons Attribution 2.5 License -- Sitename.com by Free Css Templates MANAGEMEINT INFORMATION SYSTEM   <p class="style2">&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;REGISTRY ENTRY FORM </p> <form id="form2" method="post" action=""> <p align="center">&nbsp;</p> <p align="center"><span class="style3">JOB DESCRIPTION :</span>&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp; &nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp; <textarea name="textarea"></textarea> </p> <p align="center"><span class="style3">QUANTITY :</span>&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp; <input type="text" name="textfield5" /> </p> <p align="center">&nbsp;<span class="style3">CONTACT PERSON </span>&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp; <input type="text" name="textfield3" /> </p> <p align="center">&nbsp;</p> <p align="center"><span class="style3">DIVISION CODE: <textarea name="textarea3"></textarea> </span></p> <p align="center"><span class="style3">ACCEPTANCE DATE </span>: <input type="text" name="textfield4" /> </p> <p align="center"><span class="style3">REFERENCE NUMBER :</span> <input type="text" name="textfield2" /> </p> <p align="center"><span class="style3">CLASSIFICATION :</span>&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp; <input type="text" name="textfield" /></p> <p align="center">&nbsp;</p> <p align="center"><span class="style3">CUMULATIVE COST: </span> <select name="select"> </select> </p> <p align="center"><span class="style3">PLANNING ENGR: </span> <textarea name="textarea2"></textarea> </p> <p align="center"><span class="style3">PLANNING: </span> <input type="text" name="textfield6" /> </p> <p align="center"> <span class="style3">FILL THE COMPLETION DATE: </span> <input type="text" name="textfield7" /> </p> <p align="center"><span class="style3">REMARKS: </span> <input type="text" name="textfield8" /> </p> <p align="center">&nbsp;</p> <p align="center"> <input type="submit" name="SAVE" value="SAVE" /> <input type="submit" name="Submit2" value="LIST" /> <input type="submit" name="Submit" value="ADD" /> <input type="submit" name="Submit3" value="CANCEL" /> <input type="submit" name="BACK" value="BACK" /></p> <p align="center">&nbsp;</p> <p align="center">&nbsp;</p> <p align="center">&nbsp;</p> <p align="center">&nbsp;</p> <p align="center">&nbsp;</p> </form> <p align="center" class="style2">&nbsp;</p>

    Read the article

  • Twitter Bootstrap Collapsible Navbar Duplicating

    - by sixeightzero
    I am working on a project using Twitter Bootstrap. One thing that I noticed is that my pages have duplicate navbars when they are defined as collapsible and the page is resized smaller. Here is the duplicate NavBar: Here is the normal width NavBar: Code: <!DOCTYPE html> <html lang="en"> <!--[if lt IE 7]> <html class="no-js lt-ie9 lt-ie8 lt-ie7"> <![endif]--> <!--[if IE 7]> <html class="no-js lt-ie9 lt-ie8"> <![endif]--> <!--[if IE 8]> <html class="no-js lt-ie9"> <![endif]--> <!--[if gt IE 8]><!--> <html class="no-js"> <!--<![endif]--> <head> <meta charset="utf-8"> <meta http-equiv="X-UA-Compatible" content="IE=edge,chrome=1"> <title></title> <meta name="description" content=""> <meta name="viewport" content="width=device-width"> <link rel="stylesheet" href="/assets/css/bootstrap.css"> <style> body { padding-top: 60px; } </style> <link rel="stylesheet" href="/assets/css/bootstrap-responsive.min.css"> <link rel="stylesheet" href="/assets/css/main.css"> <script>window.jQuery || document.write('<script src="/assets/js/vendor/jquery-1.8.1.min.js"><\/script>')</script> <script src="/assets/js/vendor/modernizr-2.6.1-respond-1.1.0.min.js"></script> </head> <body class="dark"> <!--[if lt IE 9]> <p class="chromeframe">You are using an outdated browser. <a href="http://browsehappy.com/">Upgrade your browser today</a> or <a href="http://www.google.com/chromeframe/?redirect=true">install Google Chrome Frame</a> to better experience this site.</p> <![endif]--> <div class="navbar navbar-inverse navbar-fixed-top"> <div class="navbar-inner"> <div class="container"> <a class="btn btn-navbar" data-toggle="collapse" data-target=".nav-collapse"> <span class="icon-bar"></span> <span class="icon-bar"></span> <span class="icon-bar"></span> </a> <a class="brand" href="#">Project name</a> <div class="nav-collapse collapse"> <ul class="nav"> <li class="active"><a href="#">Home</a></li> <li><a href="#about">About</a></li> <li><a href="#contact">Contact</a></li> <li class="dropdown"> <a href="#" class="dropdown-toggle" data-toggle="dropdown">Dropdown <b class="caret"></b></a> <ul class="dropdown-menu"> <li><a href="#">Action</a></li> <li><a href="#">Another action</a></li> <li><a href="#">Something else here</a></li> <li class="divider"></li> <li class="nav-header">Nav header</li> <li><a href="#">Separated link</a></li> <li><a href="#">One more separated link</a></li> </ul> </li> </ul> </div><!--/.nav-collapse --> </div> </div> </div> Has anyone else run into this and have some pointers?

    Read the article

  • (C++) Linking with namespaces causes duplicate symbol error

    - by user577072
    Hello. For the past few days, I have been trying to figure out how to link the files for a CLI gaming project I have been working on. There are two halves of the project, the Client and the Server code. The client needs two libraries I've made. The first is a general purpose game board. This is split between GameEngine.h and GameEngine.cpp. The header file looks something like this namespace gfdGaming { // struct sqr_size { // Index x; // Index y; // }; typedef struct { Index x, y; } sqr_size; const sqr_size sPos = {1, 1}; sqr_size sqr(Index x, Index y); sqr_size ePos; class board { // Prototypes / declarations for the class } } And the CPP file is just giving everything content #include "GameEngine.h" type gfdGaming::board::functions The client also has game-specific code (in this case, TicTacToe) split into declarations and definitions (TTT.h, Client.cpp). TTT.h is basically #include "GameEngine.h" #define TTTtar "localhost" #define TTTport 2886 using namespace gfdGaming; void* turnHandler(void*); namespace nsTicTacToe { GFDCON gfd; const char X = 'X'; const char O = 'O'; string MPhostname, mySID; board TTTboard; bool PlayerIsX = true, isMyTurn; char Player = X, Player2 = O; int recon(string* datHolder = NULL, bool force = false); void initMP(bool create = false, string hn = TTTtar); void init(); bool isTie(); int turnPlayer(Index loc, char lSym = Player); bool checkWin(char sym = Player); int mainloop(); int mainloopMP(); }; // NS I made the decision to put this in a namespace to group it instead of a class because there are some parts that would not work well in OOP, and it's much easier to implement later on. I have had trouble linking the client in the past, but this setup seems to work. My server is also split into two files, Server.h and Server.cpp. Server.h contains exactly: #include "../TicTacToe/TTT.h" // Server needs a full copy of TicTacToe code class TTTserv; struct TTTachievement_requirement { Index id; Index loc; bool inUse; }; struct TTTachievement_t { Index id; bool achieved; bool AND, inSameGame; bool inUse; bool (*lHandler)(TTTserv*); char mustBeSym; int mustBePlayer; string name, description; TTTachievement_requirement steps[safearray(8*8)]; }; class achievement_core_t : public GfdOogleTech { public: // May be shifted to private TTTachievement_t list[safearray(8*8)]; public: achievement_core_t(); int insert(string name, string d, bool samegame, bool lAnd, int lSteps[8*8], int mbP=0, char mbS=0); }; struct TTTplayer_t { Index id; bool inUse; string ip, sessionID; char sym; int desc; TTTachievement_t Ding[8*8]; }; struct TTTgame_t { TTTplayer_t Player[safearray(2)]; TTTplayer_t Spectator; achievement_core_t achievement_core; Index cTurn, players; port_t roomLoc; bool inGame, Xused, Oused, newEvent; }; class TTTserv : public gSserver { TTTgame_t Game; TTTplayer_t *cPlayer; port_t conPort; public: achievement_core_t *achiev; thread threads[8]; int parseit(string tDat, string tsIP); Index conCount; int parseit(string tDat, int tlUser, TTTplayer_t** retval); private: int parseProto(string dat, string sIP); int parseProto(string dat, int lUser); int cycleTurn(); void setup(port_t lPort = 0, bool complete = false); public: int newEvent; TTTserv(port_t tlPort = TTTport, bool tcomplete = true); TTTplayer_t* userDC(Index id, Index force = false); int sendToPlayers(string dat, bool asMSG = false); int mainLoop(volatile bool *play); }; // Other void* userHandler(void*); void* handleUser(void*); And in the CPP file I include Server.h and provide main() and the contents of all functions previously declared. Now to the problem at hand I am having issues when linking my server. More specifically, I get a duplicate symbol error for every variable in nsTicTacToe (and possibly in gfdGaming as well). Since I need the TicTacToe functions, I link Client.cpp ( without main() ) when building the server ld: duplicate symbol nsTicTacToe::PlayerIsX in Client.o and Server.o collect2: ld returned 1 exit status Command /Developer/usr/bin/g++-4.2 failed with exit code 1 It stops once a problem is encountered, but if PlayerIsX is removed / changed temporarily than another variable causes an error Essentially, I am looking for any advice on how to better organize my code to hopefully fix these errors. Disclaimers: -I apologize in advance if I provided too much or too little information, as it is my first time posting -I have tried using static and extern to fix these problems, but apparently those are not what I need Thank you to anyone who takes the time to read all of this and respond =)

    Read the article

  • $_GET loading content before head tag instead of in specified div.

