Search Results

Search found 6622 results on 265 pages for 'match'.

Page 7/265 | < Previous Page | 3 4 5 6 7 8 9 10 11 12 13 14  | Next Page >

  • rsync --remove-source-files but only those that match a pattern

    - by user28146
    Is this possible with rsync? Transfer everything from src:path/to/dir to dest:/path/to/other/dir and delete some of the source files in src:path/to/dir that match a pattern (or size limit) but keep all other files. I couldn't find a way to limit --remove-source-files with a regexp or size limit. Update1 (clarification): I'd like all files in src:path/to/dir to be copied to dest:/path/to/other/dir. Once this is done, I'd like to have some files (those that match a regexp or size limit) in src:path/to/dir deleted but don't want to have anything deleted in dest:/path/to/other/dir. Update2 (more clarification): Unfortunately, I can't simply rsync everything and then manually delete the files matching my regexp from src:. The files to be deleted are continuously created. So let's say there are N files of the type I'd like to delete after the transfer in src: when rsync starts. By the time rsync finishes there will be N+M such files there. If I now delete them manually, I'll lose the M files that were created while rsync was running. Hence I'd like to have a solution that guarantees that the only files deleted from src: are those known to be successfully copied over to dest:. I could fetch a file list from dest: after the rsync is complete, and compare that list of files with what I have in src:, and then do the removal manually. But I was wondering if rsync can do this by itself.

    Read the article

  • Using perl's Regexp::Grammars, how do I make a capture dependent on $MATCH?

    - by Evan Carroll
    I've got a token like such: <delim2=((?{ $MATCH{delim} }))> and what I want to happen is for delim2 to capture and be set to the value of delim. When I run this, delim2 is set, but the capture is never done. I think this is an error in my reasoning: I'm trying to chain this form: <ALIAS= ( PATTERN )> Match pattern, save match in $MATCH{ALIAS} and this form: (?{ MATCH{delim} }) into something like this <ALIAS= ( (?{MATCH{delim}) )> Matches the value of $MATCH{delim} save to $MATCH{delim2} but this simply doesn't seem valid. I can verify my original token works <delim2=((?{ die $MATCH{delim} }))> will die with the value, and, if I hard code it, I get the right capture and everything works <delim2=(')>? So how do I go about achieving sane results, while having a dynamic pattern?

    Read the article

  • Bug in Delphi XE RegularExpressions Unit

    - by Jan Goyvaerts
    Using the new RegularExpressions unit in Delphi XE, you can iterate over all the matches that a regex finds in a string like this: procedure TForm1.Button1Click(Sender: TObject); var RegEx: TRegEx; Match: TMatch; begin RegEx := TRegex.Create('\w+'); Match := RegEx.Match('One two three four'); while Match.Success do begin Memo1.Lines.Add(Match.Value); Match := Match.NextMatch; end end; Or you could save yourself two lines of code by using the static TRegEx.Match call: procedure TForm1.Button2Click(Sender: TObject); var Match: TMatch; begin Match := TRegEx.Match('One two three four', '\w+'); while Match.Success do begin Memo1.Lines.Add(Match.Value); Match := Match.NextMatch; end end; Unfortunately, due to a bug in the RegularExpressions unit, the static call doesn’t work. Depending on your exact code, you may get fewer matches or blank matches than you should, or your application may crash with an access violation. The RegularExpressions unit defines TRegEx and TMatch as records. That way you don’t have to explicitly create and destroy them. Internally, TRegEx uses TPerlRegEx to do the heavy lifting. TPerlRegEx is a class that needs to be created and destroyed like any other class. If you look at the TRegEx source code, you’ll notice that it uses an interface to destroy the TPerlRegEx instance when TRegEx goes out of scope. Interfaces are reference counted in Delphi, making them usable for automatic memory management. The bug is that TMatch and TGroupCollection also need the TPerlRegEx instance to do their work. TRegEx passes its TPerlRegEx instance to TMatch and TGroupCollection, but it does not pass the instance of the interface that is responsible for destroying TPerlRegEx. This is not a problem in our first code sample. TRegEx stays in scope until we’re done with TMatch. The interface is destroyed when Button1Click exits. In the second code sample, the static TRegEx.Match call creates a local variable of type TRegEx. This local variable goes out of scope when TRegEx.Match returns. Thus the reference count on the interface reaches zero and TPerlRegEx is destroyed when TRegEx.Match returns. When we call MatchAgain the TMatch record tries to use a TPerlRegEx instance that has already been destroyed. To fix this bug, delete or rename the two RegularExpressions.dcu files and copy RegularExpressions.pas into your source code folder. Make these changes to both the TMatch and TGroupCollection records in this unit: Declare FNotifier: IInterface; in the private section. Add the parameter ANotifier: IInterface; to the Create constructor. Assign FNotifier := ANotifier; in the constructor’s implementation. You also need to add the ANotifier: IInterface; parameter to the TMatchCollection.Create constructor. Now try to compile some code that uses the RegularExpressions unit. The compiler will flag all calls to TMatch.Create, TGroupCollection.Create and TMatchCollection.Create. Fix them by adding the ANotifier or FNotifier parameter, depending on whether ARegEx or FRegEx is being passed. With these fixes, the TPerlRegEx instance won’t be destroyed until the last TRegEx, TMatch, or TGroupCollection that uses it goes out of scope or is used with a different regular expression.