    - by s32ialx
    NOT EDITING BELOW BUT THANKS TO SOME REALLY NICE PEOPLE I CAN'T POST AN IMAGE ANYMORE BECAUSE I HAD a 15 Rep but NOW ONLY A 5 becuase my question wasn't what they wanted help with they gave me a neg rep. The problem is that the content loads it displays UNDER the div i placed #CONTENT# inside so the styles are being ignored and it's posting #CONTENT# outside the divs at positions 0,0 any suggestions? Found out whats happening by using "View Source" seems that it's putting all of the #CONTENT#, content that's being loaded in front of the <head> tag. Like this <doctype...> <div class="home"> \ blah blah #CONTENT# bot being loaded in correct specified area </div> / <head> <script src=""></script> </head> <body> <div class="header"></div> <div class="contents"> #CONTENT# < where content SHOULD load </div> <div class="footer"></div> </body> so anyone got a fix? OK so a better description I'll add relevant screen-shots Whats happening is /* file.class.php */ <?php $file = new file(); class file{ var $path = "templates/clean"; var $ext = "tpl"; function loadfile($filename){ return file_get_contents($this->path . "/" . $filename . "." . $this->ext); } function setcontent($content,$newcontent,$vartoreplace='#CONTENT#'){ $val = str_replace($vartoreplace,$newcontent,$content); return $val; } function p($content) { $v = $content; $v = str_replace('#CONTENT#','',$v); print $v; } } if(!isset($_GET['page'])){ // if not, lets load our index page(you can change home.php to whatever you want: include("main.txt"); // else $_GET['page'] was set so lets do stuff: } else { // lets first check if the file exists: if(file_exists($_GET['page'].'.txt')){ // and lets include that then: include($_GET['page'].'.txt'); // sorry mate, could not find it: } else { echo 'Sorry, could not find <strong>' . $_GET['page'] .'.txt</strong>'; } } ?> is calling for a file_get_contents at the bottom which I use in /* index.php */ <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xml:lang="en" lang="en"> <?php include('classes/file.class.php'); // load the templates $header = $file->loadfile('header'); $body = $file->loadfile('body'); $footer = $file->loadfile('footer'); // fill body.tpl #CONTENT# slot with $content $body = $file->setcontent($body, $content); // cleanup and output the full page $file->p($header . $body . $footer); ?> and loads into /* body.tpl */ <div id="bodys"> <div id="bodt"></div> <div id="bodm"> <div id="contents"> #CONTENT# </div> </div> <div id="bodb"></div> </div> but the issue is as follows the $content loads properly img tags etc <h2> tags etc but CSS styling is TOTALY ignored for position width z-index etc. and as follows here's the screen-shot My Firefox Showing The Problem In Action REPOSTED DUE TO PEOPLE NOT HELPING AND JUST BEING ARROGANT AND GIVING NEGATIVE VOTES and not even saying a word. DO NOT COMMENT UNLESS YOU PLAN TO HELP god I'm a beginner and with you people giving me bad reviews this won't make me help you out when the chance comes.

    Read the article

  • Help needed on an SQL configuration problem.

    - by user321048
    I have been banging my head with this one more the two weeks, and still don't know what the problem is ( I can't narrow it down). The problem is the following. I have a solution with 3 project in it all written in c# and I with LINQ. One project is the main web site, the other is the data layer (communication with the database) and the third one is a custom little CMS. The problem is the following: On a hosting provider when I publish the site it all works perfectly, but this site was needed to be hosted on the client server so I needed to do that. But the problem is that I also needed to configure the client server, because they don't have an Administrator employed (I know, I know ;) ). For the first time I some how managed, to set it up but a problem appear. My main web site is working just as it suppose to be - it reads (communicates with) the database, but My CMS is not. It shows the first log in page, but after that when I try to log in it throws the following error: A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: TCP Provider, error: 0 - A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond.) Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.Data.SqlClient.SqlException: A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: TCP Provider, error: 0 - A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond.) Source Error: An unhandled exception was generated during the execution of the current web request. Information regarding the origin and location of the exception can be identified using the exception stack trace below. Stack Trace: [SqlException (0x80131904): A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: TCP Provider, error: 0 - A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond.)] System.Data.SqlClient.SqlInternalConnection.OnError(SqlException exception, Boolean breakConnection) +4846887 System.Data.SqlClient.TdsParser.ThrowExceptionAndWarning(TdsParserStateObject stateObj) +194 System.Data.SqlClient.TdsParser.Connect(ServerInfo serverInfo, SqlInternalConnectionTds connHandler, Boolean ignoreSniOpenTimeout, Int64 timerExpire, Boolean encrypt, Boolean trustServerCert, Boolean integratedSecurity, SqlConnection owningObject) +4860189 System.Data.SqlClient.SqlInternalConnectionTds.AttemptOneLogin(ServerInfo serverInfo, String newPassword, Boolean ignoreSniOpenTimeout, Int64 timerExpire, SqlConnection owningObject) +90 System.Data.SqlClient.SqlInternalConnectionTds.LoginNoFailover(String host, String newPassword, Boolean redirectedUserInstance, SqlConnection owningObject, SqlConnectionString connectionOptions, Int64 timerStart) +342 System.Data.SqlClient.SqlInternalConnectionTds.OpenLoginEnlist(SqlConnection owningObject, SqlConnectionString connectionOptions, String newPassword, Boolean redirectedUserInstance) +221 System.Data.SqlClient.SqlInternalConnectionTds..ctor(DbConnectionPoolIdentity identity, SqlConnectionString connectionOptions, Object providerInfo, String newPassword, SqlConnection owningObject, Boolean redirectedUserInstance) +189 System.Data.SqlClient.SqlConnectionFactory.CreateConnection(DbConnectionOptions options, Object poolGroupProviderInfo, DbConnectionPool pool, DbConnection owningConnection) +185 System.Data.ProviderBase.DbConnectionFactory.CreatePooledConnection(DbConnection owningConnection, DbConnectionPool pool, DbConnectionOptions options) +31 System.Data.ProviderBase.DbConnectionPool.CreateObject(DbConnection owningObject) +433 System.Data.ProviderBase.DbConnectionPool.UserCreateRequest(DbConnection owningObject) +66 System.Data.ProviderBase.DbConnectionPool.GetConnection(DbConnection owningObject) +499 System.Data.ProviderBase.DbConnectionFactory.GetConnection(DbConnection owningConnection) +65 System.Data.ProviderBase.DbConnectionClosed.OpenConnection(DbConnection outerConnection, DbConnectionFactory connectionFactory) +117 System.Data.SqlClient.SqlConnection.Open() +122 System.Data.Linq.SqlClient.SqlConnectionManager.UseConnection(IConnectionUser user) +44 System.Data.Linq.SqlClient.SqlProvider.get_IsSqlCe() +45 System.Data.Linq.SqlClient.SqlProvider.InitializeProviderMode() +20 System.Data.Linq.SqlClient.SqlProvider.System.Data.Linq.Provider.IProvider.Execute(Expression query) +57 System.Data.Linq.DataQuery`1.System.Linq.IQueryProvider.Execute(Expression expression) +23 System.Linq.Queryable.Count(IQueryable`1 source) +240 CMS.Security.UserProfile.LoginUser() in C:\Documents and Settings\Dimitar\Desktop\New Mepso Final 08_04\CMS\Classes\UserProfile.cs:132 CMS.Default.Login1_Authenticate(Object sender, AuthenticateEventArgs e) in C:\Documents and Settings\Dimitar\Desktop\New Mepso Final 08_04\CMS\Default.aspx.cs:37 System.Web.UI.WebControls.Login.OnAuthenticate(AuthenticateEventArgs e) +108 System.Web.UI.WebControls.Login.AttemptLogin() +115 System.Web.UI.WebControls.Login.OnBubbleEvent(Object source, EventArgs e) +101 System.Web.UI.Control.RaiseBubbleEvent(Object source, EventArgs args) +37 System.Web.UI.WebControls.Button.OnCommand(CommandEventArgs e) +118 System.Web.UI.WebControls.Button.RaisePostBackEvent(String eventArgument) +166 System.Web.UI.WebControls.Button.System.Web.UI.IPostBackEventHandler.RaisePostBackEvent(String eventArgument) +10 System.Web.UI.Page.RaisePostBackEvent(IPostBackEventHandler sourceControl, String eventArgument) +13 System.Web.UI.Page.RaisePostBackEvent(NameValueCollection postData) +36 System.Web.UI.Page.ProcessRequestMain(Boolean includeStagesBeforeAsyncPoint, Boolean includeStagesAfterAsyncPoint) +1565 Maybe this is a dumb question, but I cannot find the root of the problem, let alone the solution. So far I have tried the following: -setting time out on connection string to a higher value -configuration and after that turning off server firewall -checking the connection string over and over again (they are the same for all three projects and are saved in web.config) Important notes: I have tried executing the project from VS2008 with a connection string to the same database and the results are the same. That's why I think the problem is the SQL Server 2005 and not the IIS7. Any bit of information is more then welcomed.