    Read the article

  • Address Match Key Algorithm

    - by sestocker
    I have a list of addresses in two separate tables that are slightly off that I need to be able to match. For example, the same address can be entered in multiple ways: 110 Test St 110 Test St. 110 Test Street Although simple, you can imagine the situation in more complex scenerios. I am trying to develop a simple algorithm that will be able to match the above addresses as a key. For example. the key might be "11TEST" - first two of 110, first two of Test and first two of street variant. A full match key would also include first 5 of the zipcode as well so in the above example, the full key might look like "11TEST44680". I am looking for ideas for an effective algorithm or resources I can look at for considerations when developing this. Any ideas can be pseudo code or in your language of choice. We are only concerned with US addresses. In fact, we are only looking at addresses from 250 zip codes from Ohio and Michigan. We also do not have access to any postal software although would be open to ideas for cost effective solutions (it would essentially be a one time use). Please be mindful that this is an initial dump of data from a government source so suggestions of how users can clean it are helpful as I build out the application but I would love to have the best initial I possibly can by being able to match addresses as best as possible.

    Read the article

  • C# Regex - Match and replace, Auto Increment

    - by Marc Still
    I have been toiling with a problem and any help would be appreciated. Problem: I have a paragraph and I want to replace a variable which appears several times (Variable = @Variable). This is the easy part, but the portion which I am having difficulty is trying to replace the variable with different values. I need for each occurrence to have a different value. For instance, I have a function that does a calculation for each variable. What I have thus far is below: private string SetVariables(string input, string pattern){ Regex rx = new Regex(pattern); MatchCollection matches = rx.Matches(input); int i = 1; if(matches.Count > 0) { foreach(Match match in matches) { rx.Replace(match.ToString(), getReplacementNumber(i)); i++ } } I am able to replace each variable that I need to with the number returned from getReplacementNumber(i) function, but how to I put it back into my original input with the replaced values, in the same order found in the match collection? Thanks in advance! Marcus

    Read the article

  • Match subpatterns in any order

    - by Yaroslav
    I have long regexp with two complicated subpatters inside. How i can match that subpatterns in any order? Simplified example: /(apple)?\s?(banana)?\s?(orange)?\s?(kiwi)?/ and i want to match both of apple banana orange kiwi apple orange banana kiwi It is very simplified example. In my case banana and orange is long complicated subpatterns and i don't want to do something like /(apple)?\s?((banana)?\s?(orange)?|(orange)?\s?(banana)?)\s?(kiwi)?/ Is it possible to group subpatterns like chars in character class? UPD Real data as requested: 14:24 26,37 Mb 108.53 01:19:02 06.07 24.39 19:39 46:00 my strings much longer, but it is significant part. Here you can see two lines what i need to match. First has two values: length (14 min 24 sec) and size 26.37 Mb. Second one has three values but in different order: size 108.53 Mb, length 01 h 19 m 02 s and date June, 07 Third one has two size and length Fourth has only length There are couple more variations and i need to parse all values. I have a regexp that pretty close except i can't figure out how to match patterns in different order without writing it twice. (?<size>\d{1,3}\[.,]\d{1,2}\s+(?:Mb)?)?\s? (?<length>(?:(?:01:)?\d{1,2}:\d{2}))?\s* (?<date>\d{2}\.\d{2}))? NOTE: that is only part of big regexp that forks fine already.