    Read the article

  • Service injection into Controller (Spring MVC)

    - by ThaSaleni
    Hi I have a Spring web application, I have built it up to the controller stage and I could inject my Daos, into my Services fine. Now when I want to inject my Service into my controller i get an error for dependency with the Dao and further down the sessionFactory. I don't want to inject these again cause this will ultimately lead me to eventually create a data source but I have my Daos for data access and they already know about sessionFactory. Am I missing something here? here's the sample code snippets My Service: @Service("productService") @Transactional public class ProductServiceImpl implements ProductService { private ProductDao productDao; @Autowired public void setDao(ProductDao productDao) { this.productDao = productDao; } My Controller @Controller @WebServlet(name="controllerServlet", loadOnStartup= urlPatterns=...}) public class ControllerServlet extends HttpServlet { boolean isUserLogedIn =false; @Autowired private ProductService productService; public void setProductService(ProductService productService){ this.productService = productService; } Servlet-context Stack trace javax.servlet.ServletException: Servlet.init() for servlet mvcServlet threw exception org.apache.catalina.authenticator.AuthenticatorBase.invoke(AuthenticatorBase.java:472) org.apache.catalina.valves.ErrorReportValve.invoke(ErrorReportValve.java:98) org.apache.catalina.valves.AccessLogValve.invoke(AccessLogValve.java:927) org.apache.catalina.connector.CoyoteAdapter.service(CoyoteAdapter.java:407) org.apache.coyote.http11.AbstractHttp11Processor.process(AbstractHttp11Processor.java:999) org.apache.coyote.AbstractProtocol$AbstractConnectionHandler.process(AbstractProtocol.java: 565) org.apache.tomcat.util.net.AprEndpoint$SocketProcessor.run(AprEndpoint.java:1812) java.util.concurrent.ThreadPoolExecutor$Worker.runTask(ThreadPoolExecutor.java:886) java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:908) java.lang.Thread.run(Thread.java:662) root cause org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'controllerServlet': Injection of autowired dependencies failed; nested exception is org.springframework.beans.factory.BeanCreationException: Could not autowire field: private com.phumzile.acme.services.ProductService com.phumzile.acme.client.web.controller.ControllerServlet.productService; nested exception is org.springframework.beans.factory.NoSuchBeanDefinitionException: No matching bean of type [com.phumzile.acme.services.ProductService] found for dependency: expected at least 1 bean which qualifies as autowire candidate for this dependency. Dependency annotations: {@org.springframework.beans.factory.annotation.Autowired(required=true)} org.springframework.beans.factory.annotation.AutowiredAnnotationBeanPostProcessor.p ostProcessPropertyValues(AutowiredAnnotationBeanPostProcessor.java:287) org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.populateBean(AbstractAutowireCapableBeanFactory.java:1106) org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:517) org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBean(AbstractAutowireCapableBeanFactory.java:456) org.springframework.beans.factory.support.AbstractBeanFactory$1.getObject(AbstractBeanFactory.java:294) org.springframework.beans.factory.support.DefaultSingletonBeanRegistry.getSingleton(DefaultSingletonBeanRegistry.java:225) SERVLET-CONTEXT <context:component-scan base-package="com.phumzile.acme.client" /> <!-- Enables the Spring MVC @Controller programming model --> <mvc:annotation-driven /> </beans> APP-CONFIG <bean id="propertyConfigurer" class="org.springframework.beans.factory.config.PropertyPlaceholderConfigurer"> <property name="locations"> <list> <value>configuration.properties</value> </list> </property> </bean> <context:annotation-config/> <context:component-scan base-package="com.phumzile.acme" /> <import resource="db-config.xml" /> </beans> DB-CONFIG <bean id="dataSource" class="com.mchange.v2.c3p0.ComboPooledDataSource" destroy-method="close"> <property name="idleConnectionTestPeriod" value="10800"/> <property name="maxIdleTime" value="21600"/> <property name="driverClass"> <value>${jdbc.driver.className}</value> </property> <property name="jdbcUrl"> <value>${jdbc.url}</value> </property> <property name="user"> <value>${jdbc.username}</value> </property> <property name="password"> <value>${jdbc.password}</value> </property> </bean> <bean id="sessionFactory" class="org.springframework.orm.hibernate3.a nnotation.AnnotationSessionFactoryBean"> <property name="dataSource"> <ref bean="dataSource" /> </property> <property name="annotatedClasses"> <list> <!-- Entities --> <value>com.phumzile.acme.model.User</value> <value>com.phumzile.acme.model.Person</value> <value>com.phumzile.acme.model.Company</value> <value>com.phumzile.acme.model.Product</value> <value>com.phumzile.acme.model.Game</value> <value>com.phumzile.acme.model.Book</value> <!-- Entities --> </list> </property> <property name="packagesToScan" value="com.phumzile.acme" /> <property name="hibernateProperties"> <props> <prop key="hibernate.dialect">${jdbc.hibernate.dialect </prop> <prop key="hibernate.hbm2ddl.auto">validate</prop> <prop key="hibernate.show_sql">true</prop> </props> </property> </bean> <bean id="transactionManager" class="org.springframework.orm.hibernate3.HibernateTransactionManager"> <property name="sessionFactory"> <ref bean="sessionFactory" /> </property> </bean> <tx:annotation-driven /> </beans> CONFIGURATION.PROPERTIES jdbc.driver.className=com.mysql.jdbc.Driver jdbc.url=jdbc:mysql://localhost:3306/mydb jdbc.username=root jdbc.password=root jdbc.hibernate.dialect=org.hibernate.dialect.MySQLDialect

    Read the article

  • WPF Some styles not applied on DataTemplate controls

    - by Martin
    Hi, I am trying to learn something about WPF and I am quite amazed by its flexibility. However, I have hit a problem with Styles and DataTemplates, which is little bit confusing. I have defined below test page to play around a bit with styles etc and found that the Styles defined in <Page.Resources> for Border and TextBlock are not applied in the DataTemplate, but Style for ProgressBar defined in exactly the same way is applied. Source code (I just use Kaxaml and XamlPadX to view the result) <Page xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml"> <Page.Resources> <Style TargetType="{x:Type Border}"> <Setter Property="Background" Value="SkyBlue"/> <Setter Property="BorderBrush" Value="Black"/> <Setter Property="BorderThickness" Value="2"/> <Setter Property="CornerRadius" Value="5"/> </Style> <Style TargetType="{x:Type TextBlock}"> <Setter Property="FontWeight" Value="Bold"/> </Style> <Style TargetType="{x:Type ProgressBar}"> <Setter Property="Height" Value="10"/> <Setter Property="Width" Value="100"/> <Setter Property="Foreground" Value="Red"/> </Style> <XmlDataProvider x:Key="TestData" XPath="/TestData"> <x:XData> <TestData xmlns=""> <TestElement> <Name>Item 1</Name> <Value>25</Value> </TestElement> <TestElement> <Name>Item 2</Name> <Value>50</Value> </TestElement> </TestData> </x:XData> </XmlDataProvider> <HierarchicalDataTemplate DataType="TestElement"> <Border Height="45" Width="120" Margin="5,5"> <StackPanel Orientation="Vertical" Margin="5,5" VerticalAlignment="Center" HorizontalAlignment="Center"> <TextBlock HorizontalAlignment="Center" Text="{Binding XPath=Name}"/> <ProgressBar Value="{Binding XPath=Value}"/> </StackPanel> </Border> </HierarchicalDataTemplate> </Page.Resources> <StackPanel Orientation="Horizontal" HorizontalAlignment="Center" VerticalAlignment="Center"> <StackPanel Orientation="Vertical" VerticalAlignment="Center"> <Border Height="45" Width="120" Margin="5,5"> <StackPanel Orientation="Vertical" VerticalAlignment="Center" HorizontalAlignment="Center"> <TextBlock HorizontalAlignment="Center" Text="Item 1"/> <ProgressBar Value="25"/> </StackPanel> </Border> <Border Height="45" Width="120" Margin="5,5"> <StackPanel Orientation="Vertical" VerticalAlignment="Center" HorizontalAlignment="Center"> <TextBlock HorizontalAlignment="Center" Text="Item 2"/> <ProgressBar Value="50"/> </StackPanel> </Border> </StackPanel> <ListBox Margin="10,10" Width="140" ItemsSource="{Binding Source={StaticResource TestData}, XPath=TestElement}"/> </StackPanel> </Page> I suspect it has something to do with default styles etc, but more puzzling is why some Styles are applied and some not. I cannot find an easy explanation for above anywhere and thus would like to ask if someone would be kind enough to explain this behaviour in lamens' terms with possible links to technical description, i.e. to MSDN or so. Thanks in advance for you support!

    Read the article

  • How to programatically read native DLL imports in C#?

    - by Eric
    The large hunk of C# code below is intended to print the imports of a native DLL. I copied it from from this link and modified it very slightly, just to use LoadLibraryEx as Mike Woodring does here. I find that when I call the Foo.Test method with the original example's target, MSCOREE.DLL, it prints all the imports fine. But when I use other dlls like GDI32.DLL or WSOCK32.DLL the imports do not get printed. What's missing from this code that would let it print all the imports as, for example, DUMPBIN.EXE does? (Is there a hint I'm not grokking in the original comment that says, "using mscoree.dll as an example as it doesnt export any thing"?) Here's the extract that just shows how it's being invoked: public static void Test() { // WORKS: var path = @"c:\windows\system32\mscoree.dll"; // NO ERRORS, BUT NO IMPORTS PRINTED EITHER: //var path = @"c:\windows\system32\gdi32.dll"; //var path = @"c:\windows\system32\wsock32.dll"; var hLib = LoadLibraryEx(path, 0, DONT_RESOLVE_DLL_REFERENCES | LOAD_IGNORE_CODE_AUTHZ_LEVEL); TestImports(hLib, true); } And here is the whole code example: namespace PETest2 { [StructLayout(LayoutKind.Explicit)] public unsafe struct IMAGE_IMPORT_BY_NAME { [FieldOffset(0)] public ushort Hint; [FieldOffset(2)] public fixed char Name[1]; } [StructLayout(LayoutKind.Explicit)] public struct IMAGE_IMPORT_DESCRIPTOR { #region union /// <summary> /// CSharp doesnt really support unions, but they can be emulated by a field offset 0 /// </summary> [FieldOffset(0)] public uint Characteristics; // 0 for terminating null import descriptor [FieldOffset(0)] public uint OriginalFirstThunk; // RVA to original unbound IAT (PIMAGE_THUNK_DATA) #endregion [FieldOffset(4)] public uint TimeDateStamp; [FieldOffset(8)] public uint ForwarderChain; [FieldOffset(12)] public uint Name; [FieldOffset(16)] public uint FirstThunk; } [StructLayout(LayoutKind.Explicit)] public struct THUNK_DATA { [FieldOffset(0)] public uint ForwarderString; // PBYTE [FieldOffset(4)] public uint Function; // PDWORD [FieldOffset(8)] public uint Ordinal; [FieldOffset(12)] public uint AddressOfData; // PIMAGE_IMPORT_BY_NAME } public unsafe class Interop { #region Public Constants public static readonly ushort IMAGE_DIRECTORY_ENTRY_IMPORT = 1; #endregion #region Private Constants #region CallingConvention CALLING_CONVENTION /// <summary> /// Specifies the calling convention. /// </summary> /// <remarks> /// Specifies <see cref="CallingConvention.Winapi" /> for Windows to /// indicate that the default should be used. /// </remarks> private const CallingConvention CALLING_CONVENTION = CallingConvention.Winapi; #endregion CallingConvention CALLING_CONVENTION #region IMPORT DLL FUNCTIONS private const string KERNEL_DLL = "kernel32"; private const string DBGHELP_DLL = "Dbghelp"; #endregion #endregion Private Constants [DllImport(KERNEL_DLL, CallingConvention = CALLING_CONVENTION, EntryPoint = "GetModuleHandleA"), SuppressUnmanagedCodeSecurity] public static extern void* GetModuleHandleA(/*IN*/ char* lpModuleName); [DllImport(KERNEL_DLL, CallingConvention = CALLING_CONVENTION, EntryPoint = "GetModuleHandleW"), SuppressUnmanagedCodeSecurity] public static extern void* GetModuleHandleW(/*IN*/ char* lpModuleName); [DllImport(KERNEL_DLL, CallingConvention = CALLING_CONVENTION, EntryPoint = "IsBadReadPtr"), SuppressUnmanagedCodeSecurity] public static extern bool IsBadReadPtr(void* lpBase, uint ucb); [DllImport(DBGHELP_DLL, CallingConvention = CALLING_CONVENTION, EntryPoint = "ImageDirectoryEntryToData"), SuppressUnmanagedCodeSecurity] public static extern void* ImageDirectoryEntryToData(void* Base, bool MappedAsImage, ushort DirectoryEntry, out uint Size); } static class Foo { // From winbase.h in the Win32 platform SDK. // const uint DONT_RESOLVE_DLL_REFERENCES = 0x00000001; const uint LOAD_IGNORE_CODE_AUTHZ_LEVEL = 0x00000010; [DllImport("kernel32.dll"), SuppressUnmanagedCodeSecurity] static extern uint LoadLibraryEx(string fileName, uint notUsedMustBeZero, uint flags); public static void Test() { //var path = @"c:\windows\system32\mscoree.dll"; //var path = @"c:\windows\system32\gdi32.dll"; var path = @"c:\windows\system32\wsock32.dll"; var hLib = LoadLibraryEx(path, 0, DONT_RESOLVE_DLL_REFERENCES | LOAD_IGNORE_CODE_AUTHZ_LEVEL); TestImports(hLib, true); } // using mscoree.dll as an example as it doesnt export any thing // so nothing shows up if you use your own module. // and the only none delayload in mscoree.dll is the Kernel32.dll private static void TestImports( uint hLib, bool mappedAsImage ) { unsafe { //fixed (char* pszModule = "mscoree.dll") { //void* hMod = Interop.GetModuleHandleW(pszModule); void* hMod = (void*)hLib; uint size = 0; uint BaseAddress = (uint)hMod; if (hMod != null) { Console.WriteLine("Got handle"); IMAGE_IMPORT_DESCRIPTOR* pIID = (IMAGE_IMPORT_DESCRIPTOR*)Interop.ImageDirectoryEntryToData((void*)hMod, mappedAsImage, Interop.IMAGE_DIRECTORY_ENTRY_IMPORT, out size); if (pIID != null) { Console.WriteLine("Got Image Import Descriptor"); while (!Interop.IsBadReadPtr((void*)pIID->OriginalFirstThunk, (uint)size)) { try { char* szName = (char*)(BaseAddress + pIID->Name); string name = Marshal.PtrToStringAnsi((IntPtr)szName); Console.WriteLine("pIID->Name = {0} BaseAddress - {1}", name, (uint)BaseAddress); THUNK_DATA* pThunkOrg = (THUNK_DATA*)(BaseAddress + pIID->OriginalFirstThunk); while (!Interop.IsBadReadPtr((void*)pThunkOrg->AddressOfData, 4U)) { char* szImportName; uint Ord; if ((pThunkOrg->Ordinal & 0x80000000) > 0) { Ord = pThunkOrg->Ordinal & 0xffff; Console.WriteLine("imports ({0}).Ordinal{1} - Address: {2}", name, Ord, pThunkOrg->Function); } else { IMAGE_IMPORT_BY_NAME* pIBN = (IMAGE_IMPORT_BY_NAME*)(BaseAddress + pThunkOrg->AddressOfData); if (!Interop.IsBadReadPtr((void*)pIBN, (uint)sizeof(IMAGE_IMPORT_BY_NAME))) { Ord = pIBN->Hint; szImportName = (char*)pIBN->Name; string sImportName = Marshal.PtrToStringAnsi((IntPtr)szImportName); // yes i know i am a lazy ass Console.WriteLine("imports ({0}).{1}@{2} - Address: {3}", name, sImportName, Ord, pThunkOrg->Function); } else { Console.WriteLine("Bad ReadPtr Detected or EOF on Imports"); break; } } pThunkOrg++; } } catch (AccessViolationException e) { Console.WriteLine("An Access violation occured\n" + "this seems to suggest the end of the imports section\n"); Console.WriteLine(e); } pIID++; } } } } } Console.WriteLine("Press Any Key To Continue......"); Console.ReadKey(); } }