    Read the article

  • MySQL "OR MATCH" hangs (very slow) on multiple tables

    - by Kerry
    After learning how to do MySQL Full-Text search, the recommended solution for multiple tables was OR MATCH and then do the other database call. You can see that in my query below. When I do this, it just gets stuck in a "busy" state, and I can't access the MySQL database. SELECT a.`product_id`, a.`name`, a.`slug`, a.`description`, b.`list_price`, b.`price`, c.`image`, c.`swatch`, e.`name` AS industry, MATCH( a.`name`, a.`sku`, a.`description` ) AGAINST ( '%s' IN BOOLEAN MODE ) AS relevance FROM `products` AS a LEFT JOIN `website_products` AS b ON (a.`product_id` = b.`product_id`) LEFT JOIN ( SELECT `product_id`, `image`, `swatch` FROM `product_images` WHERE `sequence` = 0) AS c ON (a.`product_id` = c.`product_id`) LEFT JOIN `brands` AS d ON (a.`brand_id` = d.`brand_id`) INNER JOIN `industries` AS e ON (a.`industry_id` = e.`industry_id`) WHERE b.`website_id` = %d AND b.`status` = %d AND b.`active` = %d AND MATCH( a.`name`, a.`sku`, a.`description` ) AGAINST ( '%s' IN BOOLEAN MODE ) OR MATCH ( d.`name` ) AGAINST ( '%s' IN BOOLEAN MODE ) GROUP BY a.`product_id` ORDER BY relevance DESC LIMIT 0, 9 Any help would be greatly appreciated. EDIT All the tables involved are MyISAM, utf8_general_ci. Here's the EXPLAIN SELECT statement: id select_type table type possible_keys key key_len ref rows Extra 1 PRIMARY a ALL NULL NULL NULL NULL 16076 Using temporary; Using filesort 1 PRIMARY b ref product_id product_id 4 database.a.product_id 2 1 PRIMARY e eq_ref PRIMARY PRIMARY 4 database.a.industry_id 1 1 PRIMARY <derived2> ALL NULL NULL NULL NULL 23261 1 PRIMARY d eq_ref PRIMARY PRIMARY 4 database.a.brand_id 1 Using where 2 DERIVED product_images ALL NULL NULL NULL NULL 25933 Using where I don't know how to make that look neater -- sorry about that UPDATE it returns the query after 196 seconds (I think correctly). The query without multiple tables takes about .56 seconds (which I know is really slow, we plan on changing to solr or sphinx soon), but 196 seconds?? If we could add a number to the relevance if it was in the brand name ( d.name ), that would also work

    Read the article

  • xsl:template match doesn't find matches

    - by dmo
    I'm trying to convert some Xaml to HTML using the .NET XslCompiledTransform and am running into difficulties getting the xslt to match Xaml tags. For instance with this Xaml input: <FlowDocument PagePadding="5,0,5,0" AllowDrop="True" NumberSubstitution.CultureSource="User" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation"> <Paragraph>a</Paragraph> </FlowDocument> And this xslt: <?xml version="1.0" encoding="utf-8"?> <xsl:stylesheet version="1.0" xmlns:xsl="http://www.w3.org/1999/XSL/Transform" xmlns:msxsl="urn:schemas-microsoft-com:xslt" exclude-result-prefixes="msxsl" > <xsl:output method="html" indent="yes"/> <xsl:template match="/"> <html> <body> <xsl:apply-templates /> </body> </html> </xsl:template> <xsl:template match="FlowDocument"> <xsl:apply-templates /> </xsl:template> <xsl:template match="Paragraph" > <p> <xsl:apply-templates /> </p> </xsl:template> I get this output: <html> <body> a </body> </html> Rather than the expected: <html> <body> <p>a</p> </body> </html> Could this be a problem with the namespace? This is my first attempt at an xsl transform, so I'm at a loss.