    Read the article

  • System.Timers.Timer leaking due to "direct delegate roots"

    - by alimbada
    Apologies for the rather verbose and long-winded post, but this problem's been perplexing me for a few weeks now so I'm posting as much information as I can in order to get this resolved quickly. We have a WPF UserControl which is being loaded by a 3rd party app. The 3rd party app is a presentation application which loads and unloads controls on a schedule defined by an XML file which is downloaded from a server. Our control, when it is loaded into the application makes a web request to a web service and uses the data from the response to display some information. We're using an MVVM architecture for the control. The entry point of the control is a method that is implementing an interface exposed by the main app and this is where the control's configuration is set up. This is also where I set the DataContext of our control to our MainViewModel. The MainViewModel has two other view models as properties and the main UserControl has two child controls. Depending on the data received from the web service, the main UserControl decides which child control to display, e.g. if there is a HTTP error or the data received is not valid, then display child control A, otherwise display child control B. As you'd expect, these two child controls bind two separate view models each of which is a property of MainViewModel. Now child control B (which is displayed when the data is valid) has a RefreshService property/field. RefreshService is an object that is responsible for updating the model in a number of ways and contains 4 System.Timers.Timers; a _modelRefreshTimer a _viewRefreshTimer a _pageSwitchTimer a _retryFeedRetrievalOnErrorTimer (this is only enabled when something goes wrong with retrieving data). I should mention at this point that there are two types of data; the first changes every minute, the second changes every few hours. The controls' configuration decides which type we are using/displaying. If data is of the first type then we update the model quite frequently (every 30 seconds) using the _modelRefreshTimer's events. If the data is of the second type then we update the model after a longer interval. However, the view still needs to be refreshed every 30 seconds as stale data needs to be removed from the view (hence the _viewRefreshTimer). The control also paginates the data so we can see more than we can fit on the display area. This works by breaking the data up into Lists and switching the CurrentPage (which is a List) property of the view model to the right List. This is done by handling the _pageSwitchTimer's Elapsed event. Now the problem My problem is that the control, when removed from the visual tree doesn't dispose of it's timers. This was first noticed when we started getting an unusually high number of requests on the web server end very soon after deploying this control and found that requests were being made at least once a second! We found that the timers were living on and not stopping hours after the control had been removed from view and that the more timers there were the more requests piled up at the web server. My first solution was to implement IDisposable for the RefreshService and do some clean up when the control's UnLoaded event was fired. Within the RefreshServices Dispose method I've set Enabled to false for all the timers, then used the Stop() method on all of them. I've then called Dispose() too and set them to null. None of this worked. After some reading around I found that event handlers may hold references to Timers and prevent them from being disposed and collected. After some more reading and researching I found that the best way around this was to use the Weak Event Pattern. Using this blog and this blog I've managed to work around the shortcomings in the Weak Event pattern. However, none of this solves the problem. Timers are still not being disabled or stopped (let alone disposed) and web requests are continuing to build up. Mem Profiler tells me that "This type has N instances that are directly rooted by a delegate. This can indicate the delegate has not been properly removed" (where N is the number of instances). As far as I can tell though, all listeners of the Elapsed event for the timers are being removed during the cleanup so I can't understand why the timers continue to run. Thanks for reading. Eagerly awaiting your suggestions/comments/solutions (if you got this far :-p)

    Read the article

  • Hiding Options of a Select with JQuery

    - by Syed Abdul Rahman
    Okay, let's start with an example. Keep in mind, this is only an example. <select id = "selection1">     <option value = "1" id = "1">Number 1</option>     <option value = "2" id = "2">Number 2</option>     <option value = "3" id = "3">Number 3</option> </select> Now from here, we have a dropdown with 3 options. What I want to do now is to hide an option. Adding style = "display:none" will not help. The option would not appear in the dropdownlist, but using the arrow keys, you can still select it. Essentially, it does exactly what the code says. It isn't displayed, and it stops there. A JQuery function of $("#1").hide() will not work. Plus, I don't only want to hide the option, I want to completely remove it. Any possibility on doing so? Do I have to use parent/sibling/child elements? If so, I'm still not sure how. Any help on this would be greatly appreciated. Thanks.           Another question - It's related Ok, so I found out that there is a .remove() available in JQuery. Works well. But what if I want to bring it back? if(condition)     {     $(this).remove();     } I can loops this. Shouldn't be complicated. But the thing of which I am trying to do is this: Maximum Capacity of Class: (Input field here) Select Room: (Dropdown here) What I'd like for it to do is to update is Dropdown using a function such as .change() or .keyup. I could create the dropdown only after something is typed. At a change or a keyup, execute the dropdown accordingly. But what I am doing is this: $roomarray = mysql_query("SELECT *     FROM         (         SELECT *,         CASE         WHEN type = 'Classroom' THEN 1         WHEN type = 'Computer laboratory' THEN 2         WHEN type = 'Lecture Hall' THEN 3         WHEN type = 'Auditorium' THEN 4         END AS ClassTypeValue         FROM rooms         ) t     ORDER BY ClassTypeValue, maxppl, roomID"); echo "<select id = \"room\">"; while ($rooms = mysql_fetch_array($roomarray)) { ?> <option value=<?php echo $rooms['roomID']; ?> id=<?php echo $rooms['roomID']; ?>><?php echo $rooms['type']; echo "&nbsp;"; echo $rooms['roomID']; echo "&nbsp;("; echo $rooms['maxppl']; echo ")"; ?></option> <?php } echo "</select>"; Yes, I know it is very messy. I plan to change it later on. But the issue now is this: Can I toggle the removal of the options according to what has been typed? Is it possible to do so with a dropdown made from a loop? Because I sure as hell can't keep executing SQL Queries. Or is that even an option? Because if it's possible, I still think it's a bad one.