    Read the article

  • Match Hard Disk Partition Table?

    - by MA1
    What is the most efficient way to match the partition tables on two different hard disks? I have saved the partition tables using dd command in linux. The partition tables are from a Windows system.

    Read the article

  • Match Hard Dusk Partition Table?

    - by MA1
    Hi All What is the efficient way to match the two different hard disk partition tables? I have save the partition tables using dd command in linux. The partition tables are from Windows system. Regards,

    Read the article

  • Iptables rule creation error: No chain/target/match by that name

    - by MikO
    I'm trying to create my first VPN on a VPS with CentOS 6, following this tutorial. When I have to create an iptables rule to allow proper routing of VPN subnet, with this command: iptables -t nat -A POSTROUTING -s 10.8.0.0/24 -o eth0 -j MASQUERADE It throws this error: iptables: No chain/target/match by that name I was searching and I've found that this error is usually thrown when you misspell something, but as far as I understand, the rule is correct...

    Read the article

  • Compare 2 sets of data in Excel and returning a value when multiple columns match

    - by Susan C
    I have a data set for employees that contains name and 3 attributes (job function, job grade and location). I then have a data set for open positions that contains the requisition number and 3 attributes (job function, job grade and job location). For every employee, i would like the three attributes associated with them compared to the same three attributes of the open positions and have the cooresponding requisition numbers displayed for each employee where there is a match.

    Read the article

  • PHP ssh2_fingerprint() does not match ssh-keygen -lf id_rsa.pub

    - by Justin
    I am using the lib ssh2 module with PHP and calling the function ssh2_fingerprint() to get the keys fingerprint. According to all resources on the internet, I can get the fingerprint of a public key by executing: ssh-keygen -lf id_rsa.pub Which outputs something like: 2048 d4:41:3b:45:00:49:4e:fc:2c:9d:3a:f7:e6:6e:bf:e7 id_rsa.pub (RSA) However, when I call ssh2_fingerprint($connection, SSH2_FINGERPRINT_HEX) in PHP with the same public key I get: dddddba52352e5ab95711c10fdd56f43 Shouldn't they match? What am I missing?

    Read the article

  • How to match against multiple value possiblities in Excel

    - by Henno
    I have list of person names in column A. I want to display "1" in column B for names which end with either "e" or "i" or "n". If there would be only one match to test against, I would write something like: =IF( MID(A1,FIND(" ",B1)-1,1) = "e", "1", "0") In PHP I would solve that like this: echo in_array( $names[$row_number], array('e', 'i', 'n') ) ? '1' : '0'; What formula should I use in column B in Excel?

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

  • perl like sed + match word and replace

    - by yael
    Is it possible to change the perl syntax (described down) to replace "a" string in the line that match "param1" as the following example: more test param1=a a param2=b b aa bb a b aa bb [root@localhost tmp]# perl -pe "s/\b$a\b/$b/g unless /^#/" test param1=asdfghj asdfghj (this line shuld not be chaged) param2=b b aa bb a b aa bb [root@localhost tmp]# The right output param1=asdfghj a param2=b b aa bb a b aa bb [root@localhost tmp]#