    Read the article

  • Problem creating calculations 'engine' in two class java calculator

    - by tokee
    i have hit a brick wall whilst attempting to create a two class java calculator but have been unsuccessful so far in getting it working. i have the code for an interface which works and displays ok but creating a seperate class 'CalcEngine' to do the actual calculations has proven to be beyond me. I'd appreciate it if someone could kick start things for me and create a class calcEngine which works with the interface class and allows input when from single button i.e. if one is pressed on the calc then 1 displays onscreen. please note i'm not asking someone to do the whole thing for me as i want to learn and i'm confident i can do the rest including addition subtraction etc. once i get over the obstacle of getting the two classes to communicate. any and all assistance would be very much appreciated. Please see the calcInterface class code below - import java.awt.*; import javax.swing.*; import javax.swing.border.*; import java.awt.event.*; /** *A Class that operates as the framework for a calculator. *No calculations are performed in this section */ public class CalcFrame implements ActionListener { private CalcEngine calc; private JFrame frame; private JTextField display; private JLabel status; /** * Constructor for objects of class GridLayoutExample */ public CalcFrame() { makeFrame(); //calc = engine; } /** * This allows you to quit the calculator. */ // Alows the class to quit. private void quit() { System.exit(0); } // Calls the dialog frame with the information about the project. private void showAbout() { JOptionPane.showMessageDialog(frame, "Group Project", "About Calculator Group Project", JOptionPane.INFORMATION_MESSAGE); } private void makeFrame() { frame = new JFrame("Group Project Calculator"); makeMenuBar(frame); JPanel contentPane = (JPanel)frame.getContentPane(); contentPane.setLayout(new BorderLayout(8, 8)); contentPane.setBorder(new EmptyBorder( 10, 10, 10, 10)); /** * Insert a text field */ display = new JTextField(); contentPane.add(display, BorderLayout.NORTH); //Container contentPane = frame.getContentPane(); contentPane.setLayout(new GridLayout(4, 4)); JPanel buttonPanel = new JPanel(new GridLayout(4, 4)); contentPane.add(new JButton("1")); contentPane.add(new JButton("2")); contentPane.add(new JButton("3")); contentPane.add(new JButton("4")); contentPane.add(new JButton("5")); contentPane.add(new JButton("6")); contentPane.add(new JButton("7")); contentPane.add(new JButton("8")); contentPane.add(new JButton("9")); contentPane.add(new JButton("0")); contentPane.add(new JButton("+")); contentPane.add(new JButton("-")); contentPane.add(new JButton("/")); contentPane.add(new JButton("*")); contentPane.add(new JButton("=")); contentPane.add(new JButton("C")); contentPane.add(buttonPanel, BorderLayout.CENTER); //status = new JLabel(calc.getAuthor()); //contentPane.add(status, BorderLayout.SOUTH); frame.pack(); frame.setVisible(true); } /** * Create the main frame's menu bar. * The frame that the menu bar should be added to. */ private void makeMenuBar(JFrame frame) { final int SHORTCUT_MASK = Toolkit.getDefaultToolkit().getMenuShortcutKeyMask(); JMenuBar menubar = new JMenuBar(); frame.setJMenuBar(menubar); JMenu menu; JMenuItem item; // create the File menu menu = new JMenu("File"); menubar.add(menu); // create the Quit menu with a shortcut "Q" key. item = new JMenuItem("Quit"); item.setAccelerator(KeyStroke.getKeyStroke(KeyEvent.VK_Q, SHORTCUT_MASK)); item.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { quit(); } }); menu.add(item); // Adds an about menu. menu = new JMenu("About"); menubar.add(menu); // Displays item = new JMenuItem("Calculator Project"); item.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { showAbout(); } }); menu.add(item); } /** * An interface action has been performed. * Find out what it was and handle it. * @param event The event that has occured. */ public void actionPerformed(ActionEvent event) { String command = event.getActionCommand(); if(command.equals("0") || command.equals("1") || command.equals("2") || command.equals("3") || command.equals("4") || command.equals("5") || command.equals("6") || command.equals("7") || command.equals("8") || command.equals("9")) { int number = Integer.parseInt(command); calc.numberPressed(number); } else if(command.equals("+")) { calc.plus(); } else if(command.equals("-")) { calc.minus(); } else if(command.equals("=")) { calc.equals(); } else if(command.equals("C")) { calc.clear(); } else if(command.equals("?")) { } // else unknown command. redisplay(); } /** * Update the interface display to show the current value of the * calculator. */ private void redisplay() { display.setText("" + calc.getDisplayValue()); } /** * Toggle the info display in the calculator's status area between the * author and version information. */ }

    Read the article

  • CoreData: Same predicate (IN) returns different fetched results after a Save operation

    - by Jason Lee
    I have code below: NSArray *existedTasks = [[TaskBizDB sharedInstance] fetchTasksWatchedByMeOfProject:projectId]; [context save:&error]; existedTasks = [[TaskBizDB sharedInstance] fetchTasksWatchedByMeOfProject:projectId]; NSArray *allTasks = [[TaskBizDB sharedInstance] fetchTasksOfProject:projectId]; First line returns two objects; Second line save the context; Third line returns just one object, which is contained in the 'two objects' above; And the last line returns 6 objects, containing the 'two objects' returned at the first line. The fetch interface works like below: WXModel *model = [WXModel modelWithEntity:NSStringFromClass([WQPKTeamTask class])]; NSPredicate *predicate = [NSPredicate predicateWithFormat:@"(%@ IN personWatchers) AND (projectId == %d)", currentLoginUser, projectId]; [model setPredicate:predicate]; NSArray *fetchedTasks = [model fetch]; if (fetchedTasks.count == 0) return nil; return fetchedTasks; What confused me is that, with the same fetch request, why return different results just after a save? Here comes more detail: The 'two objects' returned at the first line are: <WQPKTeamTask: 0x1b92fcc0> (entity: WQPKTeamTask; id: 0x1b9300f0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p9> ; data: { projectId = 372004; taskId = 338001; personWatchers = ( "0xf0bf440 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WWPerson/p1>" ); } <WQPKTeamTask: 0xf3f6130> (entity: WQPKTeamTask; id: 0xf3cb8d0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p11> ; data: { projectId = 372004; taskId = 340006; personWatchers = ( "0xf0bf440 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WWPerson/p1>" ); } And the only one object returned at third line is: <WQPKTeamTask: 0x1b92fcc0> (entity: WQPKTeamTask; id: 0x1b9300f0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p9> ; data: { projectId = 372004; taskId = 338001; personWatchers = ( "0xf0bf440 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WWPerson/p1>" ); } Printing description of allTasks: <_PFArray 0xf30b9a0>( <WQPKTeamTask: 0xf3ab9d0> (entity: WQPKTeamTask; id: 0xf3cda40 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p6> ; data: <fault>), <WQPKTeamTask: 0xf315720> (entity: WQPKTeamTask; id: 0xf3c23a0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p7> ; data: <fault>), <WQPKTeamTask: 0xf3a1ed0> (entity: WQPKTeamTask; id: 0xf3cda30 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p8> ; data: <fault>), <WQPKTeamTask: 0x1b92fcc0> (entity: WQPKTeamTask; id: 0x1b9300f0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p9> ; data: { projectId = 372004; taskId = 338001; personWatchers = ( "0xf0bf440 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WWPerson/p1>" ); }), <WQPKTeamTask: 0xf325e50> (entity: WQPKTeamTask; id: 0xf343820 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p10> ; data: <fault>), <WQPKTeamTask: 0xf3f6130> (entity: WQPKTeamTask; id: 0xf3cb8d0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p11> ; data: { projectId = 372004; taskId = 340006; personWatchers = ( "0xf0bf440 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WWPerson/p1>" ); }) ) UPDATE 1 If I call the same interface fetchTasksWatchedByMeOfProject: in: #pragma mark - NSFetchedResultsController Delegate - (void)controllerDidChangeContent:(NSFetchedResultsController *)controller { I will get 'two objects' as well. UPDATE 2 I've tried: NSPredicate *predicate = [NSPredicate predicateWithFormat:@"(ANY personWatchers == %@) AND (projectId == %d)", currentLoginUser, projectId]; NSPredicate *predicate = [NSPredicate predicateWithFormat:@"(ANY personWatchers.personId == %@) AND (projectId == %d)", currentLoginUserId, projectId]; Still the same result. UPDATE 3 I've checked the save:&error, error is nil.

    Read the article

  • Core Plot: only works ok with three plots

    - by Luis
    I am adding a scatter plot to my app (iGear) so when the user selects one, two or three chainrings combined with a cogset on a bike, lines will show the gears meters. The problem is that Core Plot only shows the plots when three chainrings are selected. I need your help, this is my first try at Core Plot and I'm lost. My code is the following: iGearMainViewController.m - (IBAction)showScatterIpad:(id)sender { cogsetToPass = [NSMutableArray new]; arrayForChainringOne = [NSMutableArray new]; arrayForChainringTwo = [NSMutableArray new]; arrayForChainringThree = [NSMutableArray new]; //behavior according to number of chainrings switch (self.segmentedControl.selectedSegmentIndex) { case 0: // one chainring selected for (int i = 1; i<= [cassette.numCogs intValue]; i++) { if (i <10) { corona = [NSString stringWithFormat:@"cog0%d",i]; }else { corona = [NSString stringWithFormat:@"cog%d",i]; } float one = (wheelSize*[_oneChainring.text floatValue]/[[cassette valueForKey:corona]floatValue])/1000; float teeth = [[cassette valueForKey:corona] floatValue]; [cogsetToPass addObject:[NSNumber numberWithFloat:teeth]]; [arrayForChainringOne addObject:[NSNumber numberWithFloat:one]]; } break; case 1: // two chainrings selected for (int i = 1; i<= [cassette.numCogs intValue]; i++) { if (i <10) { corona = [NSString stringWithFormat:@"cog0%d",i]; }else { corona = [NSString stringWithFormat:@"cog%d",i]; } float one = (wheelSize*[_oneChainring.text floatValue]/[[cassette valueForKey:corona]floatValue])/1000; //NSLog(@" gearsForOneChainring = %@",[NSNumber numberWithFloat:one]); float two = (wheelSize*[_twoChainring.text floatValue]/[[cassette valueForKey:corona]floatValue])/1000; [cogsetToPass addObject:[NSNumber numberWithFloat:[[cassette valueForKey:corona]floatValue]]]; [arrayForChainringOne addObject:[NSNumber numberWithFloat:one]]; [arrayForChainringTwo addObject:[NSNumber numberWithFloat:two]]; } break; case 2: // three chainrings selected for (int i = 1; i<= [cassette.numCogs intValue]; i++) { if (i <10) { corona = [NSString stringWithFormat:@"cog0%d",i]; }else { corona = [NSString stringWithFormat:@"cog%d",i]; } float one = (wheelSize*[_oneChainring.text floatValue]/[[cassette valueForKey:corona]floatValue])/1000; float two = (wheelSize*[_twoChainring.text floatValue]/[[cassette valueForKey:corona]floatValue])/1000; float three = (wheelSize*[_threeChainring.text floatValue]/[[cassette valueForKey:corona]floatValue])/1000; [cogsetToPass addObject:[cassette valueForKey:corona]]; [arrayForChainringOne addObject:[NSNumber numberWithFloat:one]]; [arrayForChainringTwo addObject:[NSNumber numberWithFloat:two]]; [arrayForChainringThree addObject:[NSNumber numberWithFloat:three]]; } default: break; } ScatterIpadViewController *sivc = [[ScatterIpadViewController alloc]initWithNibName: @"ScatterIpadViewController" bundle:nil]; [sivc setModalTransitionStyle:UIModalTransitionStyleFlipHorizontal]; sivc.records = [cassetteNumCogs integerValue]; sivc.cogsetSelected = self.cogsetToPass; sivc.chainringOne = self.arrayForChainringOne; sivc.chainringThree = self.arrayForChainringThree; sivc.chainringTwo = self.arrayForChainringTwo; [self presentViewController:sivc animated:YES completion:nil]; } And the child view with the code to draw the plots: ScatterIpadViewController.m #pragma mark - CPTPlotDataSource methods - (NSUInteger)numberOfRecordsForPlot: (CPTPlot *)plot { return records; } - (NSNumber *)numberForPlot: (CPTPlot *)plot field:(NSUInteger)fieldEnum recordIndex:(NSUInteger)index{ switch (fieldEnum) { case CPTScatterPlotFieldX: return [NSNumber numberWithInt:index]; break; case CPTScatterPlotFieldY:{ if ([plot.identifier isEqual:@"one"]==YES) { //NSLog(@"chainringOne objectAtIndex:index = %@", [chainringOne objectAtIndex:index]); return [chainringOne objectAtIndex:index]; }else if ([plot.identifier isEqual:@"two"] == YES ){ //NSLog(@"chainringTwo objectAtIndex:index = %@", [chainringTwo objectAtIndex:index]); return [chainringTwo objectAtIndex:index]; }else if ([plot.identifier isEqual:@"three"] == YES){ //NSLog(@"chainringThree objectAtIndex:index = %@", [chainringThree objectAtIndex:index]); return [chainringThree objectAtIndex:index]; } default: break; } } return nil; } The error returned is an exception on trying to access an empty array. 2012-11-15 11:02:42.962 iGearScatter[3283:11603] Terminating app due to uncaught exception 'NSRangeException', reason: ' -[__NSArrayM objectAtIndex:]: index 0 beyond bounds for empty array' First throw call stack: (0x1989012 0x1696e7e 0x192b0b4 0x166cd 0x183f4 0x1bd39 0x179c0 0x194fb 0x199e1 0x43250 0x14b66 0x13ef0 0x13e89 0x3b5753 0x3b5b2f 0x3b5d54 0x3c35c9 0x5c0814 0x392594 0x39221c 0x394563 0x3103b6 0x310554 0x1e87d8 0x27b3014 0x27a37d5 0x192faf5 0x192ef44 0x192ee1b 0x29ea7e3 0x29ea668 0x2d265c 0x22dd 0x2205 0x1)* libc++abi.dylib: terminate called throwing an exception Thank you!

    Read the article

  • Problems with a from CSS

    - by Michael
    I am trying to create a fairly basic form with in my maincontent. I am sure I am coding things incorrectly and it is driving me crazy. Note my code. I get extremely wide vertical spacing in IE 7 and the bacground color between the field sets does not work correctly. All is good in FF. My CSS is: fieldset { margin: 1.5em 0 0 0; padding: 0; border-style: none; border-top: 1px solid #BFBAB0; background-color: #FFFFFF; } legend { margin-left: 1em; color: #000000; font-weight: bold; } fieldset ol { padding: 1em 1em 0 1em; list-style: none; } fieldset li { padding-bottom: 1em; } fieldset.submit { border-style: none; } { var w = document.myform.mylist.selectedIndex; var selected_text = document.myform.mylist.options[w].text; alert(selected_text); } label em { display: block; color: #900; font-size: 85%; font-style: normal; text-transform: uppercase; } This is my html code. <div id="mainContent1"> <form name="myform"> <label for="mylist"><strong>Select an Account Type:</strong></label> <select name="mylist"><option value="traditional">Traditional Account</option> <option value="paperless">Paperless Account</option> </select> </form> <br /><a> </a> <form action="example.php"> <fieldset> <legend>Contact Details</legend> <ol> <li> <label for="name">Name:</label> <input id="name" name="name" class="text" type="text" /> <label for="name"> <em>required</em> </label> </li> <li> <label for="email">Email address:</label> <input id="email" name="email" class="text" type="text" /> <label for="name"> <em>required</em> </li> <li> <label for="phone">Telephone:</label> <input id="phone" name="phone" class="text" type="text" /> <label for="name"> <em>required</em> <ol> <li> <input id="option1" name="option1" class="checkbox" type="checkbox" value="1" /> <label for="option1">Savings</label> </li> <li> <input id="option2" name="option2" class="checkbox" type="checkbox" value="1" /> <label for="option2">Checkings</label> </li> </ol> </fieldset> <fieldset> <legend>Delivery Address</legend> <ol> <li> <label for="address1">Address 1:</label> <input id="address1" name="address1" class="text" type="text" /> </li> <li> <label for="city">City:</label> <input id="city" name="city" class="text" type="text" /> </li> <li> <label for="postcode">Zip Code:</label> <input id="postcode" name="postcode" class="text textSmall" type="text" /> </li> <li> <label for="country">Country:</label> <input id="country" name="country" class="text" type="text" /> </li> </ol> </fieldset> <fieldset class="submit"> <input class="submit" type="submit" value="Submit" /> </fieldset> <fieldset class="clear"> <input class="clear" type="clear" value="Submit" /> </fieldset> </form>