    Read the article

  • XSL using apply templates and match instead of call template

    - by AdRock
    I am trying to make the transition from using call-template to using applay templates and match but i'm not getting any data displayed only what is between the volunteer tags. When i use call template it works fine but it was suggested that i use applay-templates and match and not it doesn't work Any ideas how to make this work? I can then applay it to all my stylesheets. <?xml version="1.0" encoding="ISO-8859-1"?> <xsl:stylesheet version="1.0" xmlns:xsl="http://www.w3.org/1999/XSL/Transform"> <xsl:key name="volunteers-by-region" match="volunteer" use="region" /> <xsl:template name="hoo" match="/"> <html> <head> <title>Registered Volunteers</title> <link rel="stylesheet" type="text/css" href="volunteer.css" /> </head> <body> <h1>Registered Volunteers</h1> <h3>Ordered by the username ascending</h3> <h3>Grouped by the region</h3> <xsl:for-each select="folktask/member[user/account/userlevel='2']"> <xsl:for-each select="volunteer[count(. | key('volunteers-by-region', region)[1]) = 1]"> <xsl:sort select="region" /> <xsl:for-each select="key('volunteers-by-region', region)"> <xsl:sort select="folktask/member/user/personal/name" /> <div class="userdiv"> <xsl:apply-templates/> <!--<xsl:call-template name="member_userid"> <xsl:with-param name="myid" select="../user/@id" /> </xsl:call-template> <xsl:call-template name="member_name"> <xsl:with-param name="myname" select="../user/personal/name" /> </xsl:call-template>--> </div> </xsl:for-each> </xsl:for-each> </xsl:for-each> <xsl:if test="position()=last()"> <div class="count"><h2>Total number of volunteers: <xsl:value-of select="count(/folktask/member/user/account/userlevel[text()=2])"/></h2></div> </xsl:if> </body> </html> </xsl:template> <xsl:template match="folktask/member"> <xsl:apply-templates select="user/@id"/> <xsl:apply-templates select="user/personal/name"/> </xsl:template> <xsl:template match="user/@id"> <div class="heading bold"><h2>USER ID: <xsl:value-of select="." /></h2></div> </xsl:template> <xsl:template match="user/personal/name"> <div class="small bold">NAME:</div> <div class="large"><xsl:value-of select="." /></div> </xsl:template> </xsl:stylesheet> and my xml file <folktask xmlns:xs="http://www.w3.org/2001/XMLSchema-instance" xs:noNamespaceSchemaLocation="folktask.xsd"> <member> <user id="1"> <personal> <name>Abbie Hunt</name> <sex>Female</sex> <address1>108 Access Road</address1> <address2></address2> <city>Wells</city> <county>Somerset</county> <postcode>BA5 8GH</postcode> <telephone>01528927616</telephone> <mobile>07085252492</mobile> <email>[email protected]</email> </personal> <account> <username>AdRock</username> <password>269eb625e2f0cf6fae9a29434c12a89f</password> <userlevel>4</userlevel> <signupdate>2010-03-26T09:23:50</signupdate> </account> </user> <volunteer id="1"> <roles></roles> <region>South West</region> </volunteer> </member> <member> <user id="2"> <personal> <name>Aidan Harris</name> <sex>Male</sex> <address1>103 Aiken Street</address1> <address2></address2> <city>Chichester</city> <county>Sussex</county> <postcode>PO19 4DS</postcode> <telephone>01905149894</telephone> <mobile>07784467941</mobile> <email>[email protected]</email> </personal> <account> <username>AmbientExpert</username> <password>8e64214160e9dd14ae2a6d9f700004a6</password> <userlevel>2</userlevel> <signupdate>2010-03-26T09:23:50</signupdate> </account> </user> <volunteer id="2"> <roles>Van Driver</roles> <region>South Central</region> </volunteer> </member> <member> <user id="3"> <personal> <name>Skye Saunders</name> <sex>Female</sex> <address1>31 Anns Court</address1> <address2></address2> <city>Cirencester</city> <county>Gloucestershire</county> <postcode>GL7 1JG</postcode> <telephone>01958303514</telephone> <mobile>07260491667</mobile> <email>[email protected]</email> </personal> <account> <username>BigUndecided</username> <password>ea297847f80e046ca24a8621f4068594</password> <userlevel>2</userlevel> <signupdate>2010-03-26T09:23:50</signupdate> </account> </user> <volunteer id="3"> <roles>Scaffold Erector</roles> <region>South West</region> </volunteer> </member> </folktask>

    Read the article

  • Having trouble with match wildcards in array

    - by Senthil
    I've a master text file and exceptions file and I want to match all the words in exception file with master file and increase counter, but the trick is with wildcards. I'm able to do without wildcards with this: words = %w(aaa aab acc ccc AAA) stop = %q(/aa./) words.each do |x| if x.match(/aa./) puts "yes for #{x}" else puts "no for #{x}" end end = yes for aaa yes for aab no for acc no for ccc yes for AAA Also which would be the best way to go about this, using arrays or some other way. Edit: Sorry for the confusion. Yes stop has multiple wildcards and I want to match all words based on those wildcards. words = %w(aaa aab acc ccc AAA) stop = %q(aa* ac* ab*) Thanks

    Read the article

  • How to use regex to match ASTERISK in awk

    - by Ken Chen
    I'm stil pretty new to regular expression and just started learning to use awk. What I am trying to accomplish is writing a ksh script to read-in lines from text, and and for every lines that match the following: *RECORD 0000001 [some_serial_#] to replace $2 (i.e. 000001) with a different number. So essentially the script read in batch record dump, and replace the record number with date+record#, and write to separate file. So this is what I'm thinking the format should be: awk 'match($0,"/*FTR")!=0{$2="$DATE-n++"; print $0} match($0,"/*FTR")==0{print $0}' $BATCH > $OUTPUT but obviously "/*FTR" is not going to work, and I'm not sure if changing $2 and then write the whole line is the correct way to do this. So I am in need of some serious enlightenment.

    Read the article

  • Match d-M-Y with javascript regex how?

    - by bakerjr
    Hi, my date formatting in PHP is d-M-Y and I'm trying to match the dates with a javascript regex: s.match(new RegExp(/^(\d{1,2})(\-)(\w{3})(\-)(\d{4})$/)) To be used with the jQuery plugin, tablesorter. The problem is it's not working and I'm wondering why not. I tried removing the dashes in my date() formatting (d M Y) and tried the ff and it worked: s.match(new RegExp(/^\d{1,2}[ ]\w{3}[ ]\d{4}$/)); My question is what is the correct regex if I'm using dashes on PHP's date() i.e. d-M-Y? Thanks!

    Read the article

  • regex to match postgresql bytea

    - by filiprem
    In PostgreSQL, there is a BLOB datatype called bytea. It's just an array of bytes. bytea literals are output in the following way: '\\037\\213\\010\\010\\005`Us\\000\\0001.fp3\'\\223\\222%' See PostgreSQL docs for full definition of the format. I'm trying to construct a Perl regular expression which will match any such string. It should also match standard ANSI SQL string literals, like 'Joe', 'Joe''s Mom', 'Fish Called ''Wendy''' It should also match backslash-escaped variant: 'Joe\'s Mom', . First aproach (shown below) works only for some bytea representations. s{ ' # Opening apostrophe (?: # Start group [^\\\'] # Anything but a backslash or an apostrophe | # or \\ . # Backslash and anything | # or \'\' # Double apostrophe )* # End of group ' # Closing apostrophe }{LITERAL_REPLACED}xgo; For other (longer ones, with many escaped apostrophes, Perl gives such warning: Complex regular subexpression recursion limit (32766) exceeded at ./sqa.pl line 33, < line 1. So I am looking for a better (but still regex-based) solution, it probably requires some regex alchemy (avoiding backreferences and all).

    Read the article

  • Strange behavior: Dynamic expressions with RegExp Object in RegExp.match (Javascript)

    - by NeDark
    I have detect a strange behavior in regexps created with the RegExp object: With this code: var exp1 = /./; var exp2 = new RegExp('.'); ? var test1 = exp1.test('large\n\ntext..etc.'); var test2 = exp2.test('large\n\ntext..etc.'); ? var match1 = 'large\n\ntext..etc.'.match(exp1); var match2 = 'large\n\ntext..etc.'.match(exp2); ...the result is: test1 = true test2 = true ? match1 = 'l' (first match) match2 = null With the regexp maked with the regexp object from a string it finds nothing... Why does this happends? Thanks!!

    Read the article

  • How to regex match text with different endings?

    - by Mint
    This is what I have at the moment. <h2>header</h2>\n +<p>(.*)<br />|</p> ^ that is a tab space, didn't know if there was a better way to represent one or more (it seems to work) Im trying to match the 'bla bla.' text, but my current regex doesn't quite work, it will match most of the line, but I want it to match the first <h2>Information</h2> <p>bla bla.<br /><br /><a href="http://www.google.com">google</a><br /> or <h2>Information</h2> <p>bla bla.</p> other code... Oh and my php code: preg_match('#h2>header</h2>\n +<p>(.*)<br />|</p>#', $result, $postMessage);

    Read the article

< Previous Page | 3 4 5 6 7 8 9 10 11 12 13 14  | Next Page >