    Read the article

  • c++ to vb.net , problem with callback function

    - by johan
    I'm having a hard time here trying to find a solution for my problem. I'm trying to convert a client API funktion from C++ to VB.NET, and i think have some problems with the callback function. parts of the C++ code: typedef struct{ BYTE m_bRemoteChannel; BYTE m_bSendMode; BYTE m_nImgFormat; // =0 cif ; = 1 qcif char *m_sIPAddress; char *m_sUserName; char *m_sUserPassword; BOOL m_bUserCheck; HWND m_hShowVideo; }CLIENT_VIDEOINFO, *PCLIENT_VIDEOINFO; CPLAYER_API LONG __stdcall MP4_ClientStart(PCLIENT_VIDEOINFO pClientinfo,void(CALLBACK *ReadDataCallBack)(DWORD nPort,UCHAR *pPacketBuffer,DWORD nPacketSize)); void CALLBACK ReadDataCallBack(DWORD nPort,UCHAR *pPacketBuffer,DWORD nPacketSize) { TRACE("%d\n",nPacketSize); } ..... aa5.m_sUserName = "123"; aa5.m_sUserPassword="w"; aa5.m_bUserCheck = TRUE; MP4_ClientSetTTL(64); nn1 = MP4_ClientStart(&aa5,ReadDataCallBack); if (nn1 == -1) { MessageBox("error"); return; } SDK description: MP4_ClientStart This function starts a connection. The format of the call is: LONG __stdcall MP4_ClientStart(PCLIENT_VIDEOINFO pClientinfo, void(*ReadDataCallBack)(DWORD nChannel,UCHAR *pPacketBuffer,DWORD nPacketSize)) Parameters pClientinfo holds the information. of this connection. nChannel holds the channel of card. pPacketBuffer holds the pointer to the receive buffer. nPacketSize holds the length of the receive buffer. Return Values If the function succeeds the return value is the context of this connection. If the function fails the return value is -1. Remarks typedef struct{ BYTE m_bRemoteChannel; BYTE m_bSendMode; BYTE m_bImgFormat; char *m_sIPAddress; char *m_sUserName; char *m_sUserPassword; BOOL m_bUserCheck; HWND m_hShowVideo; } CLIENT_VIDEOINFO, * PCLIENT_VIDEOINFO; m_bRemoteChannel holds the channel which the client wants to connect to. m_bSendMode holds the network mode of the connection. m_bImgFormat : Image format, 0 is main channel video, 1 is sub channel video m_sIPAddress holds the IP address of the server. m_sUserName holds the user’s name. m_sUserPassword holds the user’s password. m_bUserCheck holds the value whether sends the user’s name and password or not. m_hShowVideo holds Handle for this video window. If m_hShowVideo holds NULL, the client can be record only without decoder. If m_bUserCheck is FALSE, we will send m_sUserName and m_sUserPassword as NULL, else we will send each 50 bytes. The length of m_sIPAddress and m_sUserName must be more than 50 bytes. ReadDataCallBack: When the library receives a packet from a server, this callback is called. My VB.Net code: Imports System.Runtime.InteropServices Public Class Form1 Const WM_USER = &H400 Public Structure CLIENT_VIDEOINFO Public m_bRemoteChannel As Byte Public m_bSendMode As Byte Public m_bImgFormat As Byte Public m_sIPAddress As String Public m_sUserName As String Public m_sUserPassword As String Public m_bUserCheck As Boolean Public m_hShowVideo As Long 'hWnd End Structure Public Declare Function MP4_ClientSetNetPort Lib "hikclient.dll" (ByVal dServerPort As Integer, ByVal dClientPort As Integer) As Boolean Public Declare Function MP4_ClientStartup Lib "hikclient.dll" (ByVal nMessage As UInteger, ByVal hWnd As System.IntPtr) As Boolean <DllImport("hikclient.dll")> Public Shared Function MP4_ClientStart(ByVal Clientinfo As CLIENT_VIDEOINFO, ByRef ReadDataCallBack As CALLBACKdel) As Long End Function Public Delegate Sub CALLBACKdel(ByVal nPort As Long, <MarshalAs(UnmanagedType.LPArray)> ByRef pPacketBuffer As Byte(), ByVal nPacketSize As Long) Public Sub CALLBACK(ByVal nPort As Long, <MarshalAs(UnmanagedType.LPArray)> ByRef pPacketBuffer As Byte(), ByVal nPacketSize As Long) End Sub Public mydel As New CALLBACKdel(AddressOf CALLBACK) Private Sub Form1_Load(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles MyBase.Load Dim Clientinfo As New CLIENT_VIDEOINFO() Clientinfo.m_bRemoteChannel = 0 Clientinfo.m_bSendMode = 0 Clientinfo.m_bImgFormat = 0 Clientinfo.m_sIPAddress = "193.168.1.100" Clientinfo.m_sUserName = "1" Clientinfo.m_sUserPassword = "a" Clientinfo.m_bUserCheck = False Clientinfo.m_hShowVideo = Me.Handle 'Nothing MP4_ClientSetNetPort(850, 850) MP4_ClientStartup(WM_USER + 1, Me.Handle) MP4_ClientStart(Clientinfo, mydel) End Sub End Class here is some other examples of the code in: C# http://blog.csdn.net/nenith1981/archive/2007/09/17/1787692.aspx VB ://read.pudn.com/downloads70/sourcecode/graph/250633/MD%E5%AE%A2%E6%88%B7%E7%AB%AF%28VB%29/hikclient.bas__.htm ://read.pudn.com/downloads70/sourcecode/graph/250633/MD%E5%AE%A2%E6%88%B7%E7%AB%AF%28VB%29/Form1.frm__.htm Delphi ://read.pudn.com/downloads91/sourcecode/multimedia/streaming/349759/Delphi_client/Unit1.pas__.htm

    Read the article

  • C++ run error: pointer being freed was not allocated

    - by Dale Reves
    I'm learning c++ and am working on a program that keeps giving me a 'pointer being freed was not allocated' error. It's a grocery store program that inputs data from a txt file, then user can enter item# & qty. I've read through similar questions but what's throwing me off is the 'pointer' issue. I would appreciate if someone could take a look and help me out. I'm using Netbeans IDE 7.2 on a Mac. I'll just post the whole piece I have so far. Thx. #include <iostream> #include <fstream> #include <string> #include <vector> using namespace std; class Product { public: // PLU Code int getiPluCode() { return iPluCode; } void setiPluCode( int iTempPluCode) { iPluCode = iTempPluCode; } // Description string getsDescription() { return sDescription; } void setsDescription( string sTempDescription) { sDescription = sTempDescription; } // Price double getdPrice() { return dPrice; } void setdPrice( double dTempPrice) { dPrice = dTempPrice; } // Type..weight or unit int getiType() { return iType; } void setiType( int iTempType) { iType = iTempType; } // Inventory quantity double getdInventory() { return dInventory; } void setdInventory( double dTempInventory) { dInventory = dTempInventory; } private: int iPluCode; string sDescription; double dPrice; int iType; double dInventory; }; int main () { Product paInventory[21]; // Create inventory array Product paPurchase[21]; // Create customer purchase array // Constructor to open inventory input file ifstream InputInventory ("inventory.txt", ios::in); //If ifstream could not open the file if (!InputInventory) { cerr << "File could not be opened" << endl; exit (1); }//end if int x = 0; while (!InputInventory.eof () ) { int iTempPluCode; string sTempDescription; double dTempPrice; int iTempType; double dTempInventory; InputInventory >> iTempPluCode >> sTempDescription >> dTempPrice >> iTempType >> dTempInventory; paInventory[x].setiPluCode(iTempPluCode); paInventory[x].setsDescription(sTempDescription); paInventory[x].setdPrice(dTempPrice); paInventory[x].setiType(iTempType); paInventory[x].setdInventory(dTempInventory); x++; } bool bQuit = false; //CREATE MY TOTAL VARIABLE HERE! int iUserItemCount; do { int iUserPLUCode; double dUserAmount; double dAmountAvailable; int iProductIndex = -1; //CREATE MY SUBTOTAL VARIABLE HERE! while(iProductIndex == -1) { cout<<"Please enter the PLU Code of the product."<< endl; cin>>iUserPLUCode; for(int i = 0; i < 21; i++) { if(iUserPLUCode == paInventory[i].getiPluCode()) { dAmountAvailable = paInventory[i].getdInventory(); iProductIndex = i; } } //PLU code entry validation if(iProductIndex == -1) { cout << "You have entered an invalid PLU Code."; } } cout<<"Enter the quantity to buy.\n"<< "There are "<< dAmountAvailable << "available.\n"; cin>> dUserAmount; while(dUserAmount > dAmountAvailable) { cout<<"That's too many, please try again"; cin>>dUserAmount; } paPurchase[iUserItemCount].setiPluCode(iUserPLUCode);// Array of objects function calls paPurchase[iUserItemCount].setdInventory(dUserAmount); paPurchase[iUserItemCount].setdPrice(paInventory[iProductIndex].getdPrice()); paInventory[iProductIndex].setdInventory( paInventory[iProductIndex].getdInventory() - dUserAmount ); iUserItemCount++; cout <<"Are you done purchasing items? Enter 1 for yes and 0 for no.\n"; cin >> bQuit; //NOTE: Put Amount * quantity for subtotal //NOTE: Put code to update subtotal (total += subtotal) // NOTE: Need to create the output txt file! }while(!bQuit); return 0; }

    Read the article

< Previous Page | 692 693 694 695 696 697 698 699 700 701 702 703  | Next Page >